Our database now contains whois records of 606 Million (606,000,328) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [606 Million Domains] $10,000 Details

Keyword: BAKER

Reverse Whois » KEYWORD [baker ]  { 47,022 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1baker.edu-26 Feb 199210 Apr 201731 Jul 2018
2baker.comNetwork Solutions, LLC11 Jan 199410 Jan 202210 Jan 2032
3baker.proEpik Inc.16 Oct 202030 Nov 202416 Oct 2025
4baker.infoEasyspace LTD12 Sep 200118 Aug 202412 Sep 2025
5baker.supplyGoDaddy.com, LLC25 Jun 20149 Jul 202425 Jun 2025
6baker.gopMinds + Machines Registrar Limited7 Jul 20147 Jul 20147 Jul 2015
7baker.instituteCSC Corporate Domains, Inc.24 Jul 201430 Jun 202424 Jul 2025
8baker.votingRegistryGate GmbH23 Jul 2014-23 Jul 2015
9baker.university1API GmbH30 Jul 201431 Jul 201430 Jul 2015
10baker.technologyNetwork Solutions, LLC20 Sep 201420 Sep 201420 Sep 2015
11baker.capitalDynadot, LLC25 Oct 201426 Oct 201425 Oct 2015
12baker.worldGoDaddy.com, LLC1 Apr 201615 Jul 20241 Apr 2025
13baker.constructioneNom, Inc.9 Jan 201511 Mar 20179 Jan 2018
14baker.berlinAscio Technologies, Inc. Danmark - Filial af Ascio…24 Oct 202027 Dec 202224 Oct 2025
15baker.lifeXiamen ChinaSource Internet Service Co., Ltd.24 Aug 202228 Aug 202424 Aug 2025
16baker.propertyUniregistrar Corp31 Jan 201517 Mar 201731 Jan 2018
17baker.ninjaTucows Domains Inc.22 Jul 202026 Jul 202422 Jul 2025
18baker.graphicsGoDaddy.com, LLC5 Mar 20155 Mar 20155 Mar 2016
19baker.globalGoDaddy.com, LLC16 Jun 201621 Oct 202416 Jun 2025
20baker.partnersGoDaddy.com, LLC20 Jun 202231 Aug 202320 Jun 2023
21baker.financialGoDaddy.com, LLC23 Oct 20237 Dec 202423 Oct 2025
22baker.accountantsSuper Registry Inc.19 Mar 201519 Mar 201519 Mar 2016
23baker.recipesDynadot, LLC11 Oct 202416 Oct 202411 Oct 2025
24baker.managementNameCheap, Inc.20 Mar 202425 Mar 202420 Mar 2029
25baker.communityGoDaddy.com, LLC3 Apr 201514 Jun 20233 Apr 2023
26baker.walesMesh Digital Limited23 Nov 20229 Jun 202423 Nov 2027
27baker.moscowRegional Network Information Center, JSC dba RU-CE…31 Mar 201531 Mar 201531 Mar 2016
28baker.legalGoDaddy.com, LLC31 Mar 20158 Jul 202431 Mar 2025
29baker.picsReserved for non-billable transactions where Regis…15 Jun 2024-15 Jun 2025
30baker.flowersUniregistrar Corp7 Apr 20157 Apr 20157 Apr 2016
31baker.rocksNameCheap, Inc.12 Sep 201618 Aug 202412 Sep 2025
32baker.bioKey-Systems, LLC24 Apr 201520 May 201524 Apr 2016
33baker.amsterdamMetaregistrar BV Applications29 May 201527 Nov 202429 May 2025
34baker.wtfNameCheap, Inc.14 Aug 202020 Jul 202414 Aug 2025
35baker.sexyeNom, Inc.26 May 20152 May 201726 May 2018
36baker.pubChengdu West Dimension Digital Technology Co., Ltd…10 Sep 20163 Mar 201810 Sep 2019
37baker.beerCloudFlare, Inc.7 Jul 201522 Jan 20237 Jul 2029
38baker.helpUniregistrar Corp11 Jul 201511 Jul 201511 Jul 2016
39baker.wangeName Technology Co., Ltd.21 Jul 201514 Jun 201721 Jul 2018
40baker.inkNameCheap, Inc.8 Feb 20258 Feb 20258 Feb 2026
41baker.systemsNameCheap, Inc.5 Aug 201511 Jul 20245 Aug 2025
42baker.supportCloudFlare, Inc.5 Aug 201511 Jul 20245 Aug 2025
43baker.coffeeCloudFlare, Inc.6 Aug 201512 Jul 20246 Aug 2025
44baker.techCloudFlare, Inc.14 Aug 201531 Aug 202314 Aug 2029
45baker.partyNameCheap, Inc.29 Mar 201914 Apr 202429 Mar 2024
46baker.industriesTucows Domains Inc.19 Aug 201523 Aug 202419 Aug 2025
47baker.churchNetwork Solutions, LLC21 May 20205 Jul 202421 May 2025
48baker.furnitureRegional Network Information Center, JSC dba RU-CE…16 Sep 202320 Sep 202416 Sep 2025
49baker.footballGoDaddy.com, LLC19 Sep 20153 Nov 201919 Sep 2020
50baker.centerChengdu West Dimension Digital Technology Co., Ltd…9 Jan 20229 Jan 20249 Jan 2025
51baker.foundationNetwork Solutions, LLC28 Oct 202212 Dec 202428 Oct 2025
52baker.xn--6qq986b3xlBizcn.com, Inc.13 Nov 201513 Nov 201513 Nov 2016
53baker.workGoDaddy.com, LLC16 Nov 201530 Nov 202416 Nov 2024
54baker.law101domain, Inc.28 Oct 20153 Sep 202428 Oct 2025
55baker.cityChengdu West Dimension Digital Technology Co., Ltd…18 Apr 202122 Apr 202418 Apr 2025
56baker.loveNameCheap, Inc.11 Oct 202316 Sep 202411 Oct 2025
57baker.ovhOVH sas30 Aug 20244 Sep 202430 Aug 2025
58baker.redCSL Computer Service Langenbach GmbH d/b/a joker.c…8 Jan 201622 Feb 20258 Jan 2035
59baker.plus-15 Jun 202430 Aug 202415 Jun 2025
60baker.vinUniregistrar Corp11 Feb 20163 Feb 202511 Feb 2026
61baker.pressNameCheap, Inc.2 Mar 20162 Mar 20162 Mar 2017
62baker.ren-17 Mar 201617 Mar 201617 Mar 2017
63baker.todayGoDaddy.com, LLC12 Sep 202127 Oct 202412 Sep 2025
64baker.cloudPorkbun, LLC20 Apr 201628 Mar 202420 Apr 2025
65baker.collegeGoDaddy.com, LLC9 Mar 20207 Jun 20249 Mar 2025
66baker.photoNameCheap, Inc.29 Mar 201929 Mar 201929 Mar 2020
67baker.worksGoDaddy.com, LLC9 May 201616 Jul 20249 May 2025
68baker.xin-23 Apr 201623 Apr 201623 Apr 2017
69baker.vipChengdu West Dimension Digital Technology Co., Ltd…20 May 201610 Jul 202420 May 2025
70baker.ltdChengdu West Dimension Digital Technology Co., Ltd…7 Sep 202424 Nov 20247 Sep 2025
71baker.teameNom, Inc.29 Jun 20163 Jun 202429 Jun 2025
72baker.venturesGoDaddy.com, LLC7 May 20142 Jul 20247 May 2025
73baker.galleryGoDaddy.com, LLC20 Feb 201430 Jun 202420 Feb 2026
74baker.photographyGoDaddy.com, LLC12 Feb 201429 Jun 202412 Feb 2026
75baker.lolNameCheap, Inc.20 Sep 201814 Nov 202420 Sep 2025
76baker.internationalGo Montenegro Domains, LLC9 Apr 20146 Jun 20249 Apr 2025
77baker.houseGoDaddy.com, LLC23 Dec 20183 Feb 202523 Dec 2024
78baker.host-13 Jul 201613 Jul 201613 Jul 2017
79baker.solutionsDynadot, LLC11 Jun 202412 Dec 202411 Jun 2025
80baker.emailGo Montenegro Domains, LLC23 Mar 20146 Jun 202423 Mar 2026
81baker.inDynadot, LLC3 May 201217 May 20243 May 2025
82baker.jobsName Share, Inc.4 Feb 201020 Mar 20164 Feb 2017
83baker.marketingPorkbun, LLC27 Mar 20241 Apr 202427 Mar 2025
84baker.properties-21 Nov 20231 Feb 202521 Nov 2024
85baker.condosGoDaddy.com, LLC4 Jun 201419 Jul 20244 Jun 2025
86baker.coolGoDaddy.com, LLC5 Apr 20181 Aug 20245 Apr 2025
87baker.consultingCloudFlare, Inc.5 Mar 202123 Jan 20255 Mar 2026
88baker.bizEasyspace LTD27 Mar 20021 Apr 201926 Mar 2029
89baker.groupeNom, Inc.19 Dec 201819 Mar 202419 Dec 2025
90baker.scienceNameCheap, Inc.13 Jul 201818 Jun 201913 Jul 2020
91baker.menPorkbun, LLC17 Nov 20173 Jan 202517 Nov 2025
92baker.holdingsTucows Domains Inc.20 Sep 201624 Sep 202420 Sep 2025
93baker.expressGoDaddy.com, LLC27 Sep 201611 Nov 201927 Sep 2020
94baker.toolsGoDaddy.com, LLC24 Jan 201925 Jan 202524 Jan 2026
95baker.rentalsGoogle, Inc.15 Feb 20236 Feb 202515 Feb 2026
96baker.limitedeNom, Inc.9 Oct 201620 Nov 20179 Oct 2017
97baker.fyiCloudFlare, Inc.28 Dec 20242 Jan 202528 Dec 2025
98baker.netNetwork Solutions, LLC28 May 199728 Mar 202427 May 2027
99baker.orgNetwork Solutions, LLC27 Jun 19941 Jul 202226 Jun 2032
100baker.usGoDaddy.com, LLC20 Apr 200225 Apr 202419 Apr 2025
101baker.xxx-1 Dec 201130 Jan 20121 Dec 2021
102baker.xyzGoDaddy.com, LLC2 Jun 201429 Aug 20242 Jun 2025
103baker.telGlobal Domains International, Inc. DBA DomainCostC…24 Apr 20128 Jun 202423 Apr 2025
104baker.by-16 Apr 20105 Mar 202420 Apr 2025
105baker.be-21 Jul 2003--
106baker.ccDynadot, LLC24 Oct 201724 Oct 202324 Oct 2026
107baker.engineerNameCheap, Inc.26 Oct 20161 Oct 202426 Oct 2025
108baker.caNamespro Solutions Inc.7 Apr 20104 Apr 20247 Apr 2025
109baker.de--27 Feb 2019-
110baker.fr1API GmbH3 Jun 200430 Nov 20249 Oct 2025
111baker.itAcens Technologies, S.L.U.14 Nov 200330 Nov 202414 Nov 2025
112baker.kr-13 Mar 200717 Oct 201713 Mar 2018
113baker.meGoDaddy.com, LLC29 Apr 200822 Jun 202429 Apr 2025
114baker.com.pl-18 Jan 201515 Jan 201718 Jan 2018
115baker.pl-9 Jul 201011 Aug 20179 Jul 2018
116baker.pweNom, Inc.3 Dec 201218 Oct 201631 Mar 2017
117baker.co.uk-24 Dec 20024 Jul 202424 Dec 2030
118baker.guruGoogle, Inc.23 Mar 20212 Jun 202423 Mar 2026
119baker.tvFabulous.com Pty Ltd.2 Mar 201616 Apr 20242 Mar 2025
120baker.digitaleNom, Inc.17 Mar 201726 Feb 202417 Mar 2025
121baker.educationGoogle, Inc.10 Apr 20171 Jul 202410 Apr 2025
122baker.zoneAutomattic Inc.13 May 20195 Nov 202313 May 2025
123baker.mediaGoDaddy.com, LLC28 May 201724 Jul 202428 May 2025
124baker.mobiGoDaddy.com, LLC8 Jun 201724 Jul 20248 Jun 2026
125baker.estateGoDaddy.com, LLC18 Jun 20176 Jan 201818 Jun 2018
126baker.us.comeNom, Inc.27 Dec 20058 Jan 202527 Dec 2025
127baker.watchName.com, Inc.28 Nov 202322 Nov 202428 Nov 2024
128baker.uk-10 Jun 20144 Jul 202410 Jun 2031
129baker.me.uk-14 Jan 20024 Jul 202414 Jan 2031
130baker.org.uk-23 Oct 20034 Jul 202423 Oct 2029
131baker.companyGoogle, Inc.31 Jul 202321 Jul 202431 Jul 2025
132baker.placeGoDaddy.com, LLC28 Nov 20233 Dec 202328 Nov 2025
133baker.energyNetwork Solutions, LLC2 Mar 20186 Jan 20252 Mar 2026
134baker.coacheNom, Inc.27 Oct 202024 Oct 202427 Oct 2025
135baker.restaurantGoDaddy.com, LLC25 Apr 20187 May 202025 Apr 2021
136baker.expertCloudFlare, Inc.4 Dec 20249 Dec 20244 Dec 2025
137baker.tipsTucows Domains Inc.6 Dec 202010 Dec 20216 Dec 2022
138baker.networkNamesilo, LLC6 Jun 20187 Jan 20246 Jun 2025
139baker.engineeringGoDaddy.com, LLC26 Jun 201810 Aug 202426 Jun 2025
140baker.farmGoogle, Inc.4 Dec 20204 Dec 20234 Dec 2024
141baker.dogGoDaddy.com, LLC28 Jul 20182 Aug 201828 Jul 2020
142baker.mbaNameCheap, Inc.27 Sep 20182 Sep 202427 Sep 2025
143baker.creditNameCheap, Inc.27 Sep 20182 Sep 202427 Sep 2025
144baker.photosGoogle, Inc.11 Nov 20182 Nov 202411 Nov 2025
145baker.kitchenGoogle, Inc.5 Oct 20225 Oct 20245 Oct 2025
146baker.devGoogle, Inc.14 Oct 20225 Oct 202414 Oct 2025
147baker.servicesGoDaddy.com, LLC29 Dec 202212 Feb 202529 Dec 2026
148baker.shoes-15 Jun 202412 Dec 202415 Jun 2025
149baker.goldNameCheap, Inc.29 Mar 201911 May 202429 Mar 2024
150baker.fund-15 Jun 202430 Aug 202415 Jun 2025
151baker.investmentsNameCheap, Inc.29 Mar 201911 May 202429 Mar 2024
152baker.picturesNameCheap, Inc.29 Mar 201911 May 202429 Mar 2024
153baker.clothingNameCheap, Inc.29 Mar 201911 May 202429 Mar 2024
154baker.run-15 Jun 202424 Sep 202415 Jun 2025
155baker.moneyDynadot, LLC15 Jun 202410 Feb 202515 Jun 2025
156baker.direct-15 Jun 202412 Dec 202415 Jun 2025
157baker.enterprises-15 Jun 202424 Sep 202415 Jun 2025
158baker.vacationsNameCheap, Inc.29 Mar 201911 May 202429 Mar 2024
159baker.academyGoDaddy.com, LLC24 Oct 201914 Aug 202424 Oct 2025
160baker.trainingGoDaddy.com, LLC24 Oct 201929 Oct 201924 Oct 2021
161baker.deliveryLimited Liability Company "Registrar of domain nam…22 Jan 202023 Jan 202522 Jan 2026
162baker.blueCSL Computer Service Langenbach GmbH d/b/a joker.c…28 Dec 20212 Jan 202228 Dec 2031
163baker.nrw1&1 Internet AG19 Dec 20192 Feb 202519 Dec 2025
164baker.computerGoogle, Inc.16 Jun 20207 Jun 202416 Jun 2025
165baker.doctorBlue Razor Domains, LLC2 Nov 20165 Nov 20242 Nov 2025
166baker.pizzaGoogle, Inc.10 Sep 202031 Aug 202410 Sep 2025
167baker.realtyEpik Inc.26 Sep 202014 Nov 202126 Sep 2022
168baker.productionsGoogle, Inc.25 May 20239 Jul 202425 May 2025
169baker.voteNameCheap, Inc.4 Aug 202310 Jul 20244 Aug 2025
170baker.contactPorkbun, LLC9 Dec 202010 Dec 20249 Dec 2025
171baker.fishGoogle, Inc.20 Dec 202020 Dec 202320 Dec 2024
172baker.financeDynadot, LLC19 Jul 202410 Feb 202519 Jul 2025
173baker.gentRegister NV dba Register.eu3 Mar 20213 Mar 20253 Mar 2025
174baker.guideNameCheap, Inc.19 Apr 202125 Mar 202419 Apr 2025
175baker.cleaningGoogle, Inc.3 Aug 20213 Aug 20213 Aug 2022
176baker.townGoogle, Inc.1 Dec 202128 Nov 20241 Dec 2025
177baker.agGoDaddy.com, LLC29 Oct 202113 Dec 202429 Oct 2025
178baker.ru.comNameKing.com Inc.21 Mar 202220 May 202221 Mar 2023
179baker.showGoDaddy.com, LLC25 Apr 202430 Apr 202425 Apr 2025
180baker.st-17 Aug 20014 Jul 202216 Aug 2023
181baker.equipment-2 Jan 20242 Jan 20242 Jan 2025
182baker.net.nz-4 Dec 200031 Oct 2022-
183baker.liveGoDaddy.com, LLC22 Dec 20205 Feb 202522 Dec 2025
184baker.blog1API GmbH15 Nov 202229 Dec 202215 Nov 2023
185baker.nz-28 Nov 20183 Nov 2023-
186baker.studioGoogle, Inc.20 May 20204 Jul 202420 May 2025
187baker.socialGoDaddy.com, LLC16 Dec 202213 Jul 202416 Dec 2032
188baker.softwareNameCheap, Inc.27 Dec 20222 Dec 202427 Dec 2025
189baker.oooGoogle, Inc.27 Dec 202217 Jan 202527 Dec 2025
190baker.eu.com-27 Jun 200016 Aug 202427 Jun 2026
191baker.landGoDaddy.com, LLC10 Jan 202324 Feb 202510 Jan 2026
192baker.acCommuniGal Communication Ltd.30 Sep 20245 Oct 202430 Sep 2025
193baker.afGandi SAS1 Feb 201812 Feb 20241 Feb 2027
194baker.bestOVH sas15 Jan 201916 Jan 202515 Jan 2026
195baker.buildersNameCheap, Inc.14 Feb 201715 Feb 202514 Feb 2026
196baker.armyNameCheap, Inc.7 Feb 202013 Jan 20257 Feb 2026
197baker.asiaGoDaddy.com, LLC22 Nov 20076 Jan 202522 Nov 2025
198baker.net.au--9 Jun 2024-
199baker.bondDynadot, LLC12 Dec 202122 Jan 202312 Dec 2022
200baker.bot101domain, Inc.6 Aug 20208 Jun 20246 Aug 2025
201baker.com.pe----
202baker.cafeGoDaddy.com, LLC6 Sep 20206 Sep 20236 Sep 2024
203baker.campPorkbun, LLC26 Apr 201914 Oct 202426 Apr 2026
204baker.pt----
205baker.casaNameCheap, Inc.23 May 202128 Apr 202423 May 2025
206baker.cashNameCheap, Inc.27 Sep 20182 Sep 202427 Sep 2025
207baker.appNameKing.com Inc.6 Feb 20236 Feb 20256 Feb 2026
208baker.coTucows Domains Inc.26 Aug 201025 Nov 202425 Aug 2025
209baker.ie-3 Apr 19971 Apr 20214 Apr 2025
210baker.aero101domain, Inc.28 Oct 20214 Sep 202428 Oct 2025
211baker.cpaEnCirca, Inc.9 Nov 202115 Oct 20249 Nov 2025
212baker.earthGoDaddy.com, LLC11 Apr 20198 Jun 202411 Apr 2025
213baker.gamesXiamen ChinaSource Internet Service Co., Ltd.7 Mar 202311 May 20247 Mar 2024
214baker.hausName.com, Inc.1 Jun 202015 May 20241 Jun 2025
215baker.homesGlobal Domains International, Inc. DBA DomainCostC…23 Jun 20205 Sep 202423 Jun 2025
216baker.ioNameCheap, Inc.6 Jul 201211 Jun 20246 Jul 2025
217baker.jp-18 Feb 20031 Mar 202528 Feb 2026
218baker.linkNameCheap, Inc.28 Oct 20218 Nov 202328 Oct 2025
219baker.ly-13 Aug 202418 Aug 202413 Aug 2025
220baker.marketChengdu West Dimension Digital Technology Co., Ltd…29 Nov 202030 Nov 202329 Nov 2024
221baker.nycGoDaddy.com, LLC13 May 201719 May 202413 May 2025
222baker.org.nz-14 Apr 200931 Oct 2022-
223baker.weddingGoDaddy.com, LLC17 Jul 201923 Jul 202417 Jul 2025
224baker.vcGoDaddy.com, LLC20 Nov 202323 Jan 202520 Nov 2025
225baker.saleGoDaddy.com, LLC5 Nov 201916 Jan 20255 Nov 2024
226baker.parisOVH sas22 May 20236 May 202422 May 2025
227baker.veteNom, Inc.28 Apr 202130 Apr 202428 Apr 2025
228baker.co.nz-24 Jul 201830 Jun 2024-
229baker.camNameCheap, Inc.31 Aug 202312 Oct 202431 Aug 2024
230baker.capetownTucows Domains Inc.31 Aug 20232 Aug 202431 Aug 2025
231baker.realtorName Share, Inc.17 Sep 201818 Aug 202417 Sep 2025
232baker.ripPorkbun, LLC4 Aug 20229 Aug 20224 Aug 2027
233baker.ro-3 Oct 2018-1 Oct 2027
234baker.clKey-Systems GmbH6 Aug 1999-2 Sep 2030
235baker.cn-27 Mar 2004-27 Mar 2026
236baker.co.in-15 Oct 200924 Aug 202215 Oct 2029
237baker.co.jp-24 Sep 20131 Oct 2024-
238baker.com.au--24 Oct 2023-
239baker.com.br-24 Feb 201027 Feb 202524 Feb 2026
240baker.com.cn-4 Apr 2006-4 Apr 2025
241baker.fitGoDaddy.com, LLC17 Aug 202028 Sep 202417 Aug 2024
242baker.id.au--1 Jun 2024-
243baker.la-7 Apr 201628 Sep 20247 Apr 2025
244baker.nl-1 Apr 19981 Nov 2017-
245baker.directoryGoDaddy.com, LLC7 Sep 202322 Oct 20247 Sep 2025
246baker.za.comNameKing.com Inc.30 Jun 202314 Aug 202430 Jun 2024
247baker.taxTucows Domains Inc.4 Oct 202324 Sep 20244 Oct 2025
248baker.mortgageName.com, Inc.12 Oct 202324 Nov 202412 Oct 2024
249baker.dance-11 Feb 202516 Feb 202511 Feb 2026
250baker.supplies-18 Nov 202318 Nov 202318 Nov 2024
251baker.cateringName.com, Inc.28 Nov 202322 Nov 202428 Nov 2024
252baker.repairName.com, Inc.28 Nov 202322 Nov 202428 Nov 2024
253baker.careersGoDaddy.com, LLC5 Dec 202319 Jan 20255 Dec 2025
254baker.chatGoDaddy.com, LLC23 Dec 20236 Feb 202523 Dec 2025
255baker.clinicNameCheap, Inc.24 Jan 202410 Jan 202524 Jan 2026
256baker.insureGoDaddy.com, LLC29 Jan 202417 Oct 202429 Jan 2029
257baker.im---11 Apr 2026
258baker.agencyGoDaddy.com, LLC23 Mar 202422 Jan 202523 Mar 2026
259baker.latPorkbun, LLC27 Mar 202414 May 202427 Mar 2025
260baker.ru-20 Nov 2000-22 Nov 2025
261baker.su-13 May 2021-13 May 2025
262baker.se-20 Feb 200328 Jan 202520 Feb 2026
263baker.diy-2 Jun 202410 Oct 20242 Jun 2025
264baker.eu----
265baker.monsterChengdu West Dimension Digital Technology Co., Ltd…9 Nov 202415 Dec 20249 Nov 2025
266baker.bzRegional Network Information Center, JSC dba RU-CE…20 Aug 20234 Oct 202420 Aug 2025
267baker.careNameCheap, Inc.23 Jan 202523 Jan 202523 Jan 2026
268bakerlist.comTurnCommerce, Inc. DBA NameBright.com22 Jul 201621 Aug 202422 Jul 2024
269bakersgas.comGoDaddy.com, LLC28 May 199912 Oct 202228 May 2026
270bakersfieldcollege.edu-7 Jan 200220 Apr 201731 Jul 2018
271bakertilly.co.uk--23 Jun 202427 Jun 2025
272bakerboyeronline.comDomain.com, LLC29 May 20099 May 202429 May 2025
273bakerssquare.comNetwork Solutions, LLC3 Mar 19992 Jan 20253 Mar 2028
274bakertilly.comeNom, Inc.21 Mar 200023 Jan 202421 Mar 2026
275bakeri.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Apr 199811 Feb 202519 Apr 2026
276bakershoes.comAmazon Registrar, Inc.18 Feb 200015 Jan 202518 Feb 2026
277bakertillyberk.comHosting Concepts B.V. dba Openprovider13 Dec 200613 Dec 202413 Dec 2025
278baker-group.netHosting Ukraine LLC8 Oct 200921 Mar 20248 Oct 2025
279bakerross.co.uk-27 Mar 19987 Jun 202427 Mar 2026
280bakera.jp-4 Mar 20051 Apr 202431 Mar 2025
281bakerdonelson.comGoDaddy.com, LLC30 Oct 199819 Oct 202329 Oct 2028
282bakersoven.in-23 Nov 200924 Apr 202423 Nov 2025
283bakeryland.co.th-1 Mar 201023 Nov 202328 Feb 2026
284baker-taylor.comNetwork Solutions, LLC10 Aug 199515 Aug 20239 Aug 2031
285bakerlindsey.comCronon AG23 Jun 202123 Jun 202123 Jun 2022
286bakersfieldmarathon.comGoDaddy.com, LLC26 Sep 201827 Sep 202426 Sep 2025
287bakerplayblog.comFastDomain Inc.18 Feb 201218 Feb 201218 Feb 2013
288bakeryandsnacks.comGoDaddy.com, LLC16 Jan 200320 Dec 202416 Jan 2026
289bakerboysdist.comDreamHost, LLC13 Mar 200810 Feb 202513 Mar 2026
290bakerlab.orgDomain.com, LLC18 Jun 200110 Mar 202318 Jun 2027
291bakersdelight.com.au--21 Jul 2024-
292bakersfieldbug.comDropCatch.com 1389 LLC13 Jul 201813 Jul 201813 Jul 2019
293bakerskateboards.comGandi SAS28 Mar 200116 Feb 202428 Mar 2027
294bakerframework.comGoDaddy.com, LLC25 Oct 201020 Jan 202525 Oct 2025
295bakerfurniture.comGoDaddy.com, LLC15 Jul 199614 Jul 202414 Jul 2025
296bakersfieldnow.comBrandsight, Inc.29 Jun 200414 Nov 202329 Jun 2026
297bakeru.edu-11 Jul 19943 Dec 201531 Jul 2017
298bakermckenzie.comNetwork Solutions, LLC15 Jan 199916 Nov 202315 Jan 2026
299bakersroyale.comFastDomain Inc.30 Dec 200914 Dec 202430 Dec 2025
300bakerstreet.tvBigRock Solutions Ltd.2 Jun 20118 Jun 20242 Jun 2025
301bakeryequipment.comGoDaddy.com, LLC28 Jan 199713 Sep 202229 Jan 2031
302bakerhughesdirect.comKey-Systems GmbH12 May 200011 Apr 202412 May 2025
303bakerandsoars.comRegister.it SPA15 Feb 20133 Feb 202515 Feb 2026
304bakerandspiceme.comNameCheap, Inc.18 Feb 200931 Dec 202418 Feb 2026
305bakerbettie.comWild West Domains, LLC7 Jan 20128 Dec 20247 Jan 2026
306bakerbotts.comNetwork Solutions, LLC28 Apr 199529 Feb 202429 Apr 2029
307bakerbynature.comNameCheap, Inc.10 Mar 201126 Feb 20219 Mar 2026
308bakerdays.comWebfusion Ltd.20 Jul 201121 Jul 202420 Jul 2025
309bakerdist.comNetwork Solutions, LLC3 Jan 19973 Nov 20212 Jan 2027
310bakerella.comGoDaddy.com, LLC28 Jan 200825 Jan 202428 Jan 2026
311bakerenogkokken.no-16 Jan 201316 Jan 2013-
312bakerette.comGoDaddy.com, LLC4 Feb 20115 Feb 20254 Feb 2026
313bakerhughes.comKey-Systems GmbH25 Jun 199623 May 202424 Jun 2025
314bakeridi.edu.auExperian Services Corp.-14 Jan 2014-
315bakerinstitute.orgregister.com, Inc.24 Jul 200017 Oct 202424 Jul 2027
316bakerita.comGoDaddy.com, LLC7 Sep 201027 Aug 20247 Sep 2027
317bakerlaw.comNetwork Solutions, LLC24 Jul 199625 Apr 202223 Jul 2025
318bakermarketingservices.comTucows Domains Inc.15 Jul 201130 Jun 202415 Jul 2025
319bakermen.comKey-Systems GmbH8 Feb 20103 Feb 20258 Feb 2026
320bakerpartyrentals.comGoDaddy.com, LLC26 Apr 200018 Sep 202226 Apr 2028
321bakerpublishinggroup.comNetwork Solutions, LLC1 Mar 200415 Jan 20251 Mar 2027
322bakerross.de--1 Dec 2021-
323bakers-corner.com.au--29 Jan 2025-
324bakersdozenandapolloxiv.comGoDaddy.com, LLC6 Nov 20197 Nov 20246 Nov 2025
325bakersfield.comGoDaddy.com, LLC29 Oct 199528 Oct 202428 Oct 2025
326bakersfield.netGoDaddy.com, LLC5 Sep 19964 Sep 20244 Sep 2025
327bakersfieldbusinessguide.com-27 May 202326 Feb 202527 May 2025
328bakersfieldtacos.comNameCheap, Inc.6 Oct 20146 Sep 20246 Oct 2025
329bakersfieldwebring.comRealtime Register B.V.21 Apr 202416 Sep 202421 Apr 2025
330bakersinn.comGoDaddy.com, LLC27 Mar 201827 Sep 202427 Mar 2025
331bakersplus.comNetwork Solutions, LLC23 Sep 200225 Jul 202323 Sep 2025
332bakersshoes.comNetwork Solutions, LLC12 Nov 199919 Jul 202312 Nov 2028
333bakersville.inGoDaddy.com, LLC15 Jul 201114 Feb 202315 Jul 2025
334bakertillyinternational.comEasyspace LTD19 Jun 200131 Jan 202519 Jun 2025
335bakerviewconsulting.comNameCheap, Inc.20 Nov 201121 Oct 202420 Nov 2025
336bakerybite.comNameCheap, Inc.16 Feb 202326 Mar 202416 Feb 2025
337bakerybits.co.uk-9 Aug 200910 Jul 20249 Aug 2025
338bakeryinfo.co.uk-18 Jul 200627 Jun 202418 Jul 2025
339bakerymagazine.comGoDaddy.com, LLC7 Dec 20108 Dec 20227 Dec 2025
340bakerymailer.comGoDaddy.com, LLC19 Sep 201331 Oct 202419 Sep 2024
341bakeryskill.comGoDaddy.com, LLC8 Oct 201419 Nov 20248 Oct 2024
342bakersfieldcity.usNEUSTAR RESERVE ACCOUNT A|US RESERVE|GDAVIDSO18 Apr 200218 Feb 202527 May 2102
343bakerybandit.comWild West Domains, LLC27 Jul 202431 Dec 202427 Jul 2025
344bakersfieldcaliforniaclassifieds.comWild West Domains, LLC21 Oct 201421 Oct 201421 Oct 2015
345bakerhughestrs.comMarkMonitor Inc.21 Oct 201410 Sep 202421 Oct 2025
346bakercustomtileca.comGoDaddy.com, LLC27 Jul 20228 Oct 202327 Jul 2023
347bakercrest.comHostinger, UAB21 Nov 202421 Nov 202421 Nov 2025
348bakerconstructionnoblesville.comGoDaddy.com, LLC22 Oct 20142 Nov 202422 Oct 2025
349bakerannie.comeNom, Inc.22 Oct 201422 Oct 201422 Oct 2015
350bakersfieldstorage.netGoDaddy.com, LLC20 Oct 201420 Oct 201420 Oct 2015
351bakertillyberk.nl-13 Dec 200627 Feb 2021-
352bakerymachines-magazin.ru----
353bakeryhaccp.comPSI-USA, Inc. dba Domain Robot21 Jun 202320 Jun 202421 Jun 2024
354bakerydryriver.comTurnCommerce, Inc. DBA NameBright.com23 Oct 201429 Sep 201722 Oct 2018
355bakersberry.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
356bakergetriebe.comCronon AG22 Oct 201411 Dec 202422 Oct 2025
357bakerhaus.comPSI-USA, Inc. dba Domain Robot3 Jul 201122 Aug 20243 Jul 2025
358bakershoe.comCloudFlare, Inc.20 Nov 19995 Nov 202420 Nov 2025
359bakerychina.comHiChina Zhicheng Technology Limited10 Aug 20128 Jul 202410 Aug 2025
360bakercaitlin.usLaunchpad, Inc.21 Oct 201421 Oct 201420 Oct 2015
361bakerperkins.comKey-Systems GmbH16 Mar 19985 Jan 202515 Mar 2026
362bakersmart.co.inKey-Systems GmbH9 Oct 202023 Nov 20249 Oct 2025
363bakershop.it-3 Feb 20124 Feb 202519 Jan 2026
364bakersclearinghouse.comTucows Domains Inc.24 Oct 201428 Oct 201524 Oct 2016
365bakers-cakes.comTucows Domains Inc.23 Oct 201427 Oct 201523 Oct 2016
366bakeribygget-massasje.comAscio Technologies, Inc. Danmark - Filial af Ascio…23 Oct 201423 Oct 201423 Oct 2015
367bakerengineeringcorp.comTucows Domains Inc.20 Oct 201324 Oct 201420 Oct 2015
368baker-guide.com1API GmbH23 Oct 201420 Mar 202023 Oct 2025
369bakertilly.de--12 Aug 2021-
370bakeria.ch----
371bakerxchange.comNetwork Solutions, LLC12 Apr 200613 Apr 202312 Apr 2025
372bakermckenzie.co.jp-6 Aug 20121 Sep 2024-
373bakershoes.es----
374baker-street.co.zaCommerce Island, Inc.8 Mar 2002--
375bakerboyer.comDomain.com, LLC14 Jul 199721 Apr 202411 May 2025
376bakerymba.com1&1 Internet AG24 Oct 201415 Feb 201824 Oct 2018
377bakerydirectonline.comGoDaddy.com, LLC24 Oct 201424 Oct 201424 Oct 2019
378bakersfieldmonumentcompany.comGoDaddy.com, LLC2 Jun 20162 Jun 20162 Jun 2017
379bakersfield-es.com-25 Oct 201425 Oct 201425 Oct 2017
380bakerexchange.comTurnCommerce, Inc. DBA NameBright.com9 Jan 20163 Jan 20219 Jan 2025
381bakerevolution.com1&1 Internet AG24 Oct 201415 Feb 201824 Oct 2025
382bakereditor.comregister.com, Inc.24 Oct 201424 Oct 201424 Oct 2016
383bakerycrafts.comNetwork Solutions, LLC5 Aug 19965 Jun 20214 Aug 2026
384bakersfieldatlas.comGoDaddy.com, LLC25 May 201425 May 201525 May 2016
385bakersanonymous.comAnnulet LLC15 Jul 20161 Sep 202415 Jul 2025
386bakerviewwellnesscentre.orgGoDaddy.com, LLC23 Oct 201423 Oct 201423 Oct 2015
387bakersfieldhealingarts.infoGoDaddy.com, LLC24 Oct 201424 Oct 201424 Oct 2015
388bakerville.coGoDaddy.com, LLC27 May 20136 May 201726 May 2018
389bakeryofdenver.comGoDaddy.com, LLC26 May 201227 May 201526 May 2016
390bakersmanbk.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
391bakersmanbrooklyn.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
392bakerband.orgWild West Domains, LLC26 May 20147 Jun 201526 May 2016
393bakersfieldbankrates.comGoDaddy.com, LLC26 May 201127 May 201526 May 2016
394bakersheadquarters.comGoDaddy.com, LLC27 May 200928 May 201527 May 2016
395bakercityphotobooth.comGoDaddy.com, LLC27 May 201328 May 201527 May 2016
396bakercityphotoboothrental.comGoDaddy.com, LLC27 May 201328 May 201527 May 2016
397bakeryroom.comAnnulet LLC14 Aug 201530 Sep 202414 Aug 2025
398bakershq.comTucows Domains Inc.29 Feb 20169 Apr 202028 Feb 2020
399bakersbabybarn.comGoDaddy.com, LLC9 Oct 20134 May 20159 Oct 2015
400bakersfieldbestagent.comGoDaddy.com, LLC28 May 201329 May 201528 May 2016
401bakerstreetindia.comGoDaddy.com, LLC28 May 201029 May 201528 May 2016
402bakersfieldwrapfactory.comGoDaddy.com, LLC30 Jun 201329 May 201528 May 2016
403bakersfieldhousevalues.comGoDaddy.com, LLC11 Jul 201811 Jul 201811 Jul 2019
404bakersfieldautowraps.comGoDaddy.com, LLC30 Jun 201329 May 201528 May 2016
405bakerycheff.comGoDaddy.com, LLC29 May 201430 May 201529 May 2016
406bakerybestfriends.comGoDaddy.com, LLC25 Oct 20146 Jan 202525 Oct 2024
407bakersdozenbox.comGoDaddy.com, LLC27 Jun 20188 Sep 202427 Jun 2024
408bakerieseastlansing.comTucows Domains Inc.22 Oct 201026 Oct 201422 Oct 2015
409bakerboydonuts.comDomain.com, LLC26 Oct 201426 Oct 201426 Oct 2015
410bakery3d.comCosmotown, Inc.14 Apr 202414 Apr 202414 Apr 2025
411bakerspalate.comGoDaddy.com, LLC19 Sep 20221 Dec 202319 Sep 2023
412bakersbestbreadmix.comGoDaddy.com, LLC31 May 20131 Jun 201531 May 2016
413bakersfieldbanners.com1&1 Internet AG22 Aug 201922 Aug 201922 Aug 2025
414bakerwebsitedesign.comGoDaddy.com, LLC3 Jun 20114 Jun 20153 Jun 2016
415bakersfieldautoinsuranceusa.comWild West Domains, LLC4 Jun 20134 Jun 20154 Jun 2016
416bakerlogistics.usGoDaddy.com, LLC4 Jun 20144 Jun 20143 Jun 2015
417bakersfieldnursinghomeabuselawyer.comGoDaddy.com, LLC22 May 200923 May 201522 May 2016
418bakersfieldirregulars.comWild West Domains, LLC23 May 201324 May 201523 May 2016
419bakerfeistpsychology.comGoDaddy.com, LLC21 May 201222 May 201521 May 2016
420bakeryfarmstand.comGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2015
421bakerybagsmanufacturer.comGoDaddy.com, LLC26 Oct 201417 Sep 202226 Oct 2025
422bakerberries.comGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2015
423bakeratthebar.comGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2016
424bakersfieldnursinghomeabuseattorney.comGoDaddy.com, LLC22 May 200923 May 201522 May 2016
425bakersfieldjuniorrollerderby.comGoDaddy.com, LLC23 May 201423 May 201523 May 2016
426bakersfieldrestaurantexpo.comGoDaddy.com, LLC21 May 201422 May 201521 May 2016
427bakersfieldtaxi.infoGoDaddy.com, LLC14 Jun 201815 Jun 201914 Jun 2020
428baker-propertygroup.comGoDaddy.com, LLC23 May 201324 May 201523 May 2016
429bakersfielddailydeals.comGoDaddy.com, LLC22 May 201023 May 201522 May 2016
430bakerboyhostingsolutions.comGoDaddy.com, LLC4 Jun 20145 Jun 20154 Jun 2016
431bakerjobauctions.comGoDaddy.com, LLC5 Jun 20135 Jun 20155 Jun 2016
432bakersfieldplumbing.bizGoDaddy.com, LLC5 Jun 20125 Jun 20144 Jun 2015
433bakersfieldplumbing.infoGoDaddy.com, LLC5 Jun 20125 Jun 20155 Jun 2016
434bakersfieldplumbing.ws----
435bakersfieldplumbing.mobiGoDaddy.com, LLC5 Jun 20126 Jun 20155 Jun 2016
436bakersfieldabovegroundpools.comTierraNet Inc. d/b/a DomainDiscover1 Oct 201825 Sep 20242 Oct 2026
437bakerscientific.comNameCheap, Inc.23 Aug 201523 Jun 202423 Aug 2025
438bakerychic.comGoDaddy.com, LLC6 Jun 20146 Jun 20156 Jun 2016
439bakerpond.orgGoDaddy.com, LLC5 Jun 201017 Jun 20155 Jun 2016
440bakerboyzracing.infoGoDaddy.com, LLC6 Jun 20126 Jun 20156 Jun 2016
441bakersfieldspeedweek.comGoDaddy.com, LLC27 May 20098 Jun 201527 May 2016
442bakersfieldpost.comBeijing Lanhai Jiye Technology Co., Ltd15 Dec 202316 Dec 202415 Dec 2025
443bakersfieldstar.comWhiteglove Domains, Incorporated22 Dec 20237 Mar 202522 Dec 2024
444bakerton.comGoDaddy.com, LLC10 Dec 201411 Dec 202410 Dec 2025
445bakertimes.comDynadot, LLC5 Apr 20246 Jun 20245 Apr 2025
446bakercreekresort.comGoDaddy.com, LLC4 Aug 20095 Aug 20244 Aug 2025
447bakerradio.comGoDaddy.com, LLC14 Jul 200628 Feb 202514 Jul 2025
448bakersfieldgaragedoorrepair.comGoDaddy.com, LLC21 Jun 202322 Jun 202421 Jun 2025
449bakersfieldlawfirm.comTucows Domains Inc.10 Oct 201712 Aug 202410 Oct 2025
450bakersfieldaccident.comGoDaddy.com, LLC1 Jan 20141 May 20151 Jan 2016
451bakerautomotive.comCSC Corporate Domains, Inc.17 Jul 200514 Jul 202417 Jul 2025
452bakeryboutique.coGoDaddy.com, LLC15 Jul 201321 May 201514 Jul 2015
453bakerfinancialservices.comeNom, Inc.20 May 201017 May 202420 May 2025
454bakerflooring.comGoDaddy.com, LLC9 Jun 202025 Jan 20249 Jun 2025
455bakerhealth.comeNom, Inc.14 Oct 201010 Oct 202414 Oct 2025
456bakermiddle.comeNom, Inc.28 Jan 201123 Jan 201728 Jan 2018
457bakerydreams.comGoDaddy.com, LLC23 Mar 202117 Mar 202423 Mar 2025
458bakeryshow.comeNom, Inc.12 Jun 201213 Jun 202412 Jun 2025
459bakeryboys.comGoDaddy.com, LLC1 Feb 200919 Dec 20241 Feb 2026
460bakerappliance.comDynadot, LLC6 Aug 202114 Nov 20246 Aug 2025
461bakerart.comGoDaddy.com, LLC20 Nov 201912 Feb 202520 Nov 2025
462bakerheating.comeNom, Inc.28 May 200925 May 202428 May 2025
463bakersfood.com-4 Jul 20236 Jul 20244 Jul 2025
464bakerthomas.comeNom, Inc.28 Feb 20118 Mar 202528 Feb 2026
465bakerfinancial.comeNom, Inc.24 Feb 200525 Feb 202524 Feb 2025
466bakerydelights.comeNom, Inc.2 Jul 20074 Jul 20242 Jul 2025
467bakercity.clubNameCheap, Inc.18 Jan 201715 Feb 201717 Jan 2018
468bakeryvillagenj.comFastDomain Inc.27 Oct 201412 Oct 202427 Oct 2025
469bakervalleyhomes.comTurnCommerce, Inc. DBA NameBright.com30 Sep 201231 Aug 202230 Sep 2025
470bakersfieldassociates.comWix.com Ltd.15 Aug 202415 Aug 202415 Aug 2025
471bakersfieldalarmsystems.comAutomattic Inc.27 May 201727 May 201727 May 2018
472bakerpre.comGoDaddy.com, LLC27 May 202027 May 202027 May 2021
473bakerpestcontrolinc.comNetwork Solutions, LLC27 Oct 201417 Sep 202427 Oct 2025
474bakermoran.com1&1 Internet AG27 Oct 20146 Sep 202327 Oct 2025
475bakerhillstables.comGoDaddy.com, LLC13 Nov 202019 Nov 202413 Nov 2026
476bakerdesignandbuild.comTucows Domains Inc.27 Oct 20147 Dec 202427 Oct 2024
477bakertowing.comAtak Domain Hosting Internet d/b/a Atak Teknoloji17 Oct 202417 Oct 202417 Oct 2025
478bakersfield-ca.netGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2016
479bakerbodyshop.net1&1 Internet AG27 Oct 201427 Oct 201427 Oct 2015
480bakermods.comGoDaddy.com, LLC28 Jul 200320 May 201528 Jul 2015
481bakerdozen.infoGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
482bakersfieldoptometrist.comDynadot, LLC13 Nov 202013 Nov 202013 Nov 2021
483bakeryitalia.comRegister.it SPA3 May 20243 May 20243 May 2025
484bakerinstitute.comGoDaddy.com, LLC26 Jan 201029 Jan 202526 Jan 2026
485bakeryphiladelphia.comNamesilo, LLC6 Jun 20186 Jun 20246 Jun 2025
486bakersfieldbariatric.comGoDaddy.com, LLC29 Jun 201629 Jun 201629 Jun 2019
487bakersfieldnailsalons.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Jun 201826 Jun 201826 Jun 2019
488bakersfieldstainedglass.comGoDaddy.com, LLC5 Nov 20106 Nov 20145 Nov 2015
489bakersfieldalum.comGoDaddy.com, LLC11 Oct 200723 Dec 202411 Oct 2024
490bakergrad.comGoDaddy.com, LLC26 Mar 201626 Mar 202426 Mar 2025
491bakerhughes.coNameKing.com Inc.14 Jul 202130 Aug 202314 Jul 2025
492bakerfamilydental.comGoDaddy.com, LLC13 Mar 202215 Dec 202313 Mar 2025
493bakerydesserts.comHostinger, UAB17 Oct 202417 Dec 202417 Oct 2025
494bakercreekseedcompany.comTurnCommerce, Inc. DBA NameBright.com25 Dec 202216 Mar 202425 Dec 2024
495bakercreekheirloomseedcompany.comDropCatch.com 621 LLC25 Jan 201626 Jan 201725 Jan 2018
496bakercreekseedcatalog.comGoDaddy.com, LLC8 Nov 201427 Mar 20158 Nov 2015
497bakerypops.comGoDaddy.com, LLC5 Apr 20147 Mar 20155 Apr 2016
498bakeryshopchicago.comGo Canada Domains, LLC8 Jan 201527 Jan 20158 Jan 2016
499bakersbarn.comOne.com A/S8 Jun 20004 Jun 20248 Jun 2025
500bakersfielddaily.comDynadot, LLC18 Nov 202312 Dec 202418 Nov 2025
501bakerymart.comGoDaddy.com, LLC25 Feb 200725 Feb 202525 Feb 2026
502bakerykings.comTurnCommerce, Inc. DBA NameBright.com13 Oct 201823 Dec 202413 Oct 2024
503bakersfiledfilmfestival.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Oct 201429 Oct 201429 Oct 2015
504bakeracres.comeNom, Inc.29 Sep 201026 Sep 202429 Sep 2025
505bakerbody.comHangzhou AiMing Network Co., LTD19 Jul 202119 Jul 202119 Jul 2022
506bakercommunication.comeNom, Inc.19 May 200917 May 202419 May 2025
507bakersunion.comeNom, Inc.8 Dec 201030 Nov 20248 Dec 2025
508bakerpainting.comeNom, Inc.23 Jan 201130 Jan 202523 Jan 2026
509bakerykitchen.comGoDaddy.com, LLC7 Mar 20148 Mar 20257 Mar 2026
510bakeryandrestaurant.comeNom, Inc.22 Dec 201227 Dec 202422 Dec 2025
511bakersgully.comeNom, Inc.27 Dec 201227 Dec 202427 Dec 2025
512bakerypaper.comSquarespace Domains LLC25 Sep 202311 Sep 202425 Sep 2025
513bakerappraisals.comeNom, Inc.30 Dec 201227 Dec 202430 Dec 2025
514bakerywest.comEpik Inc.4 Mar 20067 Mar 20204 Mar 2026
515bakersbodyshop.us1&1 Internet AG27 Oct 2014-26 Oct 2015
516bakerpre.orgeNom, Inc.27 Oct 201427 Oct 201427 Oct 2015
517bakermoran.net1&1 Internet AG27 Oct 20142 Nov 201727 Oct 2025
518bakercitychristian.orgPDR Ltd. d/b/a PublicDomainRegistry.com27 Oct 201427 Oct 201427 Oct 2015
519bakeryexchange.comGoDaddy.com, LLC7 May 199928 Feb 20257 May 2025
520bakerhughescareers.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Nov 202111 Nov 202410 Nov 2024
521bakercraft.netWild West Domains, LLC1 Mar 20089 Feb 20251 Mar 2026
522bakerydisplay.comGoDaddy.com, LLC31 Mar 200421 Apr 202331 Mar 2028
523bakerpros.comGoDaddy.com, LLC30 Nov 20132 Dec 202430 Nov 2025
524bakerexport.comGoDaddy.com, LLC5 Sep 20133 May 20155 Sep 2015
525bakerclassiccars.comGoDaddy.com, LLC27 Jun 20008 Aug 202427 Jun 2025
526bakeryconcepts.comAnnulet LLC30 Jan 200319 Aug 202430 Jan 2025
527bakeru.comTurnCommerce, Inc. DBA NameBright.com3 May 201417 Jun 20203 May 2025
528bakera.com-26 Jun 20118 May 202426 Jun 2025
529bakersfieldtattooremoval.comGoDaddy.com, LLC29 Jan 201730 Jan 202529 Jan 2027
530bakersfield-realestate.comGoDaddy.com, LLC29 Mar 202126 Oct 202229 Mar 2026
531bakersfield3dprinting.comDynadot, LLC1 Aug 20191 Aug 20191 Aug 2020
532bakeryflour.comGoDaddy.com, LLC16 Nov 20091 Feb 202516 Nov 2025
533bakeryedibles.comNameCheap, Inc.4 Feb 2021-4 Feb 2022
534bakerslounge.comGoDaddy.com, LLC13 May 201130 Jun 202413 May 2025
535bakersfielddisabilityattorneys.comGoDaddy.com, LLC16 Sep 201421 Apr 201516 Sep 2015
536bakersfieldprobateattorneys.comGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
537bakersfieldfamilylawfirm.comregister.com, Inc.7 Aug 201926 Aug 20217 Aug 2025
538bakersfieldcriminaldefenselawyer.comGoDaddy.com, LLC16 Mar 202217 Mar 202416 Mar 2026
539bakersfielddrunkdrivingattorney.comGoDaddy.com, LLC7 Mar 20157 Mar 20157 Mar 2016
540bakersfieldautoaccidentlawyer.comDynadot12 LLC26 Apr 202127 Apr 202126 Apr 2022
541bakersfieldpatentlaw.comGoDaddy.com, LLC24 Apr 201524 Apr 201524 Apr 2016
542bakersrestaurant.comGoDaddy.com, LLC2 Aug 200813 Jul 20242 Aug 2025
543bakersfieldagent.comGoDaddy.com, LLC13 Jan 201317 Jan 202513 Jan 2026
544bakersfieldherbs.comGoDaddy.com, LLC2 Dec 200819 Apr 20152 Dec 2015
545bakersracksupply.comGoDaddy.com, LLC6 Jul 201124 May 20156 Jul 2015
546bakerydeals.comGoDaddy.com, LLC11 Dec 200712 Dec 202311 Dec 2025
547bakermayfield.comWild West Domains, LLC20 Aug 201328 Nov 202420 Aug 2025
548bakerymill.comGoDaddy.com, LLC21 Apr 200829 Aug 202321 Apr 2026
549bakersfieldfarmersmarket.comGoDaddy.com, LLC12 Oct 202010 Nov 202212 Oct 2032
550bakerspillsolutions.comTucows Domains Inc.26 Oct 200630 Oct 201426 Oct 2015
551bakerboysoutdoors.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
552bakerblowereng.comNamesilo, LLC19 Dec 201820 Dec 201819 Dec 2019
553bakersheaven.net-27 Nov 202329 Jan 202527 Nov 2024
554bakersfieldtreeservice.comDynadot, LLC2 Jun 20185 Jun 20242 Jun 2025
555bakersfieldtreeservices.comNameKing.com Inc.18 Nov 202428 Feb 202518 Nov 2025
556bakersfieldsalon.comGoDaddy.com, LLC31 Aug 202431 Aug 202431 Aug 2025
557bakersrackco.com-23 Jul 202224 Aug 202323 Jul 2023
558bakerrys.comGoDaddy.com, LLC5 Sep 201226 Aug 20245 Sep 2025
559baker-media.comGoDaddy.com, LLC30 Mar 201410 Mar 202430 Mar 2025
560bakerelease.comKey-Systems GmbH16 Oct 202422 Jan 202516 Oct 2025
561bakersfield-towingservice.infoGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
562bakerysupplies.orgDynadot, LLC10 Jan 20224 Aug 202210 Jan 2023
563bakerybistro.comeNom, Inc.3 Sep 201331 Aug 20243 Sep 2025
564bakersfieldcahouses.comGoDaddy.com, LLC7 Jul 200923 Apr 20157 Jul 2015
565bakerscentsandmore.comGoDaddy.com, LLC2 Jul 20083 Jul 20152 Jul 2016
566bakercalifornia.comGoDaddy.com, LLC30 Aug 200631 Aug 202430 Aug 2025
567bakerygadsden.comeNom, Inc.30 Oct 201430 Oct 201430 Oct 2015
568bakersvillecaskets.comGoDaddy.com, LLC30 Oct 20148 Oct 201630 Oct 2017
569bakersvillecasket.comGoDaddy.com, LLC30 Oct 20148 Oct 201630 Oct 2017
570bakerstoparaguay.com1&1 Internet AG30 Oct 201431 Oct 201730 Oct 2018
571bakersguildcafe.comFastDomain Inc.30 Oct 201430 Oct 201730 Oct 2018
572bakeriesking.comTurnCommerce, Inc. DBA NameBright.com15 Mar 20209 Mar 202115 Mar 2025
573bakeryflours.comGoDaddy.com, LLC16 Nov 20091 Feb 202516 Nov 2025
574bakerstreetresidence.comGoDaddy.com, LLC7 Nov 201326 Dec 20147 Nov 2015
575bakerycategory.comGoDaddy.com, LLC2 Oct 20091 Feb 20252 Oct 2025
576bakerresearch.comGoDaddy.com, LLC8 Apr 200511 Apr 20248 Apr 2025
577bakery-around-envious.netGMO Internet Inc.30 Oct 201430 Oct 201430 Oct 2015
578bakerymachines.netAscio Technologies, Inc. Danmark - Filial af Ascio…7 Oct 20168 Oct 20247 Oct 2025
579bakersfieldfamilydentist.comGoDaddy.com, LLC17 Mar 201514 Jan 202417 Mar 2025
580bakermobilya.comGoDaddy.com, LLC27 May 201527 May 201527 May 2016
581bakersfieldgoldbuyers.comMetaregistrar BV Applications4 Aug 20243 Oct 20244 Aug 2025
582bakerybargains.comGoDaddy.com, LLC19 Jan 200820 Jan 202419 Jan 2026
583bakeraviation.comGoDaddy.com, LLC1 Apr 200314 Jul 20231 Apr 2025
584bakeryovens.netGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
585bakerbuildingcare.neteNom, Inc.30 Oct 201430 Oct 201430 Oct 2015
586bakerstown.comeNom, Inc.9 Nov 20028 Nov 20249 Nov 2025
587bakeryo.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED7 Mar 20257 Mar 20257 Mar 2026
588bakershell.comSoaring Eagle Domains, LLC25 Sep 202125 Sep 202125 Sep 2022
589bakersfieldbud.comGoDaddy.com, LLC9 Mar 20199 Mar 20239 Mar 2025
590bakersfieldbuds.comGoDaddy.com, LLC7 Dec 20131 Jan 20157 Dec 2015
591bakersfieldcannabis.comGoDaddy.com, LLC7 Dec 201318 Feb 20257 Dec 2024
592bakerycakeslasvegas.comWild West Domains, LLC7 May 20138 May 20157 May 2016
593bakersfieldlocksmith.comGoDaddy.com, LLC31 Jan 20114 Dec 202331 Jan 2029
594bakersfieldpersonalinjuryattorney.comGo China Domains, LLC13 Apr 201114 Apr 202413 Apr 2025
595bakersfieldredlion.comWild West Domains, LLC17 Sep 200328 Aug 202417 Sep 2025
596bakersovens.comUniregistrar Corp30 Aug 200831 Aug 202430 Aug 2025
597bakercountyfl.comGoDaddy.com, LLC29 Oct 20029 Oct 202429 Oct 2025
598bakersfieldautoglass.netGoDaddy.com, LLC19 Nov 20121 Dec 201419 Nov 2015
599bakersheriff.orgNetwork Solutions, LLC3 Apr 200028 Oct 20243 Apr 2026
600bakeright.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Jan 200723 Nov 20249 Jan 2026
601bakerypoint.comDynadot, LLC26 May 20158 Jul 202326 May 2029
602bakersfieldrealty.comGoDaddy.com, LLC4 Apr 200020 Sep 20222 Feb 2026
603bakervilleuniversity.comGoDaddy.com, LLC27 Dec 20216 Feb 202527 Dec 2025
604bakerwooddriftboats.comNameKing.com Inc.15 Mar 200919 Dec 202415 Mar 2025
605bakerconcrete.jobsName Share, Inc.7 Jan 20127 Jan 20197 Jan 2020
606bakersandandgravel.comBeijing Lanhai Jiye Technology Co., Ltd7 Jul 20218 Jul 20237 Jul 2024
607bakerit.comNamesource LLC23 Dec 202413 Jan 202523 Dec 2025
608bakernissan.comNetwork Solutions, LLC20 Jun 200221 Apr 202420 Jun 2029
609bakersice.comGoDaddy.com, LLC23 Mar 20063 Mar 202423 Mar 2025
610bakerboy.comGoDaddy.com, LLC5 May 19964 Nov 20243 Nov 2025
611bakeries-forsale.comWild West Domains, LLC19 Jan 20055 Mar 201519 Jan 2016
612bakerfarmsgreens.comGoDaddy.com, LLC29 Mar 201323 Feb 202329 Mar 2025
613bakerdistrict.comAnnulet LLC12 Nov 201830 Dec 202412 Nov 2025
614bakersfield247.comGoDaddy.com, LLC23 Jan 200522 Jan 202523 Jan 2026
615bakersfieldairportlimo.comGoDaddy.com, LLC15 Aug 200816 Aug 201415 Aug 2015
616bakersfieldsupport.comGoDaddy.com, LLC4 Jan 200919 Apr 20154 Jan 2016
617bakerspower.comGoDaddy.com, LLC28 Oct 20081 Nov 202428 Oct 2029
618bakerymix.comGoDaddy.com, LLC2 May 20063 May 20242 May 2025
619bakeryscience.comGoDaddy.com, LLC24 Feb 200725 Feb 202524 Feb 2026
620bakerscreekkarting.orgWild West Domains, LLC4 Jun 201520 May 20244 Jun 2025
621bakersfieldchamber.orgName.com, Inc.17 Apr 200031 Mar 202417 Apr 2025
622bakersfieldhyundai.comGoDaddy.com, LLC28 Apr 200926 Oct 20221 Nov 2027
623bakercounty.orgNetwork Solutions, LLC30 Nov 19995 Oct 202230 Nov 2027
624bakercorp.comGoDaddy.com, LLC6 May 200520 Dec 20246 May 2026
625bakersrosin.comTucows Domains Inc.25 Aug 200718 Aug 202425 Aug 2025
626bakersservice.netGoDaddy.com, LLC18 Oct 201111 Feb 202518 Oct 2025
627baker-harris.comNetwork Solutions, LLC23 May 200024 Mar 202423 May 2027
628bakersfieldautointeriors.comLaunchpad, Inc.18 Mar 202312 Mar 202418 Mar 2025
629bakerydelivered.comDROPCATCH.COM 765 LLC25 Apr 202226 Apr 202325 Apr 2024
630bakeryboulevard.comAscio Technologies, Inc. Danmark - Filial af Ascio…14 Jul 202213 Sep 202414 Jul 2024
631bakeryblvd.comWix.com Ltd.22 Jun 202422 Jun 202422 Jun 2025
632bakeruedu.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Oct 201431 Oct 201431 Oct 2015
633bakertily.bizTucows Domains Inc.31 Oct 20143 Nov 201530 Oct 2015
634bakersframingart.comNetwork Solutions, LLC31 Oct 201431 Oct 201431 Oct 2016
635bakersfieldlogodesign.com----
636bakersfieldcustomsigns.comregister.com, Inc.31 Oct 20149 Nov 202131 Oct 2026
637bakercattlecompany.comGoogle, Inc.11 Jul 201711 Jul 201711 Jul 2018
638bakerbednar.comNetwork Solutions, LLC3 Sep 202316 Oct 20243 Sep 2024
639bakerlakelodge.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 201114 Oct 201630 Nov 2017
640baker-riechmann.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Aug 200412 Mar 201511 Aug 2015
641bakercountypress.comGoDaddy.com, LLC23 Sep 200224 Sep 202423 Sep 2026
642bakersfieldkidsspeak.comGoDaddy.com, LLC6 Aug 200716 Sep 20236 Aug 2023
643bakerboyzz.comGoDaddy.com, LLC1 Dec 20134 May 20151 Dec 2015
644bakersfieldlightingsupply.comGoDaddy.com, LLC3 Oct 20143 Oct 20143 Oct 2015
645bakersfieldcalif-edu.netPDR Ltd. d/b/a PublicDomainRegistry.com29 Aug 199725 Jul 201728 Aug 2018
646bakercreek.comGoDaddy.com, LLC26 May 19976 Sep 202225 May 2031
647bakerintl.comNetwork Solutions, LLC26 May 199828 May 202425 May 2029
648bakerteam.comGoDaddy.com, LLC8 Feb 19999 Jan 20248 Feb 2027
649bakerpool.comeNom, Inc.6 Nov 19983 Jan 20235 Nov 2028
650bakersfieldbuyandsell.comGoDaddy.com, LLC12 Nov 200912 Nov 202412 Nov 2025
651bakercadillac.orgMarkMonitor Inc.4 Jun 20123 May 20184 Jun 2019
652bakercustomjewelry.comGoogle, Inc.29 Mar 200120 Apr 202429 Mar 2025
653bakerhouse1885.comGoDaddy.com, LLC1 Mar 20102 Mar 20251 Mar 2026
654bakersfieldpride.org1&1 Internet AG25 Jan 200825 Jan 202525 Jan 2026
655bakermans.comGoDaddy.com, LLC28 Oct 200117 Sep 202428 Oct 2025
656bakercysttreatment.comGoDaddy.com, LLC30 Mar 201331 Mar 201530 Mar 2016
657bakerfhwichita.comGoDaddy.com, LLC23 Mar 201228 Feb 202523 Mar 2026
658bakeryjobs.orgKey-Systems GmbH26 Aug 201416 Jan 202526 Aug 2025
659bakersfieldrealestateteam.comGoDaddy.com, LLC21 Jun 202421 Jun 202421 Jun 2025
660bakersfieldhomeimprovement.comGoDaddy.com, LLC21 Feb 200321 Feb 202521 Feb 2026
661bakerspd.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Sep 20007 Oct 202418 Sep 2025
662bakerscouche.comOVH sas24 Apr 201325 Apr 202424 Apr 2025
663bakeryreformulation.comMegazone Corp., dba HOSTING.KR13 Apr 202013 Apr 202013 Apr 2021
664bakerso.comPorkbun, LLC1 Jun 200912 Nov 20241 Jun 2025
665bakersfieldfitbodyyoga.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jun 20116 May 201423 Jun 2016
666bakerairguns.comGoDaddy.com, LLC31 Jul 20136 Aug 202431 Jul 2025
667bakerpools.comGoDaddy.com, LLC21 May 20022 Oct 202221 May 2025
668bakersfest.comNameKing.com Inc.8 Apr 201522 Jun 20248 Apr 2024
669bakerynewyorkny.comPDR Ltd. d/b/a PublicDomainRegistry.com29 May 201225 Apr 201729 May 2018
670bakerskitchennewbern.comNetwork Solutions, LLC15 Feb 201217 Dec 202415 Feb 2026
671bakerzimmerman.comGoDaddy.com, LLC16 Mar 200216 Mar 202415 Mar 2026
672bakernet.comNetwork Solutions, LLC18 Apr 199530 Oct 202319 Apr 2028
673bakercorp.netAutomattic Inc.26 Jan 202111 Aug 202326 Jan 2027
674bakercreekbistro.comHefei Juming Network Technology Co., Ltd29 Mar 202318 Feb 202529 Mar 2027
675bakerycases.netTucows Domains Inc.24 Dec 202424 Dec 202424 Dec 2025
676bakersjewelry.netPDR Ltd. d/b/a PublicDomainRegistry.com5 Apr 201229 Mar 20245 Apr 2025
677bakerfuniture.comGoDaddy.com, LLC12 Apr 202327 Apr 202412 Apr 2025
678bakerscandc.comGoDaddy.com, LLC23 Jun 199729 Aug 202222 Jun 2025
679bakers-exchange.com-26 Jan 202320 Jan 202526 Jan 2026
680bakerwatches.comKey-Systems GmbH21 Sep 201521 Sep 201521 Sep 2016
681bakersthomasville.comNameCheap, Inc.5 Sep 20176 Aug 20245 Sep 2025
682bakerysuwaneega.comTucows Domains Inc.11 Jun 201411 Jun 201411 Jun 2017
683bakerdrivetrain.comNetwork Solutions, LLC18 May 200019 Mar 202418 May 2029
684bakerfuneralhomeofmoultrie.comGoDaddy.com, LLC19 Jul 201120 Jul 202419 Jul 2025
685bakertargets.comTucows Domains Inc.12 Mar 201325 Feb 202512 Mar 2026
686bakerylasvegas.bizPDR Ltd. d/b/a PublicDomainRegistry.com18 Nov 200712 Mar 201517 Nov 2015
687bakersfieldfinancialplanner.comGoDaddy.com, LLC6 Apr 200718 Apr 20246 Apr 2025
688bakersfieldrefinancing.comGoDaddy.com, LLC8 Apr 200720 Jun 20158 Apr 2016
689bakersfieldbusinessbroker.comGoDaddy.com, LLC6 Apr 20077 Apr 20236 Apr 2025
690bakersfieldinsuranceagent.comGoDaddy.com, LLC6 Apr 200718 Apr 20246 Apr 2025
691bakersfieldbusinessbrokers.comTurnCommerce, Inc. DBA NameBright.com28 Oct 201722 Oct 202028 Oct 2025
692bakersvilleflowers.com----
693bakerwatersystems.comGoDaddy.com, LLC15 Sep 201110 Sep 202215 Sep 2026
694bakeries.usUniregistrar Corp1 Dec 201625 Dec 201630 Nov 2017
695bakersfieldpersonalinjuryattorneys.comDynadot6 LLC12 Sep 202412 Sep 202412 Sep 2025
696bakersfieldpersonalinjurylawyers.comGoDaddy.com, LLC3 Apr 20194 Apr 20243 Apr 2025
697bakersbestflour.comGoDaddy.com, LLC18 Oct 20108 May 20157 May 2016
698bakerybestflour.comGoDaddy.com, LLC18 Oct 20108 May 20157 May 2018
699bakerwrapxp.comGoDaddy.com, LLC20 Dec 201422 Dec 201420 Dec 2015
700bakersauto.comNetwork Solutions, LLC9 Nov 199910 Sep 20219 Nov 2026
701bakercountyfl.orgNetwork Solutions, LLC23 May 200124 Jul 202223 May 2028
702bakerchevrolet.comGoDaddy.com, LLC28 Dec 200014 Sep 202228 Dec 2025
703bakeryschools.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Feb 20061 Feb 20258 Feb 2026
704bakerathletic.comNamesilo, LLC5 Apr 201922 Sep 20195 Apr 2020
705bakersfieldrealestateagent.comGoDaddy.com, LLC1 Dec 20039 Dec 20241 Dec 2025
706bakerlawga.comregister.com, Inc.2 Nov 201420 Oct 20242 Nov 2026
707bakerhughesalumni.comGoDaddy.com, LLC23 Jan 201723 Jan 201723 Jan 2018
708bakerbash.comTucows Domains Inc.20 Nov 202231 Jan 202420 Nov 2023
709bakersfieldeyedoc.comTLDs LLC dba SRSplus28 Jun 200513 Jun 202428 Jun 2029
710bakerscartsupply.comGoDaddy.com, LLC30 Nov 200519 Apr 202320 May 2025
711bakerpublicrelations.comGoDaddy.com, LLC31 Aug 200731 Aug 202431 Aug 2025
712bakersribs.comNetwork Solutions, LLC5 Jan 19997 Nov 20245 Jan 2030
713bakersfieldfamilyattorney.comNameCheap, Inc.3 Dec 20163 Nov 20243 Dec 2025
714bakers.ccCloudFlare, Inc.11 Mar 201927 Jul 202411 Mar 2025
715bakerskitchen.comTurnCommerce, Inc. DBA NameBright.com21 May 200111 Jul 202121 May 2025
716bakersfieldblog.comFabulous.com Pty Ltd.14 Apr 20166 Dec 201614 Apr 2018
717bakeryummy.comGoDaddy.com, LLC7 Aug 201318 Jul 20247 Aug 2025
718bakertransmission.comGoDaddy.com, LLC3 May 20223 May 20223 May 2023
719bakersfieldmoldremoval.comNameCheap, Inc.31 Mar 20231 Mar 202431 Mar 2025
720bakerbook.comGoDaddy.com, LLC27 Nov 200429 Nov 202427 Nov 2025
721bakersignsandgraphics.netTucows Domains Inc.28 Oct 20111 Nov 201428 Oct 2015
722bakerstreetboz.comInternet Domain Services BS Corp18 May 202118 May 202118 May 2022
723bakerbrandcommunications.comTucows Domains Inc.4 Jun 20128 Jun 20154 Jun 2016
724bakersfieldasianescort.comDomain.com, LLC9 Jun 201112 Jun 20159 Jun 2016
725bakersfieldasianescorts.comDomain.com, LLC9 Jun 201112 Jun 20159 Jun 2016
726bakerycloud.comGoDaddy.com, LLC7 Jul 201124 Dec 20247 Jul 2025
727bakerymyanmar.comGoDaddy.com, LLC14 Aug 20132 May 201514 Aug 2015
728bakeryyangon.comGoDaddy.com, LLC14 Aug 201314 Aug 201314 Aug 2015
729bakertv.comTurnCommerce, Inc. DBA NameBright.com3 Dec 201727 Nov 20203 Dec 2024
730bakerysonganh.com----
731bakeryclass.comGoDaddy.com, LLC8 Aug 201130 Aug 20248 Aug 2025
732bakersprolawnraleigh.comeNom, Inc.12 Jun 201313 Jun 201512 Jun 2016
733bakersfieldmortgagelenders.comeNom, Inc.12 Jun 201413 Jun 201512 Jun 2016
734bakerlaw-az.comenom451, Incorporated13 Apr 202423 Oct 202413 Apr 2025
735bakersfieldcalifornian.comGoDaddy.com, LLC1 Dec 19981 Dec 202430 Nov 2025
736bakersfieldcity.infoDynadot, LLC20 Mar 200717 Oct 202420 Mar 2025
737bakersfieldcondors.comGoDaddy.com, LLC2 Jul 19981 Jul 20241 Jul 2025
738bakercityherald.comGoDaddy.com, LLC10 Aug 19989 Aug 20249 Aug 2025
739bakersfieldspeedway.comGKG.NET, INC.18 Jan 200020 Dec 202418 Jan 2026
740bakerauction.comGoDaddy.com, LLC28 Jan 20001 Oct 202228 Jan 2027
741bakercity.netDynadot, LLC11 Apr 200717 Oct 202411 Apr 2025
742bakeras.comGoDaddy.com, LLC15 Jun 20042 Sep 202215 Jun 2026
743bakerbonnigson.comAbove.com Pty Ltd.22 Mar 20025 Mar 202322 Mar 2025
744bakerchapel.orgNameCheap, Inc.17 Feb 202517 Feb 202517 Feb 2026
745bakercity.comNetwork Solutions, LLC9 May 199714 May 202410 May 2029
746bakercountyteaparty.org----
747bakerfuneralberea.comGoDaddy.com, LLC7 Jul 20098 Jul 20247 Jul 2025
748bakersfieldads.netDomain.com, LLC27 Apr 20109 Apr 202427 Apr 2025
749bakersfieldcityacc.us----
750bakersfieldfreeways.usGoDaddy.com, LLC13 Jan 200613 Jan 201712 Jan 2019
751bakersfieldhouseinvesting.comGoDaddy.com, LLC26 Nov 20128 Dec 201426 Nov 2015
752bakerspride.comCSC Corporate Domains, Inc.10 Dec 19965 Dec 20249 Dec 2025
753bakerstevensparramore.comGoDaddy.com, LLC27 Jan 20102 Apr 202427 Jan 2026
754bakerynouveau.comregister.com, Inc.16 Nov 200616 Aug 202116 Nov 2026
755bakeryproductions.comGoogle, Inc.13 Jul 202328 Jun 202413 Jul 2025
756bakerite.coGoDaddy.com, LLC7 Jun 201112 Jun 20156 Jun 2015
757bakerite.org-13 May 202319 Jul 202413 May 2024
758bakersfieldteas.comGoDaddy.com, LLC6 Jun 20147 Jun 20156 Jun 2016
759bakershusband.comFastDomain Inc.26 Aug 201526 Aug 201526 Aug 2016
760bakerblues.comGoDaddy.com, LLC21 Mar 20006 Jul 20245 Aug 2026
761bakerindustries.orgNetwork Solutions, LLC22 Aug 20006 Oct 202422 Aug 2025
762bakerboyzracing.comGoDaddy.com, LLC6 Jun 20127 Jun 20156 Jun 2016
763bakerssquare-eclub.comGoDaddy.com, LLC3 Feb 20253 Feb 20253 Feb 2026
764bakerite.bizGoDaddy.com, LLC7 Jun 20117 Jun 20156 Jun 2015
765bakerite.mobiGoDaddy.com, LLC7 Jun 20118 Jun 20157 Jun 2016
766bakersfieldspca.orgNetwork Solutions, LLC25 Mar 19999 May 202425 Mar 2025
767bakerite.infoNameCheap, Inc.23 Feb 202423 Feb 202523 Feb 2026
768baker-thompson.comGoDaddy.com, LLC8 Jun 20128 Jun 20158 Jun 2016
769bakerpostfh.comGoDaddy.com, LLC5 Feb 20089 Feb 20255 Feb 2027
770bakersfield.orgGoDaddy.com, LLC20 Apr 199914 Jun 202420 Apr 2025
771bakersfieldtrackclub.comenom427, Incorporated30 Jan 202431 Jan 202530 Jan 2026
772bakersup.comNamesilo, LLC7 Sep 20207 Sep 20207 Sep 2021
773bakeryclasses.comNameKing.com Inc.20 Jan 202122 Dec 202420 Jan 2026
774bakerhometour.comGoDaddy.com, LLC2 Nov 201417 Sep 20222 Nov 2031
775bakersbakery.bizNamesilo, LLC1 Dec 201615 Jan 202530 Nov 2025
776bakersfieldgasprices.comGoDaddy.com, LLC28 Jul 20001 Aug 202328 Jul 2026
777bakerbuilt.comGoDaddy.com, LLC18 Jun 199717 Jun 202417 Jun 2025
778bakerysystem.netGoDaddy.com, LLC9 Jun 201410 Jun 20159 Jun 2016
779bakerhughes.jobsName Share, Inc.27 Jul 201121 Mar 201627 Jul 2016
780bakerbaran.comGoDaddy.com, LLC8 Jun 20128 Jun 20158 Jun 2016
781bakerstreetreviews.comNamesilo, LLC27 Aug 201531 Jul 201727 Aug 2017
782bakersfield.jobsName Share, Inc.23 Aug 202423 Aug 202423 Aug 2025
783bakerfuneral.comGoDaddy.com, LLC24 Mar 20062 Mar 202324 Mar 2025
784bakersdrivethru.comNetwork Solutions, LLC5 Sep 199719 Aug 20234 Sep 2028
785bakerstuartmd.netregister.com, Inc.1 Nov 20141 Nov 20141 Nov 2015
786bakerauto.netGoogle, Inc.26 Oct 202227 Oct 202326 Oct 2024
787bakerroadcarworks.comGoDaddy.com, LLC10 Jun 201311 Jun 201510 Jun 2016
788bakerchiropractic.orgGoDaddy.com, LLC11 May 20069 Jul 202411 May 2026
789bakerandolive.comGoDaddy.com, LLC25 Oct 200926 Oct 202425 Oct 2025
790bakeryingredients.netGoDaddy.com, LLC10 Jun 201411 Jun 201510 Jun 2016
791bakersfieldsportsnet.usGoDaddy.com, LLC12 Jun 201412 Jun 201411 Jun 2015
792bakersfieldsportsnetwork.netGoDaddy.com, LLC12 Jun 201412 Jun 201512 Jun 2016
793bakersfieldfinancial.orgGoDaddy.com, LLC11 Jun 201323 Jun 201511 Jun 2016
794bakersfieldsportsnet.comGoDaddy.com, LLC12 Jun 201412 Jun 201512 Jun 2016
795bakersfieldsports.netGoDaddy.com, LLC12 Jun 201412 Jun 201512 Jun 2016
796bakersfieldsportsnetwork.usGoDaddy.com, LLC12 Jun 201412 Jun 201411 Jun 2015
797bakerlionspride.comeNom, Inc.11 May 200818 May 202411 May 2025
798bakerelectricsolar.comNetwork Solutions, LLC15 Jan 20083 Feb 202315 Jan 2026
799bakersfieldsportsnetwork.comGoDaddy.com, LLC7 Jan 20227 Jan 20227 Jan 2023
800bakerycakebox.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…24 Nov 202325 Nov 202424 Nov 2025
801bakeraw.comNameCheap, Inc.24 Sep 202424 Sep 202424 Sep 2025
802bakerchocolatefactory-apts.comNet-Chinese Co., Ltd.25 Jul 202225 Jul 202225 Jul 2023
803bakerlumberco.comKey-Systems GmbH26 Nov 20228 Feb 202426 Nov 2023
804bakermaid.comTucows Domains Inc.28 Jun 201014 Jun 202428 Jun 2025
805bakersfieldobserved.comeNom, Inc.24 Dec 200818 Dec 202424 Dec 2025
806bakerholtz.comGoDaddy.com, LLC23 Apr 20121 May 202423 Apr 2027
807bakersfieldhighschool.orgGoDaddy.com, LLC5 Sep 200710 Jul 20245 Sep 2025
808bakersfieldeyeinstitute.comGoDaddy.com, LLC11 Feb 200712 Feb 202511 Feb 2030
809bakermontana.usGoDaddy.com, LLC27 Jun 201317 Jun 202426 Jun 2025
810bakerprecision.comNetwork Solutions, LLC18 Jun 19985 Oct 202317 Jun 2025
811bakercoa.orgPorkbun, LLC4 Apr 201112 Nov 20244 Apr 2028
812bakerheritagemuseum.comNetwork Solutions, LLC14 Mar 200813 Jan 202514 Mar 2026
813bakerynearme.orgInternet Domain Services BS Corp19 Nov 201420 Mar 201619 Nov 2017
814bakerandsons.comeNom, Inc.16 Aug 200017 Jul 202416 Aug 2029
815bakerresidential.comGoDaddy.com, LLC5 Mar 20036 Mar 20255 Mar 2026
816bakersfieldjetcenter.comNetwork Solutions, LLC20 Dec 200721 Oct 202320 Dec 2025
817bakersfield-propertymanager.comGoDaddy.com, LLC8 Mar 201020 Aug 20238 Mar 2025
818bakersfieldmedicalgroup.orgNetwork Solutions, LLC17 Sep 20138 Jan 201517 Sep 2016
819bakersfieldaidsproject.orgGoDaddy.com, LLC15 Jun 200610 Jun 202415 Jun 2025
820bakersfieldhearthospital.comBrandsight, Inc.27 Jun 200022 Oct 202427 Jun 2026
821bakerspeppers.com-22 Dec 202426 Dec 202422 Dec 2025
822bakershow.comGoDaddy.com, LLC7 May 20138 May 20247 May 2026
823bakertirellc.comeNom, Inc.5 Sep 20137 Aug 20245 Sep 2025
824bakerphotography.coGoDaddy.com, LLC24 Jun 20115 Jul 202423 Jun 2025
825bakerandspicebakery.comGMO Internet Inc.21 Dec 201618 Nov 202421 Dec 2025
826bakeryrepair.comGoDaddy.com, LLC2 Sep 19993 Sep 20242 Sep 2025
827bakersfieldhomeking.comGoDaddy.com, LLC1 Jun 20112 Jun 20231 Jun 2025
828bakerburg.orgGoDaddy.com, LLC5 Mar 200811 Mar 20255 Mar 2026
829bakersrackshack.comGoDaddy.com, LLC4 Dec 200616 Apr 20154 Dec 2015
830bakersfieldcity.mobiGoDaddy.com, LLC13 Aug 200727 Sep 202413 Aug 2026
831baker-online.comNetwork Solutions, LLC13 Nov 199614 Oct 202412 Nov 2025
832bakermetalworksfl.comGoDaddy.com, LLC5 Jan 20062 Sep 20245 Jan 2026
833bakerbluminfamilytree.compair Networks, Inc. d/b/a pairNIC8 Jun 200424 May 20248 Jun 2029
834bakerelections.comGoDaddy.com, LLC19 Jan 20074 Sep 202219 Jan 2032
835bakerpartsandtowing.comeNom, Inc.26 Sep 201411 Feb 201526 Sep 2015
836bakeraecom.comDropCatch.com 555 LLC28 Aug 201928 Aug 201928 Aug 2020
837baker-miller.comGoDaddy.com, LLC19 Feb 200320 Feb 202519 Feb 2028
838bakersfiedlcalifornian.com----
839bakersguide.comCloudFlare, Inc.1 Dec 199922 Nov 20241 Dec 2025
840bakerzbella.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Aug 201722 Aug 201722 Aug 2018
841bakervu.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2015
842bakerspress.comGoDaddy.com, LLC4 Nov 201415 Jan 20254 Nov 2024
843bakersfieldnotarypublic.comeNom, Inc.6 Apr 20156 Jun 20246 Apr 2025
844bakersfieldelderlawyer.comGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2016
845bakerscornerpizza.comDropCatch.com 1534 LLC7 Nov 202318 Dec 20247 Nov 2024
846bakerlocator.comGoDaddy.com, LLC25 Jun 202224 May 202425 Jun 2025
847bakerkendallbash.comregister.com, Inc.4 Nov 20144 Nov 20144 Nov 2015
848bakerexcavatingandhauling.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
849bakerchina.com-26 Jun 202426 Jun 202426 Jun 2025
850bakerandcoe.comAscio Technologies, Inc. Danmark - Filial af Ascio…3 Nov 201413 Oct 20173 Nov 2018
851bakerssquare.jobsName.com, Inc.10 Jul 201310 Jul 202210 Jul 2023
852bakersbesthealth.comNetwork Solutions, LLC3 Jan 20084 Nov 20243 Jan 2026
853bakerracingengines.comGoDaddy.com, LLC21 Dec 200722 Dec 202421 Dec 2025
854bakersfieldpetfoodpantry.orgNetwork Solutions, LLC8 Dec 200916 May 20248 Dec 2026
855bakerfloral.comMarkMonitor Inc.7 Nov 20026 Oct 20247 Nov 2025
856bakerpetroleumde.comGoDaddy.com, LLC4 Mar 201027 Feb 20254 Mar 2026
857bakersfieldrugs.comNetwork Solutions, LLC23 Feb 200025 Dec 202223 Feb 2026
858bakerancestry.orgeNom, Inc.21 Feb 201023 Jan 202221 Feb 2026
859bakersfieldvoice.comGoDaddy.com, LLC28 Dec 200628 Dec 202428 Dec 2025
860bakerhometour.orgGoDaddy.com, LLC2 Nov 201429 Oct 20162 Nov 2018
861bakersfieldchristian.comGoDaddy.com, LLC19 Jul 199920 Jul 202319 Jul 2031
862bakersfieldccc.orgTucows Domains Inc.24 Sep 201314 Sep 202424 Sep 2025
863bakersfielddba.comLaunchpad, Inc.4 Apr 200720 Mar 20244 Apr 2025
864baker-street-studios.comNameCheap, Inc.11 Nov 200417 Sep 202411 Nov 2025
865bakersamerican.comGoDaddy.com, LLC25 May 201026 May 202425 May 2025
866bakersjournal.comTucows Domains Inc.3 Dec 19994 Nov 20243 Dec 2025
867bakersfieldmemorial.orgNetwork Solutions, LLC1 Aug 200319 Jun 20231 Aug 2026
868bakernorth.comTucows Domains Inc.16 Feb 202516 Feb 202516 Feb 2026
869bakerfacts.comCloud Yuqu LLC4 Aug 20204 Aug 20204 Aug 2021
870bakermfginc.comTucows Domains Inc.19 Mar 19994 Mar 202419 Mar 2025
871bakershardware.comregister.com, Inc.30 Jan 199931 Jan 202530 Jan 2026
872bakersrackdealers.comGoDaddy.com, LLC22 May 201922 May 201922 May 2020
873bakerscyst.comGoDaddy.com, LLC15 Nov 200116 Nov 202415 Nov 2025
874bakersandartists.comGoDaddy.com, LLC20 Oct 201021 Oct 202420 Oct 2025
875bakersfieldrestaurant.comNameCheap, Inc.24 Apr 20081 Nov 202424 Apr 2025
876bakersvillagegardencenter.comGoDaddy.com, LLC8 Feb 20079 Feb 20258 Feb 2026
877bakerfhvc.comGoDaddy.com, LLC30 Mar 201129 Feb 202430 Mar 2025
878bakerartistawards.orgInternet Domain Services BS Corp12 May 20085 May 202412 May 2025
879bakersdozeh.comAnnulet LLC31 Aug 20117 Jul 201631 Aug 2017
880bakersfieldgrocerydelivery.comGoDaddy.com, LLC16 Jun 201115 Jun 202416 Jun 2025
881bakerfuneralservice.comGoDaddy.com, LLC10 Nov 200511 Nov 202410 Nov 2025
882bakerimplement.comBrandsight, Inc.2 Mar 200030 Jan 20252 Mar 2026
883bakeryunlimitedtoledo.comGoDaddy.com, LLC1 Apr 200930 Mar 20241 Apr 2025
884bakersfieldalterations.comWild West Domains, LLC31 Oct 20111 Nov 202431 Oct 2025
885bakerautopartsmi.comGoDaddy.com, LLC3 Mar 200618 Oct 20223 Mar 2029
886bakerytop.comFlappy Domain, Inc4 May 201726 Aug 20174 May 2018
887bakerystickers.comGoDaddy.com, LLC4 Nov 20145 Nov 20164 Nov 2017
888bakerylabel.comGoDaddy.com, LLC3 Jan 202330 Dec 20243 Jan 2026
889bakeryearendcloseout.comGoDaddy.com, LLC4 Nov 20145 Nov 20164 Nov 2017
890bakerybkk.comGoDaddy.com, LLC1 Aug 202313 Oct 20241 Aug 2024
891bakery7.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…9 Dec 202411 Dec 20249 Dec 2025
892bakersfieldwelcomeservice.comAmazon Registrar, Inc.4 Nov 20141 Oct 20244 Nov 2025
893bakersfieldbrew.comGoDaddy.com, LLC18 Mar 202130 May 202318 Mar 2023
894bakerrecord.comGoDaddy.com, LLC1 Apr 20161 Apr 20161 Apr 2017
895bakerbonningson.comGoDaddy.com, LLC21 Apr 20213 Jul 202321 Apr 2023
896baker2018.comNameCheap, Inc.5 Nov 20148 Jan 20185 Nov 2020
897bakersfieldeconomicsclub.comGoDaddy.com, LLC12 Jun 201213 Jun 201512 Jun 2016
898bakerelectric.orgName.com, Inc.30 Aug 201513 Aug 202430 Aug 2025
899bakersfieldhousefinder.comGoDaddy.com, LLC14 Sep 201715 Sep 202314 Sep 2025
900bakersfieldeconomicsclub.orgGoDaddy.com, LLC12 Jun 201224 Jun 201512 Jun 2016
901bakeryparadise.infoGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2015
902bakerrecord.infoGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2015
903bakersbay-condos.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
904bakersfieldunits.comGoDaddy.com, LLC15 Jun 201315 Jun 201515 Jun 2016
905bakersfielddentist.orgGoDaddy.com, LLC14 Jun 201030 May 202414 Jun 2025
906baker-dish.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Aug 201418 Aug 201418 Aug 2015
907baker-fam.netTucows Domains Inc.15 Aug 201319 Aug 201415 Aug 2015
908bakerbostonrealtygroup.comGoDaddy.com, LLC18 Aug 201430 Oct 202418 Aug 2024
909bakerenergysolutions.com1&1 Internet AG18 Aug 201415 Feb 201818 Aug 2025
910bakerrecipe.comHostinger, UAB21 Oct 202421 Dec 202421 Oct 2025
911bakersfieldcolonics.comGoDaddy.com, LLC7 Nov 202110 Aug 20247 Nov 2025
912bakersfieldpatio.comTurnCommerce, Inc. DBA NameBright.com18 Aug 201426 Jul 202218 Aug 2025
913bakersfieldpatios.comTucows Domains Inc.18 Aug 201420 Jul 202418 Aug 2025
914bakersriseup.comWild West Domains, LLC18 Aug 201418 Aug 201418 Aug 2015
915bakerysupplies.infoGoDaddy.com, LLC18 Aug 201419 Aug 201718 Aug 2018
916bakersfieldhealthexchange.comGoDaddy.com, LLC14 Jun 201315 Jun 201514 Jun 2016
917bakersfieldtherapist.com-25 May 202123 Jun 202425 May 2025
918bakeryimage.comGoDaddy.com, LLC15 Jun 201415 Jun 201515 Jun 2016
919bakerlemke.comGoDaddy.com, LLC15 Jun 201416 Jun 201515 Jun 2016
920bakeryville.usGoDaddy.com, LLC16 Jun 201116 Jun 201315 Jun 2015
921bakersfieldfamilylawattorney.com1&1 Internet AG5 Oct 202311 Dec 20235 Oct 2025
922bakersfieldsafehalloween.comEvoPlus Ltd.9 Sep 20159 Sep 20159 Sep 2016
923bakeryville.infoGoDaddy.com, LLC16 Jun 201116 Jun 201516 Jun 2016
924bakeryville.orgGoDaddy.com, LLC16 Jun 201128 Jun 201516 Jun 2016
925bakeryville.mobiGoDaddy.com, LLC16 Jun 201117 Jun 201516 Jun 2016
926bakerstreetsweets.comFastDomain Inc.9 Jun 20209 Jun 20209 Jun 2021
927bakeryville.netGoDaddy.com, LLC16 Jun 201117 Jun 201516 Jun 2016
928bakersfieldpoolservices.com-1 Jan 20251 Jan 20251 Jan 2026
929bakerohana.comGoDaddy.com, LLC18 Jun 201418 Jun 201518 Jun 2016
930bakersfield-pestcontrol.comGoDaddy.com, LLC13 Jul 201814 Jul 202413 Jul 2025
931bakercbhs.org----
932bakergirlbakes.comGoDaddy.com, LLC19 Jun 201420 Jun 201519 Jun 2016
933bakerautopartsmichigan.netTucows Domains Inc.20 Aug 201424 Aug 201520 Aug 2016
934bakerdynastynow.comGoDaddy.com, LLC19 Aug 201419 Aug 201419 Aug 2015
935bakersadvies.comKey-Systems GmbH19 Aug 201418 Aug 201719 Aug 2018
936bakersfieldaddictiontreatment.comGoDaddy.com, LLC20 Aug 201421 Aug 202420 Aug 2025
937bakersfieldusedautos.comAmazon Registrar, Inc.18 Nov 201915 Oct 202418 Nov 2025
938bakersprojects.comHosting Concepts B.V. dba Openprovider19 Aug 201411 Dec 202419 Aug 2025
939bakeryorganics.comNameCheap, Inc.5 Dec 202115 Feb 20245 Dec 2023
940bakerholics.comGoDaddy.com, LLC19 Jun 201420 Jun 201519 Jun 2016
941bakersracksfunstore.comGoDaddy.com, LLC19 Jun 200820 Jun 201519 Jun 2016
942bakerysora.comJapan Registry Services Co., Ltd.6 Nov 20144 Nov 20246 Nov 2025
943bakerysky.comTucows Domains Inc.16 Feb 202120 Feb 202316 Feb 2024
944bakerybus.comGoDaddy.com, LLC28 Jul 201828 Jul 202428 Jul 2025
945bakerstore.com-21 Jan 202521 Jan 202521 Jan 2026
946bakersfieldwingchun.comFastDomain Inc.5 Nov 201413 Mar 20165 Nov 2017
947bakersfieldcalfornian.comFabulous.com Pty Ltd.18 Oct 200519 Oct 201718 Oct 2017
948bakersandbutchers.comPSI-USA, Inc. dba Domain Robot5 Nov 201425 Dec 20245 Nov 2025
949bakerportland.comRegister.it SPA5 Nov 201428 Oct 20245 Nov 2026
950bakercountrykitchen.comGoDaddy.com, LLC5 Feb 201810 Feb 20205 Feb 2020
951bakerblackangus.comGoDaddy.com, LLC17 Dec 202017 Dec 202017 Dec 2021
952bakeryplanet.ca----
953bakerfloorsanding.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
954bakersfieldtrees.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
955bakeryouth.comTurnCommerce, Inc. DBA NameBright.com11 Sep 201621 Oct 202411 Sep 2024
956bakerconstructionjoplin.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
957bakerdev.comTurnCommerce, Inc. DBA NameBright.com13 Sep 201621 Aug 202013 Sep 2025
958bakerenterprisellc.comAutomattic Inc.9 Jun 202220 May 20249 Jun 2025
959bakernj.comGoDaddy.com, LLC24 Jun 201518 Sep 202224 Jun 2025
960bakerspondorganicdairy.comregister.com, Inc.25 Jun 201525 Jun 201525 Jun 2016
961bakersq.comGoDaddy.com, LLC4 Dec 20244 Dec 20244 Dec 2027
962bakeryinma.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
963bakerycastle.netPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 20144 Nov 20144 Nov 2015
964bakerrecord.netGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2015
965bakerandrhodesattorneysatlaw.comTucows Domains Inc.17 Aug 201020 Aug 201417 Aug 2015
966bakerfitness.netSquarespace Domains LLC30 May 202229 Jun 202430 May 2024
967bakergreene.comGoDaddy.com, LLC20 Aug 201421 Aug 202420 Aug 2025
968bakerhomes.infoGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
969bakersbodyshop.com-27 Sep 201627 Sep 201627 Sep 2017
970bakersfieldcarinsurancequotes.neteNom, Inc.20 Aug 201420 Aug 201420 Aug 2015
971bakersfieldlibrary.orgeNom, Inc.20 Aug 201420 Aug 201420 Aug 2015
972bakersfieldnobankqualifyhomes.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
973bakersfieldpropertydeals.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
974bakersfieldseo.orgDynadot, LLC19 Aug 201419 Aug 201419 Aug 2015
975bakersfitness.comTucows Domains Inc.9 Sep 201825 Aug 20249 Sep 2025
976bakershomefurniture.comGoDaddy.com, LLC20 Aug 201421 Aug 202420 Aug 2026
977bakertillygreece.comPapaki Ltd.20 Aug 201420 Aug 202420 Aug 2026
978bakertillygreece.netPapaki Ltd.20 Aug 201420 Aug 202420 Aug 2025
979bakerwraps.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
980bakerycrates.comLaunchpad, Inc.1 May 20181 May 20181 May 2019
981bakerbuildingtx.comGoDaddy.com, LLC2 Aug 202126 Nov 20242 Aug 2025
982bakergardner.comregister.com, Inc.12 Jan 201513 Jan 202512 Jan 2026
983bakerplumbing.comDomain.com, LLC28 Apr 20032 Aug 202228 Apr 2026
984bakersfielddigital.comGoDaddy.com, LLC19 Jun 201619 Jun 202419 Jun 2025
985bakersfieldhelpwanted.netNameCheap, Inc.24 Nov 202325 Nov 202424 Nov 2025
986bakersfieldpressurepros.com----
987bakersfieldrealestatebroker.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
988bakersfieldrealestateclub.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
989bakerspaintless.comTucows Domains Inc.16 Apr 202020 Apr 202316 Apr 2024
990bakerspluscommunityrewards.comNetwork Solutions, LLC12 Jan 201513 Nov 202412 Jan 2026
991bakerstoothpaste.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
992bakervineyards.comNameCheap, Inc.16 Mar 202016 Jan 202216 Mar 2027
993bakersfield-traffic-school.comTucows Domains Inc.18 Aug 201221 Aug 201418 Aug 2015
994bakersfieldawnings.comGoDaddy.com, LLC4 Jan 20235 Jan 20254 Jan 2026
995bakersfieldincomeproperty.com1&1 Internet AG15 Jun 202115 Jun 202115 Jun 2022
996bakersfieldpatiosinc.comGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
997bakersfieldsellhomesfast.comGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
998bakersfieldshade.comGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
999bakersfieldstubs.comGoDaddy.com, LLC21 Aug 201422 Apr 201521 Aug 2017
1000bakerdiversionprogram.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016

Displaying 1,000 out of 47,022 domains starting with the keyword "BAKER". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=baker

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now