Our database now contains whois records of 608 Million (608,981,440) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [608 Million Domains] $10,000 Details

Keyword: BINANCEE

Reverse Whois » KEYWORD [binancee ]  { 411 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1binancee.comDynadot, LLC7 Sep 201720 Aug 20247 Sep 2027
2binancee.infoNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
3binancee.netIHS Telekom, Inc.27 Nov 20237 Jan 202527 Nov 2024
4binancee.onlineUpperlink Limited9 Jul 202414 Jul 20249 Jul 2025
5binancee.xyzGMO Internet Inc.23 Dec 202428 Dec 202423 Dec 2025
6binancee.siteHosting Ukraine LLC10 May 20249 Oct 202410 May 2025
7binancee.exchangeDynadot, LLC28 Feb 202122 Mar 202128 Feb 2022
8binancee.clubNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
9binancee.proName.com, Inc.30 Oct 202430 Oct 202430 Oct 2025
10binancee.lifeNamesilo, LLC20 Jun 202220 Jun 202320 Jun 2024
11binancee.co.ukDynadot, LLC12 Jun 202112 Jun 202312 Jun 2023
12binancee.usDynadot, LLC16 Jun 201920 Sep 202416 Jun 2025
13binancee.net.inGoDaddy.com, LLC19 Mar 202230 Apr 202319 Mar 2023
14binancee.co.inGoDaddy.com, LLC1 Mar 202212 Apr 20231 Mar 2023
15binancee.orgGoogle, Inc.9 Jan 202430 Dec 20249 Jan 2026
16binancee.funNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
17binancee.cloudNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
18binancee.todayNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
19binancee.liveNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
20binancee.storeNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
21binancee.bizNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
22binancee.workNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
23binancee.buzzNamesilo, LLC18 Jan 202319 Feb 202418 Jan 2024
24binancee.worldGoDaddy.com, LLC21 Jan 20232 Apr 202421 Jan 2024
25binancee.networkNamesilo, LLC2 Feb 20232 Feb 20232 Feb 2024
26binancee.winNamesilo, LLC2 Feb 20234 Mar 20242 Feb 2024
27binancee.tradeNamesilo, LLC2 Feb 20232 Feb 20232 Feb 2024
28binancee.bestNamesilo, LLC2 Feb 20233 Apr 20242 Feb 2024
29binancee.bidNamesilo, LLC2 Feb 20232 Feb 20232 Feb 2024
30binancee.spaceNamesilo, LLC2 Feb 20232 Feb 20232 Feb 2024
31binancee.artNamesilo, LLC2 Feb 20232 Feb 20232 Feb 2024
32binancee.wsNamesilo, LLC2 Feb 20232 Feb 20232 Feb 2024
33binancee.digitalHostinger, UAB24 Mar 202424 Mar 202524 Mar 2026
34binancee.linkNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
35binancee.cyouChengdu West Dimension Digital Technology Co., Ltd…25 Feb 202326 Apr 202425 Feb 2024
36binancee.inGoDaddy.com, LLC4 Mar 202215 Apr 20234 Mar 2023
37binancee.org.inGoDaddy.com, LLC16 Mar 202227 Apr 202316 Mar 2023
38binancee.cityNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
39binancee.cfdNamesilo, LLC5 Apr 20236 Apr 20245 Apr 2025
40binancee.boutiqueNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
41binancee.dateNamesilo, LLC5 Apr 20239 May 20245 Apr 2024
42binancee.boatsNamesilo, LLC5 Apr 20236 Apr 20245 Apr 2025
43binancee.bondNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
44binancee.beautyNamesilo, LLC5 Apr 20236 Apr 20245 Apr 2025
45binancee.autosNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
46binancee.downloadNamesilo, LLC5 Apr 20239 May 20245 Apr 2024
47binancee.agencyNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
48binancee.clickNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
49binancee.directoryNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
50binancee.blogNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
51binancee.gayNamesilo, LLC5 Apr 20239 May 20245 Apr 2024
52binancee.golfNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
53binancee.hairNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
54binancee.guruNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
55binancee.homesNamesilo, LLC5 Apr 20236 Apr 20245 Apr 2025
56binancee.inkNamesilo, LLC5 Apr 20239 May 20245 Apr 2024
57binancee.icuNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
58binancee.momNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
59binancee.makeupNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
60binancee.picsNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
61binancee.restNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
62binancee.tattooNamesilo, LLC5 Apr 202310 Apr 20235 Apr 2024
63binancee.questNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
64binancee.monsterNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
65binancee.mediaNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
66binancee.runNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
67binancee.sbsNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
68binancee.wtfNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
69binancee.lolNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
70binancee.yachtsNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
71binancee.wikiNamesilo, LLC5 Apr 20239 May 20245 Apr 2024
72binancee.skinNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
73binancee.teamNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
74binancee.motorcyclesNamesilo, LLC5 Apr 20238 Jun 20245 Apr 2024
75binancee.pl-3 Dec 20223 Dec 2022-
76binancee.techHostinger, UAB24 Jul 202329 Sep 202424 Jul 2024
77binancee.topNamesilo, LLC12 Oct 202315 Nov 202412 Oct 2024
78binancee.appGoogle, Inc.23 Oct 202313 Oct 202423 Oct 2025
79binancee.oneOne.com A/S8 Dec 202312 Dec 20248 Dec 2025
80binancee.ru-17 Aug 2023-17 Aug 2025
81binancee.coNameKing.com Inc.26 Jul 20249 Oct 202426 Jul 2025
82binancee.biz.id-15 Sep 2024-15 Sep 2025
83binancee.de--11 Dec 2024-
84binancee.vipGoDaddy.com, LLC10 Feb 202510 Feb 202510 Feb 2026
85binanceexchange.comDropCatch.com 733 LLC18 Jul 202121 Feb 202318 Jul 2025
86binanceexchange.netHostinger, UAB21 Aug 202421 Oct 202421 Aug 2025
87binanceevent.comNameKing.com Inc.17 Apr 201919 Mar 202417 Apr 2025
88binanceex.comGoDaddy.com, LLC13 Jul 201927 Jun 202413 Jul 2025
89binanceeuro.comHostinger, UAB11 Oct 202411 Dec 202411 Oct 2025
90binanceeco.comInfomaniak Network SA6 May 202119 Jul 20236 May 2023
91binanceedu.comBeijing Lanhai Jiye Technology Co., Ltd20 Feb 202023 Apr 202420 Feb 2024
92binanceexplained.comNameCheap, Inc.21 Apr 201821 Apr 201821 Apr 2019
93binanceeos.comHiChina Zhicheng Technology Limited24 Apr 201824 Apr 201824 Apr 2020
94binanceexchange.infoNamesilo, LLC23 Jul 202428 Jul 202423 Jul 2025
95binanceeurope.comPorkbun, LLC24 Feb 202524 Feb 202524 Feb 2026
96binanceetf.comChengdu West Dimension Digital Technology Co., Ltd…23 Oct 201923 Oct 201923 Oct 2025
97binanceexchangetheworld.comGoDaddy.com, LLC8 Aug 20188 Aug 20188 Aug 2019
98binanceexchangewebsite.reviewNameCheap, Inc.8 Aug 20189 Aug 20188 Aug 2019
99binanceexchange.reviewNameCheap, Inc.8 Aug 20189 Aug 20188 Aug 2019
100binanceecosystem.comGoDaddy.com, LLC25 Jul 20205 Sep 202425 Jul 2024
101binanceethereum.comNamesilo, LLC27 Sep 20221 Dec 202327 Sep 2023
102binanceether.netRegional Network Information Center, JSC dba RU-CE…6 Sep 2018-5 Sep 2019
103binanceeth.netWix.com Ltd.29 May 202329 May 202329 May 2024
104binanceethevent.netRegional Network Information Center, JSC dba RU-CE…10 Sep 2018-9 Sep 2019
105binanceether.clubRegional Network Information Center, JSC dba RU-CE…12 Sep 201812 Sep 201812 Sep 2019
106binanceethereum.clubRegional Network Information Center, JSC dba RU-CE…12 Sep 201812 Sep 201812 Sep 2019
107binanceeth.clubRegional Network Information Center, JSC dba RU-CE…12 Sep 201812 Sep 201812 Sep 2019
108binanceethcompetition.comNameCheap, Inc.12 Sep 201812 Sep 201812 Sep 2019
109binanceethevent.clubRegional Network Information Center, JSC dba RU-CE…13 Sep 201813 Sep 201813 Sep 2019
110binanceethereumairdroppevent.infoEranet International Limited17 Sep 201817 Sep 201817 Sep 2019
111binanceethairdropp.infoEranet International Limited17 Sep 201817 Sep 201817 Sep 2019
112binanceetherairdropp.infoEranet International Limited17 Sep 201817 Sep 201817 Sep 2019
113binanceethairdroppevent.infoEranet International Limited17 Sep 201817 Sep 201817 Sep 2019
114binanceethergiveaway.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 201819 Sep 201819 Sep 2019
115binanceevent.clubRegional Network Information Center, JSC dba RU-CE…24 Sep 201824 Sep 201824 Sep 2019
116binanceevent.netRegional Network Information Center, JSC dba RU-CE…24 Sep 2018-23 Sep 2019
117binanceevents.comGoDaddy.com, LLC19 May 202419 May 202419 May 2025
118binanceeu.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…23 Dec 20187 Dec 202423 Dec 2025
119binancees.comNameKing.com Inc.1 Mar 202228 Feb 20251 Mar 2026
120binanceer.comHosting Concepts B.V. dba Openprovider12 Mar 202112 Mar 202112 Mar 2022
121binanceextend.comGoDaddy.com, LLC20 Feb 201913 Feb 202520 Feb 2026
122binanceexpress.comGoDaddy.com, LLC20 Feb 201913 Feb 202520 Feb 2026
123binanceexplorer.comNamesilo, LLC12 Jan 202418 Feb 202512 Jan 2025
124binanceextend.netGoDaddy.com, LLC20 Feb 201913 Feb 202520 Feb 2026
125binanceexpress.netGoDaddy.com, LLC20 Feb 201913 Feb 202520 Feb 2026
126binanceexpert.comGoDaddy.com, LLC3 Feb 202431 Jan 20253 Feb 2026
127binanceelite.comWild West Domains, LLC9 Sep 202321 Nov 20249 Sep 2024
128binanceelite.netShanghai Meicheng Technology Information Co., Ltd30 Aug 201930 Aug 201930 Aug 2022
129binanceearn.comRealtime Register B.V.25 Sep 202425 Sep 202425 Sep 2025
130binanceequity.comCloud Yuqu LLC6 Dec 20196 Dec 20196 Dec 2025
131binanceen.comGMO Internet Inc.19 Nov 202419 Nov 202419 Nov 2025
132binanceexchangelogin.comJiangsu Bangning Science and technology Co. Ltd.28 Mar 202028 Mar 202028 Mar 2021
133binanceether.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 202015 Aug 202015 Aug 2021
134binanceezh.comDynadot, LLC14 Dec 202123 Jan 202414 Dec 2023
135binanceexpress.infoGoDaddy.com, LLC20 Feb 201918 Feb 202520 Feb 2026
136binanceextend.infoGoDaddy.com, LLC20 Feb 201918 Feb 202520 Feb 2026
137binanceevent.infoLimited Liability Company "Registrar of domain nam…12 Dec 201910 Feb 202012 Dec 2020
138binanceeth.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…26 Apr 202326 Apr 202326 Apr 2025
139binanceezh.netDynadot, LLC22 Oct 202022 Oct 202022 Oct 2021
140binanceezh.proDynadot, LLC12 Nov 202012 Nov 202012 Nov 2021
141binanceenterprise.comGoDaddy.com, LLC3 Dec 20203 Dec 20203 Dec 2021
142binanceedutrade.comGoDaddy.com, LLC8 Dec 202018 Feb 20248 Dec 2023
143binanceevent.siteNics Telekomünikasyon Ticaret Ltd. Şti.20 Oct 202230 Nov 202320 Oct 2023
144binanceen.xyzHostinger, UAB20 Dec 202020 Dec 202020 Dec 2021
145binanceepower.comHosting Concepts B.V. dba Openprovider10 Feb 202110 Feb 202110 Feb 2022
146binanceestate.comOVH sas27 Feb 202127 Feb 202127 Feb 2022
147binanceecosystemrewards.comHosting Concepts B.V. dba Openprovider9 Mar 20219 Mar 20219 Mar 2022
148binanceexchange.icuNamesilo, LLC24 Oct 202424 Oct 202424 Oct 2025
149binanceeed.xyzHostinger, UAB6 Apr 20216 Apr 20216 Apr 2022
150binanceeplus.com1API GmbH16 May 202116 May 202116 May 2022
151binanceethiopia.comGoogle, Inc.21 Jun 20216 Jun 202421 Jun 2025
152binanceejr.comGoDaddy.com, LLC24 Oct 20225 Jan 202424 Oct 2023
153binanceexchange.usNameCheap, Inc.27 Jan 202027 Jan 202427 Jan 2024
154binanceencryption.comGoDaddy.com, LLC12 Dec 202223 Jan 202412 Dec 2023
155binanceelitemarket.comNameCheap, Inc.23 Aug 2021-23 Aug 2022
156binanceet.comUniregistrar Corp27 Aug 202127 Aug 202127 Aug 2022
157binanceeokv.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
158binanceeozb.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
159binanceepne.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
160binanceeqkn.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
161binanceeqxk.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
162binanceeqzz.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
163binanceeraf.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
164binanceeren.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
165binanceerhf.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
166binanceerig.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
167binanceerzq.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
168binanceesjj.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
169binanceesmn.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
170binanceeszq.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
171binanceeuwh.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
172binanceevpg.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
173binanceewkr.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
174binanceewla.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
175binanceewvr.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
176binanceexuc.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
177binanceezee.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
178binanceezof.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
179binanceedue.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
180binanceedzl.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
181binanceeetv.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
182binanceehat.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
183binanceehgo.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
184binanceehku.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
185binanceeimu.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
186binanceeinl.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
187binanceeiwc.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
188binanceejyf.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
189binanceelms.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
190binanceemag.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
191binanceemnw.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
192binanceemsb.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
193binanceenou.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
194binanceensi.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
195binanceepbn.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
196binanceerpf.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
197binanceeajr.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
198binanceeami.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
199binanceeaym.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
200binanceeayv.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
201binanceebgd.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
202binanceebky.xyzGMO Internet Inc.28 Sep 20218 Oct 202128 Sep 2022
203binanceeblt.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
204binanceebot.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
205binanceebpm.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
206binanceebuv.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
207binanceecol.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
208binanceecom.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
209binanceecqf.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
210binanceeeai.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
211binanceeowo.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
212binanceepbd.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
213binanceepkk.xyzGMO Internet Inc.28 Sep 20218 Oct 202128 Sep 2022
214binanceeriu.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
215binanceetep.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
216binanceetnp.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
217binanceecqi.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
218binanceeees.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
219binanceeetf.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
220binanceeggw.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
221binanceeito.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
222binanceejjq.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
223binanceejxe.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
224binanceekrh.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
225binanceekuy.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
226binanceelow.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
227binanceeltt.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
228binanceemdw.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
229binanceemhi.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
230binanceemjb.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
231binanceemyg.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
232binanceenob.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
233binanceense.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
234binanceenxo.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
235binanceebyn.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
236binanceeceh.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
237binanceejna.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
238binanceeank.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
239binanceeiwv.xyzGMO Internet Inc.28 Sep 202129 Sep 202128 Sep 2022
240binanceethegiveaway.comFastDomain Inc.20 Dec 202121 Dec 202120 Dec 2022
241binanceextra.comNameCheap, Inc.3 Jan 202214 Feb 20233 Jan 2023
242binanceew.com-1 Aug 20241 Aug 20241 Aug 2025
243binanceecuador.comCloudFlare, Inc.10 Mar 202219 Apr 202310 Mar 2023
244binanceerfahrung.comCloudFlare, Inc.10 Mar 202219 Apr 202310 Mar 2023
245binanceerfahrungen.comCloudFlare, Inc.10 Mar 202219 Apr 202310 Mar 2023
246binanceentrar.comCloudFlare, Inc.10 Mar 202219 Apr 202310 Mar 2023
247binanceedufi.comDynadot, LLC25 Mar 20224 Jun 202325 Mar 2023
248binanceeesti.comCloudFlare, Inc.27 Mar 20226 May 202327 Mar 2023
249binanceeth.oneGoogle, Inc.1 Apr 202222 Apr 20221 Apr 2023
250binanceelsalvador.comCloudFlare, Inc.3 Apr 202213 May 20233 Apr 2023
251binanceegypt.comCloudFlare, Inc.3 Apr 202212 Jun 20233 Apr 2023
252binanceex.netAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Apr 202210 May 20232 Apr 2023
253binanceevents.onlineGoDaddy.com, LLC5 Apr 202217 May 20235 Apr 2023
254binanceex.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Apr 202210 Jun 20232 Apr 2023
255binanceev.comGoDaddy.com, LLC8 Apr 202219 May 20248 Apr 2024
256binanceegldfuture.coNameKing.com Inc.11 Apr 202216 Apr 202311 Apr 2023
257binanceetr.comGoogle, Inc.22 Apr 202218 Jun 202422 Apr 2024
258binanceeth.infoPorkbun, LLC5 May 202215 Jul 20235 May 2023
259binanceearn.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…16 May 20222 Sep 202216 May 2024
260binanceexplorertrade.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…27 May 20226 Aug 202327 May 2023
261binanceescrow.comDNSPod, Inc.30 May 202230 Jun 202330 May 2023
262binanceec.comeName Technology Co., Ltd.26 Aug 202330 Sep 202426 Aug 2024
263binanceens.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Jun 20228 Jun 20237 Jun 2023
264binanceeconomy.comPorkbun, LLC8 Jun 202220 Aug 20248 Jun 2024
265binanceexchange.onlineHostinger, UAB5 Mar 20255 Mar 20255 Mar 2026
266binanceexpo.comTucows Domains Inc.2 Jul 20223 Jun 20242 Jul 2025
267binanceexchangetrades.comTucows Domains Inc.7 Jul 202217 Sep 20237 Jul 2023
268binanceearn.orgHostinger, UAB3 Jan 202318 Mar 20253 Jan 2025
269binanceex.com.cn-2 Apr 2022-2 Apr 2024
270binanceen.netHostinger, UAB18 Aug 202228 Oct 202318 Aug 2023
271binanceearners.com-29 Aug 20224 Nov 202329 Aug 2023
272binanceedge.xyzGoDaddy.com, LLC17 Sep 202229 Oct 202317 Sep 2023
273binanceeth2.comDynadot, LLC28 Sep 20228 Dec 202328 Sep 2023
274binanceebonus.com1&1 Internet AG9 Oct 202221 Dec 20239 Oct 2023
275binanceeventtakip.netGoogle, Inc.14 Oct 202215 Oct 202314 Oct 2024
276binanceeventtakipleri.netGoogle, Inc.16 Oct 202217 Oct 202316 Oct 2024
277binanceeventleritakip.netGoogle, Inc.18 Oct 202219 Oct 202318 Oct 2024
278binanceevents.siteNics Telekomünikasyon Ticaret Ltd. Şti.20 Oct 202230 Nov 202320 Oct 2023
279binanceevents.orgDynadot, LLC9 Nov 202218 Jan 20249 Nov 2023
280binanceexchange.inGoDaddy.com, LLC18 Nov 202230 Dec 202418 Nov 2024
281binanceec.topNamesilo, LLC19 Nov 202222 Dec 202319 Nov 2023
282binanceexhange.comNameCheap, Inc.18 Nov 202230 Dec 202318 Nov 2023
283binanceexpressearning247.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Nov 202231 Jan 202419 Nov 2023
284binanceearn.live-30 Oct 202415 Jan 202530 Oct 2025
285binanceeurope.ioHostinger, UAB3 Aug 20229 Oct 20233 Aug 2023
286binanceearnings.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Dec 202221 Feb 202410 Dec 2023
287binanceearnpro.onlinePDR Ltd. d/b/a PublicDomainRegistry.com4 Jan 202311 Mar 20244 Jan 2024
288binanceeventsandcampaigns.netGoogle, Inc.27 Jan 202326 Feb 202427 Jan 2024
289binanceeventsandcampaignscheck.netGoogle, Inc.28 Jan 202329 Mar 202428 Jan 2024
290binanceeventscampaignschecksnewyears.netGoogle, Inc.28 Jan 202329 Mar 202428 Jan 2024
291binanceeventscampaignschecksnewyearsfind.netGoogle, Inc.29 Jan 202330 Mar 202429 Jan 2024
292binanceeventsandnewcampaignsactivitycheck.netGoogle, Inc.30 Jan 202331 Mar 202430 Jan 2024
293binanceeventsnewyearcampaignschecknow.netGoogle, Inc.30 Jan 202331 Mar 202430 Jan 2024
294binanceeventsandnewcampaignschecker.netGoogle, Inc.30 Jan 202331 Mar 202430 Jan 2024
295binanceetkinliksorgulariyeniyilyenietkinlikler.netGoogle, Inc.1 Feb 20232 Apr 20241 Feb 2024
296binanceeventsandcampaignnewyearsnewcampaigns.netGoogle, Inc.1 Feb 20232 Apr 20241 Feb 2024
297binanceeventscampaignschecknewyearsnewcamp.netGoogle, Inc.4 Feb 20235 Mar 20244 Feb 2024
298binanceeventvekampanyalarimizdanhaberdaroldunuzmu.netGoogle, Inc.8 Feb 20239 Apr 20248 Feb 2024
299binanceeventvekampanyalarimizdanhaberinizvarmi.netGoogle, Inc.8 Feb 20239 Apr 20248 Feb 2024
300binanceeventveetkinliklerisorgulamasayfamiz.netGoogle, Inc.10 Feb 202311 Mar 202410 Feb 2024
301binanceeventlerimizvekampanyalarimizisorgula.netGoogle, Inc.10 Feb 202311 Mar 202410 Feb 2024
302binanceeventlerimizvekampanyalarimizabasvurulariniyapin.netGoogle, Inc.11 Feb 202312 Mar 202411 Feb 2024
303binanceetkinlikvekampanyalarinisorgulamasayfamiz.netGoogle, Inc.10 Feb 202311 Mar 202410 Feb 2024
304binanceexc.comWeb Commerce Communications Limited dba WebNic.cc10 Feb 202310 Feb 202310 Feb 2024
305binanceeventlerimizdenvekapanyalarimizdenhaberdar.netGoogle, Inc.11 Feb 202312 Mar 202411 Feb 2024
306binanceeventlerinisorgulamavekampanyalarakatilma.netGoogle, Inc.10 Feb 202311 Mar 202410 Feb 2024
307binanceetkinlikkampanyalarsorgulamagirissayfasi.netGoogle, Inc.12 Feb 202313 Mar 202412 Feb 2024
308binanceeventvekampanyalarigirissayfasisorgulama.netGoogle, Inc.12 Feb 202313 Mar 202412 Feb 2024
309binanceeventvekampanyalarimizabasvurunuzuyapin.netGoogle, Inc.11 Feb 202312 Mar 202411 Feb 2024
310binanceetkinliklerivekampanyalarigirissayfasikontrol.netGoogle, Inc.11 Feb 202313 Mar 202411 Feb 2024
311binanceeventlerimveetkinliklerimsayfasisorgulama.netGoogle, Inc.13 Feb 202314 Mar 202413 Feb 2024
312binanceeventlerimizvekampanyalarimizburadansorgu.netGoogle, Inc.13 Feb 202314 Mar 202413 Feb 2024
313binanceeventveetkinliklerinegirissayfamizbasvuru.netGoogle, Inc.13 Feb 202314 Mar 202413 Feb 2024
314binanceeventetkinliksorgulamasayfalarimizdan.netGoogle, Inc.14 Feb 202316 Mar 202414 Feb 2024
315binanceetkinliklerimizvekampanyalarimizisorgulayin.netGoogle, Inc.15 Feb 202316 Mar 202415 Feb 2024
316binanceeventveetkinliklerimizduyurularimizburada.netGoogle, Inc.16 Feb 202318 Mar 202416 Feb 2024
317binanceetkinliksorgulamalarivekatilimlar.netGoogle, Inc.17 Feb 202318 Mar 202417 Feb 2024
318binanceetkinlikvekampanyalarisorgulayinvebasvurunuzuyapin.netGoogle, Inc.18 Feb 202319 Mar 202418 Feb 2024
319binanceetkinlikvekampanyalarisorgulayinvebasvurunuzuyapiniz.netGoogle, Inc.18 Feb 202319 Mar 202418 Feb 2024
320binanceeventlerimizvekampanyalarimizisorgulayin.netGoogle, Inc.18 Feb 202319 Mar 202418 Feb 2024
321binanceeventsandactivitycheckandapplynownewevent.netGoogle, Inc.17 Feb 202318 Mar 202417 Feb 2024
322binanceeventetkinlikveduyurularimiziyeniyildesorgula.netGoogle, Inc.19 Feb 202320 Mar 202419 Feb 2024
323binanceeventveduyurularigoruntulemevekayitsayfasi.netGoogle, Inc.19 Feb 202320 Mar 202419 Feb 2024
324binanceeventleriniveetkinliklerinisorgulayarakkatil.netGoogle, Inc.18 Feb 202319 Mar 202418 Feb 2024
325binanceetkinliksorgulamalarivekayitsayfalarimiz.netGoogle, Inc.20 Feb 202321 Mar 202420 Feb 2024
326binanceeventlerimizvekampanyalarimiziduyurularimizisorgula.netGoogle, Inc.19 Feb 202320 Mar 202419 Feb 2024
327binanceeventlerivekampanyalarimizisorgulayinvekayityaptir.netGoogle, Inc.19 Feb 202320 Mar 202419 Feb 2024
328binanceetkinliklerinivekampanyalariniiteksayfadasorgula.netGoogle, Inc.21 Feb 202322 Apr 202421 Feb 2024
329binanceeventlerivekampanyalarininduyurularinisorgula.netGoogle, Inc.21 Feb 202322 Apr 202421 Feb 2024
330binanceeventlerimizivekampanyalarimizisorgulagirisyap.netGoogle, Inc.22 Feb 202323 Apr 202422 Feb 2024
331binanceegiveaway.onlinePDR Ltd. d/b/a PublicDomainRegistry.com22 Feb 202330 Mar 202422 Feb 2024
332binanceeventlerimizisorgulayinvekatiliminizibiranonceyapin.netGoogle, Inc.23 Feb 202324 Apr 202423 Feb 2024
333binancee-login.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 20239 May 202426 Feb 2024
334binanceetkinliklerinekatilimsaglamakvesizdekazanmakicin.netGoogle, Inc.27 Feb 202328 Apr 202427 Feb 2024
335binanceetkinliklerimizivekampanyalarimizisorguyeni.netGoogle, Inc.27 Feb 202328 Apr 202427 Feb 2024
336binanceed.comBeijing Lanhai Jiye Technology Co., Ltd26 Feb 202329 Mar 202426 Feb 2024
337binanceetkinlikeventsorgulamasayfalariniziyaretet.netGoogle, Inc.27 Feb 202328 Apr 202427 Feb 2024
338binanceee.infoHostinger, UAB1 Mar 20237 May 20241 Mar 2024
339binanceec.xyzNamesilo, LLC5 Mar 20238 May 20245 Mar 2024
340binanceec.lifeNamesilo, LLC5 Mar 20237 May 20245 Mar 2024
341binanceexchangelawsuit.comGoDaddy.com, LLC13 Jan 201824 Jan 202413 Jan 2025
342binanceer.topNamesilo, LLC19 Mar 202325 Apr 202419 Mar 2024
343binanceeg.comGoDaddy.com, LLC22 Apr 202111 Apr 202422 Apr 2025
344binanceenergy.comNameKing.com Inc.7 Jul 202120 Aug 20237 Jul 2023
345binanceetkinlikyenitr.netGoogle, Inc.11 Apr 202311 May 202411 Apr 2024
346binanceee.comGoDaddy.com, LLC17 Nov 202417 Nov 202417 Nov 2025
347binanceengland.comGoDaddy.com, LLC29 May 202210 Aug 202329 May 2023
348binanceexperts.comHostinger, UAB16 Apr 202326 Jun 202416 Apr 2024
349binanceexchange.liveGoDaddy.com, LLC22 Apr 202422 Apr 202422 Apr 2025
350binanceear.liveDynadot, LLC11 Jun 202220 Aug 202311 Jun 2023
351binanceextend.orgGoDaddy.com, LLC20 Feb 201918 Feb 202520 Feb 2026
352binanceexpress.orgGoDaddy.com, LLC20 Feb 201918 Feb 202520 Feb 2026
353binanceexchange.topChengdu West Dimension Digital Technology Co., Ltd…20 Mar 202421 Mar 202520 Mar 2026
354binanceeuropeltd.comCosmotown, Inc.10 May 202320 Jul 202410 May 2024
355binanceexchange.cn????????????27 May 2023-27 May 2025
356binanceemail.clickMat Bao Trading & Service Company Limited d/b/a Ma…29 Jun 20238 Aug 202429 Jun 2024
357binanceexchange.supportPDR Ltd. d/b/a PublicDomainRegistry.com11 Jul 202321 Aug 202411 Jul 2024
358binanceexchange.nl-3 Sep 20227 Jun 2024-
359binanceearnpk.comAtak Domain Hosting Internet d/b/a Atak Teknoloji7 Aug 202327 Sep 20247 Aug 2024
360binanceearnpk.xyzAtak Domain Hosting Internet d/b/a Atak Teknoloji7 Aug 20232 Sep 20247 Aug 2024
361binanceexchange.techHostinger, UAB19 Dec 202424 Dec 202419 Dec 2025
362binanceevents.infoGoDaddy.com, LLC9 Aug 202320 Sep 20249 Aug 2024
363binanceexploit.comWeb Commerce Communications Limited dba WebNic.cc17 Aug 202317 Aug 202317 Aug 2024
364binanceeo.comeName Technology Co., Ltd.2 Sep 202322 Sep 20242 Sep 2025
365binanceep.comeName Technology Co., Ltd.7 Sep 202311 Oct 20247 Sep 2024
366binanceet.sbsBeijing Lanhai Jiye Technology Co., Ltd22 Sep 202324 Oct 202422 Sep 2024
367binanceev.sbsBeijing Lanhai Jiye Technology Co., Ltd22 Sep 202324 Oct 202422 Sep 2024
368binanceef.sbsBeijing Lanhai Jiye Technology Co., Ltd22 Sep 202324 Oct 202422 Sep 2024
369binanceexchanger.comP.A. Viet Nam Company Limited4 Oct 202319 Nov 20234 Oct 2024
370binanceeth.buzzNamesilo, LLC10 Nov 202314 Dec 202410 Nov 2024
371binanceeth.icuNamesilo, LLC10 Nov 202314 Dec 202410 Nov 2024
372binanceeth.lifeNamesilo, LLC10 Nov 202314 Dec 202410 Nov 2024
373binanceeth.xyzNamesilo, LLC10 Nov 202314 Dec 202410 Nov 2024
374binanceeth.liveNamesilo, LLC10 Nov 202314 Dec 202410 Nov 2024
375binanceescrowservices.comHostinger, UAB18 Nov 202331 Jan 202518 Nov 2024
376binanceerc.siteHostinger, UAB21 Nov 20233 Feb 202521 Nov 2024
377binanceepro.comP.A. Viet Nam Company Limited20 Nov 202320 Nov 202320 Nov 2024
378binanceexch.comGoDaddy.com, LLC16 Dec 202327 Jan 202516 Dec 2024
379binancee99.comBeijing Lanhai Jiye Technology Co., Ltd28 Dec 202329 Jan 202528 Dec 2024
380binanceesurance.comGoDaddy.com, LLC27 Dec 202328 Dec 202427 Dec 2025
381binanceeu.vipBeijing Lanhai Jiye Technology Co., Ltd3 Jan 20243 Jan 20253 Jan 2025
382binanceexchange.co.inHostinger, UAB12 Jan 202412 Jan 202512 Jan 2025
383binanceetp.comPorkbun, LLC15 Mar 202416 Mar 202515 Mar 2026
384binanceex.shopGoDaddy.com, LLC23 Mar 202427 May 202423 Mar 2025
385binanceeth.topNamesilo, LLC10 Nov 202314 Dec 202410 Nov 2024
386binanceevm.netInternet Domain Services BS Corp21 Apr 202421 Apr 202421 Apr 2025
387binanceevm.comInternet Domain Services BS Corp21 Apr 202421 Apr 202421 Apr 2025
388binancee-global.infoNameKing.com Inc.24 Apr 202425 Jul 202424 Apr 2025
389binancee-global.appNameKing.com Inc.24 Apr 202425 Jul 202424 Apr 2025
390binancee-global.clickNameKing.com Inc.24 Apr 202425 Jul 202424 Apr 2025
391binancee-global.orgNameKing.com Inc.24 Apr 202425 Jul 202424 Apr 2025
392binancee-u-s.infoNameKing.com Inc.26 Apr 202426 Apr 202426 Apr 2025
393binancee-u-s.bestNameKing.com Inc.26 Apr 202426 Apr 202426 Apr 2025
394binancee-u-s.shopNameKing.com Inc.26 Apr 202426 Apr 202426 Apr 2025
395binancee-u-s.clickNameKing.com Inc.26 Apr 202426 Apr 202426 Apr 2025
396binancee-airdropd.comWild West Domains, LLC13 May 202416 May 202413 May 2025
397binanceegy.comGoDaddy.com, LLC19 May 20243 Jan 202519 May 2025
398binanceezh.topDynadot, LLC4 Jun 202410 Nov 20244 Jun 2025
399binanceexchanges.comNamesilo, LLC6 Jun 20246 Jun 20246 Jun 2025
400binanceevn.comCosmotown, Inc.14 Jun 202424 Aug 202414 Jun 2025
401binanceexchange.emailNameCheap, Inc.9 Jul 202414 Jul 20249 Jul 2025
402binanceeth.ccNamesilo, LLC10 Nov 202314 Jan 202510 Nov 2024
403binanceelf.comWeb Commerce Communications Limited dba WebNic.cc11 Aug 202411 Aug 202411 Aug 2025
404binanceett.onlineHostinger, UAB3 Oct 20248 Oct 20243 Oct 2025
405binanceescrowsecurity.onlineDynadot, LLC27 Dec 20243 Feb 202527 Dec 2025
406binanceemail.comGoDaddy.com, LLC4 Jan 20254 Jan 20254 Jan 2026
407binanceevent.liveHostinger, UAB21 Jan 202526 Jan 202521 Jan 2026
408binanceef.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED4 Feb 20254 Feb 20254 Feb 2026
409binanceeuropean.comNamesilo, LLC6 Feb 20256 Feb 20256 Feb 2026
410binanceereward.onlineHostinger, UAB10 Mar 202510 Mar 202510 Mar 2026
411binancee-tr.comNICENIC INTERNATIONAL GROUP CO., LIMITED4 Apr 20254 Apr 20254 Apr 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=binancee

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now