Our database now contains whois records of 573 Million (573,878,034) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1566 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [573 Million Domains] $10,000 Details

Keyword: BESTFAMILYLAWYER

Reverse Whois » KEYWORD [bestfamilylawyer ]  { 165 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1bestfamilylawyer.ca-24 Jun 201729 Jun 201724 Jun 2018
2bestfamilylawyer.nycNetwork Solutions, LLC16 Oct 201422 Aug 202415 Oct 2025
3bestfamilylawyer.netGoDaddy.com, LLC16 Oct 201516 Oct 201516 Oct 2016
4bestfamilylawyer.usGoDaddy.com, LLC26 Dec 201526 Dec 201525 Dec 2016
5bestfamilylawyer.comeNom, Inc.27 Mar 200827 Mar 202427 Mar 2025
6bestfamilylawyer.topAlpnames Limited30 Jul 20161 Aug 201630 Jul 2017
7bestfamilylawyer.xyzLimited Liability Company "Registrar of domain nam…3 Jun 201629 Jul 20163 Jun 2017
8bestfamilylawyer.online1&1 Internet AG25 Jun 201718 Jul 201725 Jun 2018
9bestfamilylawyer.co.uk-11 Aug 20094 Aug 201711 Aug 2019
10bestfamilylawyer.today1&1 Internet AG2 Jun 20202 Jun 20232 Jun 2024
11bestfamilylawyer.infoGoDaddy.com, LLC15 Sep 202315 Sep 202315 Sep 2024
12bestfamilylawyer.orgGoogle, Inc.3 Nov 202217 Apr 20243 Nov 2024
13bestfamilylawyer.au--15 Aug 2024-
14bestfamilylawyerlv.comLaunchpad, Inc.7 Feb 201516 Jan 20177 Feb 2018
15bestfamilylawyernewyork.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
16bestfamilylawyerinmonmouthcounty.comGoDaddy.com, LLC24 Apr 201524 Apr 201524 Apr 2016
17bestfamilylawyersyracuse.comGoDaddy.com, LLC20 Jun 201521 Jun 202320 Jun 2025
18bestfamilylawyer-divorceattorney.comGoDaddy.com, LLC22 Feb 201622 Feb 201622 Feb 2017
19bestfamilylawyervail.comGoDaddy.com, LLC25 Feb 201625 Feb 201625 Feb 2017
20bestfamilylawyerseattle.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
21bestfamilylawyersanfran.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
22bestfamilylawyerportland.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
23bestfamilylawyerphoenix.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
24bestfamilylawyernyc.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
25bestfamilylawyermiami.comGoDaddy.com, LLC13 Mar 201914 Mar 202413 Mar 2025
26bestfamilylawyerla.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
27bestfamilylawyerdenver.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
28bestfamilylawyerchicago.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
29bestfamilylawyerkc.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
30bestfamilylawyercny.comAmazon Registrar, Inc.5 Jul 201331 May 20245 Jul 2025
31bestfamilylawyers.comGoDaddy.com, LLC1 Dec 20115 Oct 20231 Dec 2024
32bestfamilylawyerschicago.comGoDaddy.com, LLC2 Aug 20133 Aug 20232 Aug 2025
33bestfamilylawyerinpa.comGoDaddy.com, LLC28 Jan 201129 Jan 202428 Jan 2025
34bestfamilylawyerboston.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
35bestfamilylawyerschicago.infoGoDaddy.com, LLC2 Aug 201328 Jun 20242 Aug 2025
36bestfamilylawyerschicago.netGoDaddy.com, LLC2 Aug 20133 Aug 20232 Aug 2025
37bestfamilylawyerschicago.orgGoDaddy.com, LLC2 Aug 20132 Jul 20242 Aug 2025
38bestfamilylawyertoronto.com1&1 Internet AG14 Feb 202414 Feb 202414 Feb 2025
39bestfamilylawyerneworleans.infoGoDaddy.com, LLC21 Mar 20175 May 202421 Mar 2025
40bestfamilylawyerneworleans.comGoDaddy.com, LLC21 Mar 201722 Mar 202321 Mar 2025
41bestfamilylawyerbayarea.comTurnCommerce, Inc. DBA NameBright.com7 Jun 20176 Jun 20176 Jun 2018
42bestfamilylawyersbayarea.comTurnCommerce, Inc. DBA NameBright.com7 Jun 20176 Jun 20176 Jun 2018
43bestfamilylawyerssanfrancisco.comTurnCommerce, Inc. DBA NameBright.com7 Jun 20176 Jun 20176 Jun 2018
44bestfamilylawyersanfrancisco.comTurnCommerce, Inc. DBA NameBright.com7 Jun 20176 Jun 20176 Jun 2018
45bestfamilylawyercalifornia.comGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
46bestfamilylawyerlgbt.comGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
47bestfamilylawyerscalifornia.comGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
48bestfamilylawyerslgbt.comGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
49bestfamilylawyersamesex.comGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
50bestfamilylawyerssamesex.comGoDaddy.com, LLC18 Jun 201718 Jun 201718 Jun 2018
51bestfamilylawyers.winNameCheap, Inc.1 Jul 20171 Jul 20171 Jul 2018
52bestfamilylawyerstoronto.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…17 Mar 202317 Mar 202317 Mar 2024
53bestfamilylawyerintoronto.comNameCheap, Inc.2 Sep 20172 Sep 20172 Sep 2018
54bestfamilylawyers.co.uk-22 Mar 20128 Mar 201622 Mar 2018
55bestfamilylawyers.netTPP Wholesale Pty Ltd.28 Mar 201828 Mar 201828 Mar 2020
56bestfamilylawyersantaclara.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
57bestfamilylawyerstanford.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
58bestfamilylawyersanrafael.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
59bestfamilylawyerpleasanthill.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
60bestfamilylawyerpiedmont.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
61bestfamilylawyerorinda.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
62bestfamilylawyerbelvedere.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
63bestfamilylawyerredwoodcity.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
64bestfamilylawyercontracosta.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
65bestfamilylawyermillvalley.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
66bestfamilylawyermillbrae.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
67bestfamilylawyerblackhawk.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
68bestfamilylawyersunnyvale.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
69bestfamilylawyernortherncalifornia.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
70bestfamilylawyerlarkspur.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
71bestfamilylawyertiburon.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
72bestfamilylawyerwalnutcreek.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
73bestfamilylawyersaratoga.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
74bestfamilylawyerlivermore.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
75bestfamilylawyersf.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
76bestfamilylawyerlosgatos.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
77bestfamilylawyerdanville.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
78bestfamilylawyerlosaltos.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
79bestfamilylawyersausalito.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
80bestfamilylawyerlafayette.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
81bestfamilylawyerbrentwood.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
82bestfamilylawyernovato.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
83bestfamilylawyermenlopark.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
84bestfamilylawyersanramon.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
85bestfamilylawyermilpitas.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
86bestfamilylawyercupertino.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
87bestfamilylawyerpaloalto.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
88bestfamilylawyermountainview.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
89bestfamilylawyerbelmont.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
90bestfamilylawyerberkeley.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
91bestfamilylawyersanmateo.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
92bestfamilylawyersancarlos.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
93bestfamilylawyeralamo.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
94bestfamilylawyersanjose.comTurnCommerce, Inc. DBA NameBright.com18 Oct 201818 Oct 201818 Oct 2019
95bestfamilylawyerhighasset.comTurnCommerce, Inc. DBA NameBright.com11 Nov 201811 Nov 201811 Nov 2019
96bestfamilylawyerswalnutcreek.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
97bestfamilylawyerspleasanthill.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
98bestfamilylawyersmenlopark.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
99bestfamilylawyersbelvedere.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
100bestfamilylawyersorinda.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
101bestfamilylawyersbrentwood.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
102bestfamilylawyerslarkspur.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
103bestfamilylawyerssaratoga.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
104bestfamilylawyerstiburon.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
105bestfamilylawyersnortherncalifornia.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
106bestfamilylawyersmarin.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
107bestfamilylawyerslosaltos.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
108bestfamilylawyerssunnyvale.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
109bestfamilylawyerssantaclara.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
110bestfamilylawyerspiedmont.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
111bestfamilylawyerssanjose.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
112bestfamilylawyerssanrafael.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
113bestfamilylawyersdanville.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
114bestfamilylawyerscontracosta.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
115bestfamilylawyersredwoodcity.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
116bestfamilylawyersmillvalley.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
117bestfamilylawyerslosgatos.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
118bestfamilylawyerspaloalto.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
119bestfamilylawyerssancarlos.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
120bestfamilylawyerscupertino.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
121bestfamilylawyersbelmont.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
122bestfamilylawyersstanford.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
123bestfamilylawyerssf.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
124bestfamilylawyersmountainview.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
125bestfamilylawyersberkeley.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
126bestfamilylawyersmilpitas.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
127bestfamilylawyersnovato.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
128bestfamilylawyersmoraga.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
129bestfamilylawyerssanmateo.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
130bestfamilylawyerslafayette.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
131bestfamilylawyersmillbrae.comTurnCommerce, Inc. DBA NameBright.com29 Nov 201829 Nov 201829 Nov 2019
132bestfamilylawyersiliconvalley.comTurnCommerce, Inc. DBA NameBright.com22 Feb 201922 Feb 201922 Feb 2020
133bestfamilylawyerz.comGoDaddy.com, LLC27 Feb 201928 Feb 202327 Feb 2025
134bestfamilylawyersmadisonwi.comNameCheap, Inc.27 Sep 2019-27 Sep 2020
135bestfamilylawyersjanesvillewi.comNameCheap, Inc.27 Sep 2019-27 Sep 2020
136bestfamilylawyercarson.comGoDaddy.com, LLC30 Mar 202030 Mar 202030 Mar 2021
137bestfamilylawyerreno.comGoDaddy.com, LLC30 Mar 202030 Mar 202030 Mar 2021
138bestfamilylawyersny.comGoogle, Inc.22 May 202022 Jul 202422 May 2024
139bestfamilylawyernearme.comDNC Holdings, Inc.1 Nov 20201 Nov 20202 Nov 2021
140bestfamilylawyersparramatta.siteCrazy Domains FZ-LLC4 May 2021-4 May 2022
141bestfamilylawyerssydney.siteCrazy Domains FZ-LLC4 May 2021-4 May 2022
142bestfamilylawyersbrisbane.siteCrazy Domains FZ-LLC4 May 2021-4 May 2022
143bestfamilylawyers.infoFabulous.com Pty Ltd.2 Jun 202113 Aug 20242 Jun 2024
144bestfamilylawyermarketing.comNameCheap, Inc.8 Aug 20219 Jul 20248 Aug 2025
145bestfamilylawyerauroraillinois.comNameCheap, Inc.6 Sep 20217 Aug 20236 Sep 2024
146bestfamilylawyergenevaillinois.comNameCheap, Inc.6 Sep 20217 Aug 20236 Sep 2024
147bestfamilylawyerstcharles.comNameCheap, Inc.6 Sep 20217 Aug 20246 Sep 2025
148bestfamilylawyernapervilleillinois.comNameCheap, Inc.6 Sep 20217 Aug 20236 Sep 2024
149bestfamilylawyerillinois.comNameCheap, Inc.6 Sep 20217 Aug 20236 Sep 2024
150bestfamilylawyeredmonton.comGoDaddy.com, LLC23 Sep 202118 Jan 202423 Sep 2024
151bestfamilylawyerinsingapore.comUniregistrar Corp14 Nov 20216 Nov 202314 Nov 2024
152bestfamilylawyertoronto.ca-11 Mar 202211 Mar 202211 Mar 2023
153bestfamilylawyers.storeCrazy Domains FZ-LLC23 Jan 202324 Jan 202423 Jan 2025
154bestfamilylawyers.sydneyCrazy Domains FZ-LLC23 Jan 202324 Feb 202323 Jan 2025
155bestfamilylawyerottawa.comWix.com Ltd.7 Mar 202317 May 20247 Mar 2025
156bestfamilylawyersinsingapore.comUniregistrar Corp14 Nov 20216 Nov 202314 Nov 2024
157bestfamilylawyersgoldcoast.onlineCrazy Domains FZ-LLC7 Apr 20238 Apr 20247 Apr 2026
158bestfamilylawyersgoldcoast.com.au--3 Apr 2024-
159bestfamilylawyers.proNameCheap, Inc.25 Sep 202330 Sep 202325 Sep 2024
160bestfamilylawyers.com.au--1 Jun 2024-
161bestfamilylawyersus.comNameCheap, Inc.12 May 202416 May 202412 May 2025
162bestfamilylawyersau.comNameCheap, Inc.12 May 202416 May 202412 May 2025
163bestfamilylawyersca.comNameCheap, Inc.12 May 202416 May 202412 May 2025
164bestfamilylawyersnz.comNameCheap, Inc.12 May 202416 May 202412 May 2025
165bestfamilylawyersinbangalore.comGoDaddy.com, LLC9 Jul 202422 Jul 20249 Jul 2029

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=bestfamilylawyer

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now