With support for 
Keyword: CHP
Reverse Whois » KEYWORD [chp ] { 11,830 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | chp.org.tr | - | 1 May 1996 | - | 30 Apr 2020 |
| 2 | chp.edu | - | 30 Jan 1992 | 10 Jun 2016 | 31 Jul 2018 |
| 3 | chp.cl | - | 7 Apr 2000 | - | 2 May 2029 |
| 4 | chp.co.uk | - | 21 Aug 1996 | 18 Jul 2024 | 21 Aug 2025 |
| 5 | chp.com.ua | - | 8 Oct 2003 | 4 Oct 2016 | 8 Oct 2017 |
| 6 | chp.gov.hk | HooYoo Information Technology Company Ltd. | 2 Feb 2004 | - | 28 Feb 2018 |
| 7 | chp.org.cn | ???????????? | 7 Jun 2000 | - | 7 Jun 2026 |
| 8 | chp.co.jp | - | 11 Jun 1998 | 1 Jul 2024 | - |
| 9 | chp.com | eNom, Inc. | 1 May 1995 | 1 May 2024 | 2 May 2025 |
| 10 | chp.ca | - | 19 Nov 2000 | 1 Jun 2024 | 17 Apr 2025 |
| 11 | chp.academy | GoDaddy.com, LLC | 13 Aug 2022 | 13 Aug 2022 | 13 Aug 2023 |
| 12 | chp.careers | - | 7 Jul 2014 | 7 Jul 2014 | 7 Jul 2015 |
| 13 | chp.solar | GoDaddy.com, LLC | 23 Jul 2014 | 6 Jan 2017 | 23 Jul 2017 |
| 14 | chp.career | GTLDPREMIUM | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2024 |
| 15 | chp.xyz | GoDaddy.com, LLC | 6 Sep 2014 | 9 Dec 2016 | 6 Sep 2017 |
| 16 | chp.blackfriday | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 17 | chp.church | GoDaddy.com, LLC | 22 Sep 2014 | 23 Sep 2024 | 22 Sep 2025 |
| 18 | chp.christmas | Uniregistrar Corp | 30 Sep 2014 | 1 Oct 2014 | 30 Sep 2015 |
| 19 | chp.today | Limited Liability Company "Registrar of domain nam… | 1 May 2024 | 6 May 2024 | 1 May 2025 |
| 20 | chp.media | GoDaddy.com, LLC | 17 Apr 2018 | 22 Apr 2018 | 17 Apr 2019 |
| 21 | chp.kim | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Feb 2021 | 20 Feb 2024 | 16 Feb 2025 |
| 22 | chp.nyc | eNom, Inc. | 21 Dec 2017 | 25 Dec 2023 | 21 Dec 2024 |
| 23 | chp.engineering | Mesh Digital Limited | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2016 |
| 24 | chp.exchange | GoDaddy.com, LLC | 22 Nov 2014 | 29 Sep 2017 | 22 Nov 2019 |
| 25 | chp.click | 1API GmbH | 4 Dec 2014 | 7 Jun 2024 | 4 Dec 2024 |
| 26 | chp.moscow | Limited Liability Company "Registrar of domain nam… | 25 Jan 2023 | 25 Jan 2024 | 25 Jan 2024 |
| 27 | chp.diet | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 28 | chp.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 29 | chp.hosting | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 30 | chp.recipes | GoDaddy.com, LLC | 12 Feb 2015 | 7 Jul 2024 | 12 Feb 2025 |
| 31 | chp.red | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 21 Jan 2019 | 22 Jan 2019 | 21 Jan 2020 |
| 32 | chp.wales | 1&1 Internet AG | 1 Mar 2015 | 1 Mar 2017 | 1 Mar 2018 |
| 33 | chp.social | GoDaddy.com, LLC | 16 Mar 2023 | 27 Apr 2024 | 16 Mar 2024 |
| 34 | chp.website | GoDaddy.com, LLC | 14 Aug 2017 | 14 Aug 2017 | 14 Aug 2018 |
| 35 | chp.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 36 | chp.party | NameCheap, Inc. | 3 Mar 2018 | 3 Mar 2018 | 3 Mar 2019 |
| 37 | chp.design | Wild West Domains, LLC | 13 May 2015 | 6 Jun 2024 | 13 May 2025 |
| 38 | chp.webcam | Alpnames Limited | 21 May 2015 | - | 20 May 2016 |
| 39 | chp.one | 1&1 Internet AG | 20 May 2015 | 4 Jul 2024 | 20 May 2025 |
| 40 | chp.pub | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Jun 2015 | 11 Jun 2017 | 9 Jun 2018 |
| 41 | chp.help | Uniregistrar Corp | 11 Jul 2015 | 11 Jul 2015 | 11 Jul 2016 |
| 42 | chp.site | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Aug 2016 | 29 Jun 2017 | 31 Aug 2017 |
| 43 | chp.services | Gandi SAS | 28 Jul 2015 | 29 Jun 2024 | 28 Jul 2025 |
| 44 | chp.email | 1&1 Internet AG | 6 May 2015 | 20 Jun 2024 | 6 May 2025 |
| 45 | chp.online | ChinaNet Technology (SuZhou) CO., LTD | 13 Nov 2017 | - | 13 Nov 2018 |
| 46 | chp.biz | HiChina Zhicheng Technology Limited | 22 Sep 2019 | 27 Aug 2024 | 22 Sep 2026 |
| 47 | chp.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Nov 2016 | 15 Dec 2016 | 12 Nov 2017 |
| 48 | chp.ren | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Oct 2015 | - | 14 Oct 2016 |
| 49 | chp.net | Domain.com, LLC | 5 Aug 1997 | 15 Jul 2024 | 4 Aug 2025 |
| 50 | chp.org | GoDaddy.com, LLC | 15 Aug 1996 | 11 Aug 2024 | 14 Aug 2033 |
| 51 | chp.news | Google, Inc. | 21 Jul 2022 | 25 Sep 2024 | 21 Jul 2027 |
| 52 | chp.education | eNom, Inc. | 23 Nov 2015 | 11 Mar 2017 | 23 Nov 2017 |
| 53 | chp.club | EJEE Group Holdings Limited | 16 Dec 2015 | 6 Mar 2017 | 15 Dec 2019 |
| 54 | chp.asia | NameCheap, Inc. | 8 Jun 2023 | 19 Aug 2024 | 8 Jun 2024 |
| 55 | chp.properties | GoDaddy.com, LLC | 1 Feb 2016 | 14 Jul 2024 | 1 Feb 2026 |
| 56 | chp.energy | Key-Systems, LLC | 12 Jun 2024 | 1 Jul 2024 | 12 Jun 2025 |
| 57 | chp.blue | West263 International Limited | 17 Feb 2016 | - | 17 Feb 2017 |
| 58 | chp.black | West263 International Limited | 19 Feb 2016 | - | 19 Feb 2017 |
| 59 | chp.pink | West263 International Limited | 29 Feb 2016 | - | 28 Feb 2017 |
| 60 | chp.cloud | GoDaddy.com, LLC | 18 Feb 2016 | 23 Feb 2016 | 18 Feb 2017 |
| 61 | chp.ink | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Apr 2022 | 4 May 2022 | 29 Apr 2025 |
| 62 | chp.gift | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Mar 2016 | 18 Mar 2017 | 2 Mar 2017 |
| 63 | chp.co | GoDaddy.com, LLC | 20 Jul 2010 | 25 Jul 2024 | 19 Jul 2025 |
| 64 | chp.istanbul | GoDaddy.com, LLC | 14 Aug 2018 | 28 Sep 2024 | 14 Aug 2025 |
| 65 | chp.ist | Key-Systems, LLC | 6 Mar 2023 | 20 Apr 2024 | 6 Mar 2025 |
| 66 | chp.healthcare | Network Solutions, LLC | 24 Nov 2023 | 24 Nov 2024 | 24 Nov 2025 |
| 67 | chp.gmbh | united-domains AG | 22 Jun 2016 | 5 Sep 2024 | 22 Jun 2025 |
| 68 | chp.gallery | Gandi SAS | 4 Jul 2016 | 17 Sep 2017 | 4 Jul 2017 |
| 69 | chp.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 17 Jun 2016 | 4 Nov 2016 | 16 Jun 2019 |
| 70 | chp.in | - | 20 Oct 2013 | 28 Mar 2017 | 20 Oct 2019 |
| 71 | chp.science | Alpnames Limited | 25 Feb 2015 | 21 May 2016 | 24 Feb 2017 |
| 72 | chp.lol | NameCheap, Inc. | 24 Sep 2024 | 30 Sep 2024 | 24 Sep 2025 |
| 73 | chp.company | Google, Inc. | 28 Apr 2021 | 12 Jun 2024 | 28 Apr 2025 |
| 74 | chp.systems | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 May 2021 | 9 Apr 2024 | 20 May 2025 |
| 75 | chp.training | GoDaddy.com, LLC | 26 Mar 2014 | 7 May 2020 | 26 Mar 2020 |
| 76 | chp.solutions | GoDaddy.com, LLC | 7 Mar 2024 | 13 Oct 2024 | 7 Mar 2025 |
| 77 | chp.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 11 Aug 2014 | 19 Apr 2017 | 11 Aug 2018 |
| 78 | chp.london | Instra Corporation Pty Ltd. | 4 Jun 2024 | 1 Jul 2024 | 4 Jun 2025 |
| 79 | chp.com.br | - | 21 Jun 1998 | 20 Nov 2019 | 21 Jun 2028 |
| 80 | chp.store | GoDaddy.com, LLC | 29 Oct 2017 | 29 Oct 2017 | 29 Oct 2018 |
| 81 | chp.partners | Internet Invest, Ltd. dba Imena.ua | 10 Aug 2016 | 4 Aug 2024 | 10 Aug 2025 |
| 82 | chp.photography | Wild West Domains, LLC | 28 Aug 2016 | 12 Oct 2017 | 28 Aug 2018 |
| 83 | chp.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Sep 2016 | 29 Sep 2017 | 13 Sep 2018 |
| 84 | chp.tips | GoDaddy.com, LLC | 23 Sep 2016 | 4 Nov 2017 | 23 Sep 2017 |
| 85 | chp.parts | CSC Corporate Domains, Inc. | 28 Sep 2016 | 27 Aug 2019 | 28 Sep 2020 |
| 86 | chp.info | - | 29 Jan 2024 | 8 Feb 2024 | 29 Jan 2025 |
| 87 | chp.mobi | GoDaddy.com, LLC | 12 Feb 2022 | 12 Feb 2022 | 12 Feb 2023 |
| 88 | chp.us | TLD Registrar Solutions Ltd. | 5 Jun 2004 | 9 Jul 2024 | 4 Jun 2025 |
| 89 | chp.tech | West263 International Limited | 5 Dec 2016 | 5 Dec 2016 | 5 Dec 2017 |
| 90 | chp.de | - | - | 14 Feb 2024 | - |
| 91 | chp.fr | - | 8 Sep 1999 | 6 Jan 2024 | 9 Nov 2025 |
| 92 | chp.kr | - | 10 May 2017 | 10 May 2017 | 10 May 2019 |
| 93 | chp.la | - | 3 Jul 2021 | 3 Jun 2024 | 3 Jul 2025 |
| 94 | chp.tv | FBS Inc. | 26 Mar 2010 | 26 May 2017 | 26 Mar 2018 |
| 95 | chp.org.uk | - | 5 Jun 2003 | 19 Jun 2024 | 5 Jun 2025 |
| 96 | chp.group | GoDaddy.com, LLC | 25 Mar 2021 | 6 Apr 2023 | 25 Mar 2024 |
| 97 | chp.life | GoDaddy.com, LLC | 23 Nov 2020 | 24 Aug 2024 | 23 Nov 2024 |
| 98 | chp.center | Nics Telekomünikasyon Ticaret Ltd. Şti. | 31 Oct 2017 | 31 Oct 2017 | 31 Oct 2018 |
| 99 | chp.uk | - | 18 Jul 2014 | 14 Jun 2024 | 18 Jul 2025 |
| 100 | chp.eu | - | - | - | - |
| 101 | chp.uk.com | Reserved for non-billable transactions where Regis… | 19 Apr 2015 | 13 Apr 2017 | 19 Apr 2018 |
| 102 | chp.vote | GoDaddy.com, LLC | 23 Apr 2018 | 23 Apr 2018 | 23 Apr 2019 |
| 103 | chp.digital | NameCheap, Inc. | 8 Sep 2020 | 14 Aug 2024 | 8 Sep 2025 |
| 104 | chp.network | GoDaddy.com, LLC | 19 Apr 2018 | 24 Apr 2018 | 19 Apr 2019 |
| 105 | chp.finance | GoDaddy.com, LLC | 27 Jul 2018 | 27 Jul 2018 | 27 Jul 2019 |
| 106 | chp.agency | GoDaddy.com, LLC | 22 Jan 2024 | 6 Feb 2024 | 22 Jan 2025 |
| 107 | chp.zone | NameCheap, Inc. | 22 Jan 2019 | 23 Sep 2024 | 22 Jan 2026 |
| 108 | chp.chat | Google, Inc. | 9 Aug 2019 | 30 Jul 2024 | 9 Aug 2025 |
| 109 | chp.technology | Tucows Domains Inc. | 29 Aug 2018 | 2 Sep 2019 | 29 Aug 2020 |
| 110 | chp.care | Google, Inc. | 1 Oct 2019 | 23 Sep 2024 | 1 Oct 2025 |
| 111 | chp.legal | NameKing.com Inc. | 12 Jun 2024 | 24 Sep 2024 | 12 Jun 2025 |
| 112 | chp.fyi | Google, Inc. | 22 Feb 2020 | 29 May 2024 | 22 Feb 2025 |
| 113 | chp.fund | Key-Systems, LLC | 12 Mar 2020 | 16 Mar 2024 | 12 Mar 2025 |
| 114 | chp.plus | GoDaddy.com, LLC | 8 Mar 2018 | 31 Jul 2024 | 8 Mar 2026 |
| 115 | chp.cool | DNSPod, Inc. | 6 Jul 2020 | 11 Jul 2020 | 6 Jul 2030 |
| 116 | chp.global | GoDaddy.com, LLC | 28 Nov 2023 | 13 Sep 2024 | 28 Nov 2024 |
| 117 | chp.poker | NameCheap, Inc. | 23 Apr 2022 | 23 Apr 2023 | 23 Apr 2024 |
| 118 | chp.rest | Limited Liability Company "Registrar of domain nam… | 7 Sep 2020 | 7 Sep 2020 | 7 Sep 2021 |
| 119 | chp.tools | GoDaddy.com, LLC | 15 Oct 2020 | 17 Oct 2024 | 15 Oct 2025 |
| 120 | chp.ovh | OVH sas | 22 Oct 2024 | 22 Oct 2024 | 22 Oct 2025 |
| 121 | chp.wiki | GoDaddy.com, LLC | 21 Dec 2022 | 1 Feb 2024 | 21 Dec 2023 |
| 122 | chp.com.co | GoDaddy.com, LLC | 30 Sep 2017 | 7 Aug 2024 | 29 Sep 2025 |
| 123 | chp.team | Google, Inc. | 28 Apr 2021 | 12 Jun 2024 | 28 Apr 2025 |
| 124 | chp.international | Network Solutions, LLC | 1 May 2021 | 1 May 2021 | 1 May 2022 |
| 125 | chp.world | Network Solutions, LLC | 17 Feb 2022 | 10 Feb 2024 | 17 Feb 2027 |
| 126 | chp.events | Network Solutions, LLC | 19 Apr 2022 | 1 Jul 2023 | 19 Apr 2023 |
| 127 | chp.tax | Cronon AG | 13 May 2022 | 27 Jun 2024 | 13 May 2025 |
| 128 | chp.nrw | Cronon AG | 13 May 2022 | 13 Jun 2023 | 13 May 2023 |
| 129 | chp.za.com | DiaMatrix C.C. | 24 Mar 2009 | 25 Mar 2024 | 24 Mar 2025 |
| 130 | chp.uz | TLDOMAINS Inc. | 15 Jun 2008 | 16 Jun 2021 | 15 Jul 2023 |
| 131 | chp.dk | - | 24 Jan 2003 | - | 31 Jan 2022 |
| 132 | chp.org.au | - | - | 29 Jun 2024 | - |
| 133 | chp.net.au | - | - | 19 Oct 2024 | - |
| 134 | chp.com.au | - | - | 6 Nov 2024 | - |
| 135 | chp.co.in | - | 30 Jul 2016 | 30 Jul 2023 | 30 Jul 2023 |
| 136 | chp.holdings | Google, Inc. | 26 Sep 2022 | 16 Sep 2024 | 26 Sep 2025 |
| 137 | chp.de.com | NameCheap, Inc. | 21 Oct 2015 | 22 Oct 2024 | 21 Oct 2025 |
| 138 | chp.co.kr | - | 28 Feb 2014 | 1 Sep 2016 | 28 Feb 2023 |
| 139 | chp.law | eNom, Inc. | 27 Mar 2019 | 10 Mar 2024 | 27 Mar 2025 |
| 140 | chp.ma | - | 2 May 2005 | 1 Jun 2024 | 1 May 2025 |
| 141 | chp.surf | GMO Internet Inc. | 18 Dec 2017 | 22 Oct 2024 | 18 Dec 2025 |
| 142 | chp.app | Dynadot, LLC | 8 May 2018 | 22 Jun 2024 | 8 May 2025 |
| 143 | chp.berlin | Cronon AG | 28 Mar 2014 | 30 Aug 2021 | 28 Mar 2025 |
| 144 | chp.or.ke | - | 2 Nov 2012 | 29 Oct 2024 | 2 Nov 2025 |
| 145 | chp.com.pe | - | - | - | - |
| 146 | chp.bond | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 15 Nov 2020 | 31 Aug 2023 | 15 Nov 2030 |
| 147 | chp.cm | - | 22 Sep 2020 | 11 Jul 2024 | 22 Sep 2021 |
| 148 | chp.tl | 1API GmbH | 13 Jul 2017 | 12 Jul 2024 | 13 Jul 2025 |
| 149 | chp.com.pt | - | 9 Aug 2005 | - | - |
| 150 | chp.cba | CSC Corporate Domains, Inc. | 21 Oct 2016 | 21 Sep 2024 | 21 Oct 2025 |
| 151 | chp.cn | - | 13 Jun 2004 | - | 13 Jun 2025 |
| 152 | chp.pl | home.pl S.A. | 19 Nov 2002 | 20 Sep 2022 | 18 Nov 2025 |
| 153 | chp.net.nz | - | 8 Nov 2002 | 22 Nov 2023 | - |
| 154 | chp.vc | CSC Corporate Domains, Inc. | 16 Feb 2012 | 22 Oct 2024 | 16 Feb 2027 |
| 155 | chp.pt | - | - | - | - |
| 156 | chp.work | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 2 Apr 2022 | 27 Aug 2024 | 2 Apr 2026 |
| 157 | chp.family | GoDaddy.com, LLC | 21 Feb 2019 | 22 Jun 2024 | 21 Feb 2025 |
| 158 | chp.it | - | 28 Apr 2000 | 14 May 2024 | 28 Apr 2025 |
| 159 | chp.jp | - | 13 Jun 2013 | 1 Jul 2024 | 30 Jun 2025 |
| 160 | chp.me | InterNetworX Ltd. & Co. KG | 10 Feb 2012 | 26 Mar 2024 | 10 Feb 2025 |
| 161 | chp.monster | Uniregistrar Corp | 21 Dec 2021 | 1 Feb 2024 | 21 Dec 2023 |
| 162 | chp.name | GoDaddy.com, LLC | - | - | - |
| 163 | chp.com.pl | home.pl S.A. | 8 Aug 2006 | 19 Jul 2024 | 8 Aug 2026 |
| 164 | chp.arts.ro | - | 9 Mar 2009 | - | 7 Jul 2025 |
| 165 | chp.ai | - | - | - | - |
| 166 | chp.icu | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Sep 2024 | 29 Sep 2024 | 29 Sep 2025 |
| 167 | chp.gay | eNom, Inc. | 24 Jun 2023 | 5 Aug 2024 | 24 Jun 2024 |
| 168 | chp.org.nz | - | 18 Jul 2023 | 21 Mar 2024 | - |
| 169 | chp.me.uk | - | 31 Jul 2023 | 7 Sep 2023 | 31 Jul 2025 |
| 170 | chp.lat | Porkbun, LLC | 25 Aug 2023 | 8 Oct 2024 | 25 Aug 2024 |
| 171 | chp.ae | - | - | - | - |
| 172 | chp.com.cn | - | 3 Aug 2022 | - | 3 Aug 2025 |
| 173 | chp.uk.net | Webfusion Ltd. | 27 Feb 2017 | 22 Oct 2024 | 27 Feb 2025 |
| 174 | chp.support | GoDaddy.com, LLC | 2 Dec 2023 | 13 Sep 2024 | 2 Dec 2024 |
| 175 | chp.construction | Google, Inc. | 7 Feb 2024 | 6 Jun 2024 | 7 Feb 2025 |
| 176 | chp.com.de | - | - | 26 Aug 2024 | - |
| 177 | chp.vip | Hangzhou AiMing Network Co., LTD | 31 Aug 2016 | 12 Oct 2024 | 31 Aug 2025 |
| 178 | chp.su | - | 4 Jun 2014 | - | 4 Jun 2025 |
| 179 | chp.ru | - | 6 Feb 2002 | - | 7 Feb 2025 |
| 180 | chp.bio | NameCheap, Inc. | 6 May 2024 | 11 May 2024 | 6 May 2025 |
| 181 | chp.onl | Amazon Registrar, Inc. | 2 Jun 2024 | 7 Jun 2024 | 2 Jun 2025 |
| 182 | chp.land | NameCheap, Inc. | 11 Jul 2024 | 16 Jul 2024 | 11 Jul 2025 |
| 183 | chp.community | NameCheap, Inc. | 11 Jul 2024 | 16 Jul 2024 | 11 Jul 2025 |
| 184 | chp.ro | - | 22 Dec 2018 | - | 19 Dec 2024 |
| 185 | chp.ie | Protocol Internet Technology Limited T/A Hosting I… | 25 Apr 2016 | 7 Jun 2024 | 26 Apr 2025 |
| 186 | chp.nl | - | 16 Feb 2000 | 19 Nov 2021 | - |
| 187 | chp.mom | Namesilo, LLC | 30 Sep 2024 | 30 Sep 2024 | 30 Sep 2025 |
| 188 | chp.capital | GoDaddy.com, LLC | 2 Oct 2024 | 2 Oct 2024 | 2 Oct 2025 |
| 189 | chp.se | - | 2 Dec 2011 | 2 Dec 2023 | 2 Dec 2024 |
| 190 | chpda.com | DropCatch.com 1197 LLC | 15 Mar 2024 | 16 Mar 2024 | 15 Mar 2025 |
| 191 | chpistanbul.org.tr | - | 13 Jan 2005 | - | 12 Jan 2019 |
| 192 | chpaonline.org | GoDaddy.com, LLC | 6 Mar 2004 | 19 Jul 2024 | 6 Mar 2025 |
| 193 | chpk.no | - | 1 Oct 2010 | 24 Sep 2012 | - |
| 194 | chpnet.org | Network Solutions, LLC | 13 Aug 1998 | 18 Jun 2024 | 12 Aug 2025 |
| 195 | chprf.com | Bizcn.com, Inc. | 30 Sep 2006 | 11 Apr 2024 | 30 Sep 2025 |
| 196 | chpedu.net | Xin Net Technology Corporation | 21 Jan 2010 | 5 Dec 2023 | 21 Jan 2025 |
| 197 | chpnyc.org | Network Solutions, LLC | 9 Apr 2003 | 14 Feb 2024 | 9 Apr 2025 |
| 198 | chpoki.com | TurnCommerce, Inc. DBA NameBright.com | 23 Jan 2019 | 31 Dec 2020 | 23 Jan 2025 |
| 199 | chpwn.com | Google, Inc. | 29 May 2010 | 14 May 2024 | 29 May 2025 |
| 200 | chpa.co.uk | - | 14 Jul 2015 | 13 Jul 2024 | 14 Jul 2025 |
| 201 | chplnj.org | GoDaddy.com, LLC | 23 Jun 2004 | 10 Jun 2024 | 23 Jun 2026 |
| 202 | chpn.net | Google, Inc. | 9 Aug 2004 | 21 Apr 2024 | 9 Aug 2026 |
| 203 | chpower.com | GoDaddy.com, LLC | 21 Aug 1997 | 1 Nov 2022 | 20 Aug 2025 |
| 204 | chproducts.com | Network Solutions, LLC | 19 Aug 1995 | 28 Jan 2024 | 18 Aug 2025 |
| 205 | chpsaintgregoire.com | OVH sas | 29 Oct 2014 | 4 Aug 2024 | 29 Oct 2029 |
| 206 | chplaymienphi.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 207 | chpwiec.com | Hongkong Domain Name Information Management Co., L… | 24 Apr 2021 | 24 Apr 2021 | 24 Apr 2022 |
| 208 | chpkjp.com | Xin Net Technology Corporation | 16 Oct 2013 | 22 Oct 2014 | 16 Oct 2015 |
| 209 | chplast.com.pl | - | 21 Sep 2007 | 24 Sep 2024 | 21 Sep 2025 |
| 210 | chpoking.ru | - | 14 Aug 2009 | - | 14 Aug 2025 |
| 211 | chprimary.net | 1&1 Internet AG | 21 Oct 2014 | 22 Oct 2016 | 21 Oct 2017 |
| 212 | chpqydpeq.us | - | 21 Oct 2014 | - | 20 Oct 2015 |
| 213 | chpningunahgalerisi.com | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 214 | chpnintarihi.com | GoDaddy.com, LLC | 5 Jun 2015 | 5 Jun 2015 | 5 Jun 2016 |
| 215 | chptarihi.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 23 Jan 2018 | 23 Jan 2018 | 23 Jan 2019 |
| 216 | chpc.ac.th | Tech Tyrants, Inc. | 30 May 2011 | 22 Apr 2014 | - |
| 217 | chpeizi.com | Hosting Concepts B.V. dba Openprovider | 28 Jul 2021 | 28 Jul 2021 | 28 Jul 2022 |
| 218 | chpw.org | GoDaddy.com, LLC | 21 Oct 1998 | 20 Oct 2024 | 20 Oct 2025 |
| 219 | chplt.be | - | 15 May 1998 | - | - |
| 220 | chplan.cn | Dagnabit, Incorporated | 31 Aug 2010 | - | 31 Aug 2016 |
| 221 | chpok.me | Regional Network Information Center, JSC dba RU-CE… | 5 Jan 2009 | 28 Oct 2016 | 5 Jan 2018 |
| 222 | chpakademi.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Apr 2015 | 5 Jun 2015 | 5 Apr 2016 |
| 223 | chprdwt.com | register.com, Inc. | 11 Jul 2014 | 24 Oct 2014 | 11 Jul 2015 |
| 224 | chpies.com | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Apr 2019 | 5 Apr 2019 | 5 Apr 2020 |
| 225 | chphoa.org | GoDaddy.com, LLC | 27 May 2008 | 8 Jun 2015 | 27 May 2016 |
| 226 | chpt-inc.info | GoDaddy.com, LLC | 28 May 2012 | 28 May 2015 | 28 May 2016 |
| 227 | chpm.co | GoDaddy.com, LLC | 4 Jun 2011 | 9 Jun 2015 | 3 Jun 2015 |
| 228 | chpcertified.org | - | - | - | - |
| 229 | chpengportfolio.com | Tucows Domains Inc. | 26 Oct 2014 | 30 Oct 2015 | 26 Oct 2016 |
| 230 | chpcertified.net | GoDaddy.com, LLC | 4 Jun 2012 | 5 Jun 2015 | 4 Jun 2016 |
| 231 | chpinyue.com | enom413, Incorporated | 16 Mar 2022 | 29 Apr 2023 | 16 Mar 2023 |
| 232 | chpiao.com | Namesilo, LLC | 10 Aug 2021 | 10 Oct 2023 | 10 Aug 2023 |
| 233 | chpkusadasi.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2017 | 24 Oct 2017 | 4 Mar 2018 |
| 234 | chpdrone.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 235 | chpbesiktas.org | Reg2C.com Inc. | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 236 | chpinspection.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2024 | 29 Oct 2025 |
| 237 | chphaberleri.net | GoDaddy.com, LLC | 13 Feb 2020 | 13 Feb 2020 | 13 Feb 2021 |
| 238 | chp-osaka.net | Key-Systems GmbH | 15 Jan 2021 | 15 Jan 2021 | 15 Jan 2022 |
| 239 | chpbelengenclik.com | FBS Inc. | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 240 | chp2014.org | Wild West Domains, LLC | 7 Jan 2014 | 24 Feb 2015 | 7 Jan 2016 |
| 241 | chpmi.org | Network Solutions, LLC | 7 Dec 2004 | 14 Nov 2012 | 7 Dec 2017 |
| 242 | chphplefomiqcs.com | Chengdu Fly-Digital Technology Co., Ltd | 21 Oct 2011 | 22 Oct 2024 | 21 Oct 2025 |
| 243 | chpropertiesllc.com | GoDaddy.com, LLC | 31 Oct 2019 | 31 Oct 2019 | 31 Oct 2021 |
| 244 | chpmanedu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 245 | chp1.com | TurnCommerce, Inc. DBA NameBright.com | 31 Oct 2014 | 25 Oct 2020 | 31 Oct 2024 |
| 246 | chpgroup.com | GoDaddy.com, LLC | 11 Jun 2003 | 12 Jun 2024 | 11 Jun 2025 |
| 247 | chplay.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 May 2011 | 30 Aug 2024 | 9 May 2026 |
| 248 | chpres.org | GoDaddy.com, LLC | 27 Mar 2004 | 21 Jun 2024 | 27 Mar 2025 |
| 249 | chplay.net | Porkbun, LLC | 24 Feb 2020 | 18 Feb 2024 | 24 Feb 2025 |
| 250 | chpschneider.net | 1&1 Internet AG | 15 Apr 2004 | 13 Nov 2017 | 15 Apr 2025 |
| 251 | chpclv.com | Realtime Register B.V. | 17 Jun 2022 | 28 Aug 2023 | 17 Jun 2023 |
| 252 | chpch.com | GoDaddy.com, LLC | 19 Jan 2014 | 20 Jan 2023 | 19 Jan 2026 |
| 253 | chpitter.net | - | - | - | - |
| 254 | chportal.com | TurnCommerce, Inc. DBA NameBright.com | 10 Jul 2015 | 4 Jul 2020 | 10 Jul 2025 |
| 255 | chpwo.com | - | - | - | - |
| 256 | chpunits.com | 35 Technology Co., Ltd. | 31 Mar 2023 | 9 Jun 2024 | 31 Mar 2024 |
| 257 | chpomaha.com | GoDaddy.com, LLC | 28 Feb 2019 | 28 Feb 2019 | 28 Feb 2021 |
| 258 | chpool.com | TurnCommerce, Inc. DBA NameBright.com | 6 May 2018 | 6 Jul 2024 | 6 May 2025 |
| 259 | chpactiveandhealthy.com | GoDaddy.com, LLC | 25 Oct 2008 | 25 Oct 2024 | 25 Oct 2025 |
| 260 | chp-engineering.com | Launchpad, Inc. | 17 Aug 2023 | 2 Aug 2024 | 17 Aug 2025 |
| 261 | chpbmcd.com | GoDaddy.com, LLC | 6 Jun 2005 | 7 Jun 2015 | 6 Jun 2016 |
| 262 | chproperties.com | GoDaddy.com, LLC | 5 Aug 1998 | 17 Sep 2024 | 4 Aug 2025 |
| 263 | chpkgas.com | CSC Corporate Domains, Inc. | 11 May 1999 | 7 May 2024 | 11 May 2025 |
| 264 | chpower.net | GoDaddy.com, LLC | 29 Mar 2004 | 26 Mar 2024 | 29 Mar 2025 |
| 265 | chplastics.com | GoDaddy.com, LLC | 17 Dec 2003 | 18 Dec 2023 | 17 Dec 2024 |
| 266 | chp1010.com | Key-Systems GmbH | 13 May 2023 | 26 Jul 2024 | 13 May 2024 |
| 267 | chpyouth.com | TurnCommerce, Inc. DBA NameBright.com | 1 Feb 2012 | 19 Mar 2020 | 1 Feb 2025 |
| 268 | chpa-us.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jan 2005 | 14 Dec 2022 | 25 Jan 2027 |
| 269 | chpconsultants.com | Tucows Domains Inc. | 14 Jun 2001 | 30 May 2024 | 14 Jun 2025 |
| 270 | chpwnet.com | FastDomain Inc. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 271 | chpingan.com | HiChina Zhicheng Technology Limited | 24 Jan 2021 | 29 Sep 2024 | 24 Jan 2025 |
| 272 | chpah.com | TurnCommerce, Inc. DBA NameBright.com | 1 Apr 2020 | 13 May 2024 | 1 Apr 2024 |
| 273 | chpics.com | Register.it SPA | 27 Oct 2024 | 27 Oct 2024 | 27 Oct 2025 |
| 274 | chpdosimetry.com | GoDaddy.com, LLC | 29 Mar 2007 | 29 Mar 2024 | 29 Mar 2026 |
| 275 | chpwholesaleshop.com | GoDaddy.com, LLC | 8 Jun 2020 | 8 Jun 2020 | 8 Jun 2021 |
| 276 | chp13aug.org | Network Solutions, LLC | 8 May 2000 | 26 Jun 2024 | 8 May 2026 |
| 277 | chpoweredproducts.com | GoDaddy.com, LLC | 18 Feb 2010 | 30 Apr 2015 | 18 Feb 2016 |
| 278 | chporto.pt | - | 12 Jul 2007 | - | 12 May 2024 |
| 279 | chpindao.com | HiChina Zhicheng Technology Limited | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 280 | chpooo.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 May 2015 | 3 Nov 2024 | 25 May 2026 |
| 281 | chpepiceweb.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 282 | chpbesiktasgenc.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 283 | chpprogram.com | Tucows Domains Inc. | 20 Aug 2014 | 26 Jul 2024 | 20 Aug 2025 |
| 284 | chprenovations.com | Squarespace Domains LLC | 19 Aug 2014 | 9 Jul 2024 | 19 Aug 2025 |
| 285 | chpsttc.org | Xin Net Technology Corporation | 19 Aug 2014 | - | 19 Aug 2015 |
| 286 | chpcustomdesign.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 287 | chpgprimarycare.com | Network Solutions, LLC | 24 Jun 2015 | 17 May 2017 | 24 Jun 2018 |
| 288 | chpginternalmed.com | Network Solutions, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 289 | chpgwomenshealth.com | Network Solutions, LLC | 24 Jun 2015 | 17 May 2017 | 24 Jun 2018 |
| 290 | chpredictlabs.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 291 | chp-pop.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 292 | chpl.biz | GMO Internet Inc. | 19 Nov 2015 | - | 18 Nov 2016 |
| 293 | chpunchfreewelt.com | Bizcn.com, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 294 | chpuzunkopru.org | NameCheap, Inc. | 6 Jun 2017 | 6 Aug 2017 | 6 Jun 2018 |
| 295 | chpdersim.com | FBS Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 296 | chpdersim.net | FBS Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 297 | chplondontest.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 298 | chpmoulayrachid.com | eNom, Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 299 | chpwtesturl.com | FastDomain Inc. | 12 Jan 2015 | 23 Feb 2016 | 12 Jan 2017 |
| 300 | chp-gov.com | Tucows Domains Inc. | 31 Jan 2019 | 4 Feb 2020 | 31 Jan 2020 |
| 301 | chptch.com | DropCatch.com 698 LLC | 24 Jan 2024 | 27 Jan 2024 | 24 Jan 2025 |
| 302 | chpxw.org | GoDaddy.com, LLC | 19 May 2017 | 18 Jul 2017 | 19 May 2018 |
| 303 | chproductionsnyc.com | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2024 | 6 Nov 2026 |
| 304 | chproduction.com | TurnCommerce, Inc. DBA NameBright.com | 6 Nov 2014 | 15 Jan 2020 | 6 Nov 2025 |
| 305 | chprod.biz | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 5 Nov 2016 |
| 306 | chpglofi.com | GMO Internet Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 307 | chper.com | Namesilo, LLC | 27 Jan 2016 | 28 Jan 2024 | 27 Jan 2025 |
| 308 | chpc-cpa.com | GoDaddy.com, LLC | 6 Feb 2015 | 7 Feb 2024 | 6 Feb 2025 |
| 309 | chphotodesign.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2020 | 14 Nov 2020 | 14 Nov 2021 |
| 310 | chpkadingucu.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 311 | chpkadingucu.org | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 312 | chpdv.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 313 | chpanamericano.com | Hostinger, UAB | 5 Jul 2022 | 15 Aug 2023 | 5 Jul 2023 |
| 314 | chpimages.com | FastDomain Inc. | 22 Aug 2014 | 7 Aug 2017 | 22 Aug 2018 |
| 315 | chpluckys.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 316 | chpwsale.com | Xin Net Technology Corporation | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 317 | chpkonya.org | Name.com, Inc. | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 318 | chppi.net | GoDaddy.com, LLC | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 319 | chpcolorado.com | NameCheap, Inc. | 7 Nov 2014 | 9 Jan 2018 | 7 Nov 2018 |
| 320 | chpqeisl.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 321 | chparkfoundation.org | GoDaddy.com, LLC | 24 Jun 2015 | 10 Jul 2024 | 24 Jun 2027 |
| 322 | chpginternalmed.org | Network Solutions, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 323 | chpgprimarycare.org | CloudFlare, Inc. | 24 Jun 2015 | 30 May 2024 | 24 Jun 2025 |
| 324 | chpgwomenshealth.org | Network Solutions, LLC | 24 Jun 2015 | 17 May 2017 | 24 Jun 2018 |
| 325 | chpspta.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 326 | chpjw.com | Beijing Lanhai Jiye Technology Co., Ltd | 12 Nov 2022 | 29 Oct 2024 | 12 Nov 2025 |
| 327 | chpa66.com | HiChina Zhicheng Technology Limited | 26 Aug 2014 | 27 Mar 2023 | 26 Aug 2026 |
| 328 | chpd.net | DropCatch.com 482 LLC | 2 Nov 2018 | 2 Nov 2024 | 2 Nov 2024 |
| 329 | chpfrance.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 Oct 2020 | 1 Nov 2023 | 31 Oct 2024 |
| 330 | chpgundem.com | Ä°simtescil BiliÅŸim A.Åž. | 17 Apr 2019 | 24 Apr 2024 | 17 Apr 2025 |
| 331 | chprequine.com | Tucows Domains Inc. | 23 Aug 2011 | 27 Aug 2014 | 23 Aug 2015 |
| 332 | chpvehicles.com | Papaki Ltd. | 25 Aug 2014 | 27 Jul 2024 | 25 Aug 2025 |
| 333 | chpzeytinburnu.com | Network Solutions, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 334 | chpsosyal.com | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2016 | 13 Aug 2017 |
| 335 | chpinzon.com | Wild West Domains, LLC | 14 Aug 2014 | 15 Aug 2024 | 14 Aug 2025 |
| 336 | chpyebirkadinelieulkertarhan.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 337 | chpadana.org | NameCheap, Inc. | 22 Feb 2018 | 30 Jan 2024 | 22 Feb 2025 |
| 338 | chplay-google.com | Web Commerce Communications Limited dba WebNic.cc | 7 Aug 2024 | 3 Aug 2024 | 7 Aug 2025 |
| 339 | chplay2014.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 340 | chpromos.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Mar 2022 | 22 Apr 2024 | 21 Mar 2024 |
| 341 | chplwmarketing.com | Wild West Domains, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 342 | chpmarketing.com | TurnCommerce, Inc. DBA NameBright.com | 3 Nov 2015 | 28 Oct 2020 | 3 Nov 2024 |
| 343 | chphealthcare.com | DROPCATCH.COM 756 LLC | 23 Jul 2023 | 24 Jul 2023 | 23 Jul 2025 |
| 344 | chpg-3d-druck.com | united-domains AG | 10 Nov 2014 | 2 Oct 2024 | 10 Nov 2025 |
| 345 | chpbw.com | Hosting Concepts B.V. dba Openprovider | 1 Sep 2019 | 1 Sep 2019 | 1 Sep 2020 |
| 346 | chpatisseries.com | Tucows Domains Inc. | 13 Aug 2010 | 18 Aug 2014 | 13 Aug 2015 |
| 347 | chpocc.org | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2016 |
| 348 | chpg-3d-druck.net | united-domains AG | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 349 | chpg-3d-druck.info | united-domains AG | 10 Nov 2014 | - | 10 Nov 2015 |
| 350 | chpliyiz.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2022 | 23 Aug 2024 | 3 Sep 2025 |
| 351 | chpoki.org | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 352 | chpg-3d-druck.org | united-domains AG | 10 Nov 2014 | - | 10 Nov 2015 |
| 353 | chpeogrenme.org | Tucows Domains Inc. | 7 Nov 2013 | 11 Nov 2014 | 7 Nov 2015 |
| 354 | chpenergy.info | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 355 | chpenergy.net | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 356 | chpenergy.org | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 357 | chpyerel.net | FBS Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 358 | chpyerel.org | FBS Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 359 | chpbxww.biz | GMO Internet Inc. | 28 Aug 2014 | - | 27 Aug 2015 |
| 360 | chphost.com | NameCheap, Inc. | 29 Aug 2018 | 30 Jul 2024 | 29 Aug 2025 |
| 361 | chpnyc.com | TurnCommerce, Inc. DBA NameBright.com | 5 Mar 2014 | 27 Feb 2021 | 5 Mar 2025 |
| 362 | chpfs.com | - | 28 Jun 2024 | 3 Oct 2024 | 28 Jun 2025 |
| 363 | chpkars.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 364 | chpsib.com | FBS Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 365 | chpropertymanagement.com | GoDaddy.com, LLC | 13 Nov 2014 | 14 Nov 2023 | 13 Nov 2025 |
| 366 | chplayvn.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 367 | chpisparta.org | Tucows Domains Inc. | 8 Sep 2012 | 12 Sep 2014 | 8 Sep 2015 |
| 368 | chpcon2011.com | Japan Registry Services Co., Ltd. | 23 Feb 2017 | 9 Jan 2024 | 23 Feb 2025 |
| 369 | chpace.com | GoDaddy.com, LLC | 23 Apr 2024 | 23 Apr 2024 | 23 Apr 2025 |
| 370 | chpaday.com | Realtime Register B.V. | 20 Apr 2022 | 1 Jul 2023 | 20 Apr 2023 |
| 371 | chpgqziwo.us | - | 31 Aug 2014 | - | 30 Aug 2015 |
| 372 | chpy18.com | HiChina Zhicheng Technology Limited | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 373 | chpdkm.com | Network Solutions, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 374 | chpdpw.com | Hosting Concepts B.V. dba Openprovider | 1 Sep 2019 | 1 Sep 2019 | 1 Sep 2020 |
| 375 | chp3o6gy76.com | GMO Internet Inc. | 1 Sep 2014 | 2 Sep 2014 | 1 Sep 2015 |
| 376 | chpdistribution.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Sep 2014 | 2 Sep 2016 | 1 Sep 2017 |
| 377 | chperu.com | Soluciones Corporativas IP, SLU | 11 Nov 2020 | 27 Oct 2024 | 11 Nov 2025 |
| 378 | chpvlaj.com | Network Solutions, LLC | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 379 | chpyzw45kf.com | GMO Internet Inc. | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 380 | chp-cm.org | SiteName Ltd. | 4 Jun 2022 | 4 Jun 2023 | 4 Jun 2024 |
| 381 | chpeg.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 382 | chpetbt.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Sep 2014 | 3 Oct 2024 | 16 Sep 2025 |
| 383 | chpgreen.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 384 | chpsource.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 385 | chpadvantage.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 386 | chpcigli.com | Domainsareforever.net LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 387 | chpfethiye.org | FBS Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 388 | chpg.net | enom383, Incorporated | 9 Nov 2020 | 11 Nov 2024 | 9 Nov 2025 |
| 389 | chpharma.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Dec 2015 | 29 Dec 2023 | 28 Dec 2024 |
| 390 | chpvps.net | Gandi SAS | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 391 | chpartvin.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 392 | chpcanakkale.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 393 | chpdev.com | GoDaddy.com, LLC | 15 Sep 2014 | 16 Sep 2016 | 15 Sep 2018 |
| 394 | chpedirne.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 395 | chpkonya.com | Aerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 396 | chpmersin.com | DropCatch.com 633 LLC | 2 Dec 2015 | 3 Dec 2016 | 2 Dec 2017 |
| 397 | chpsamsun.com | FBS Inc. | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 398 | chpukw.com | Network Solutions, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 399 | chpenchamp.com | GMO Internet Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 400 | chpinshui.com | Xin Net Technology Corporation | 3 Sep 2014 | 3 Nov 2024 | 3 Sep 2024 |
| 401 | chpliyiz.com | IHS Telekom, Inc. | 3 Sep 2022 | 18 Oct 2024 | 3 Sep 2025 |
| 402 | chpw.net | Dynadot, LLC | 18 Sep 2014 | 28 Oct 2024 | 18 Sep 2025 |
| 403 | chpanahtarliste.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 404 | chpanahtarliste.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 405 | chpgundemi.com | - | 6 Feb 2023 | 9 Mar 2024 | 6 Feb 2024 |
| 406 | chpgundemi.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 407 | chpgundemi.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 4 Sep 2014 | - | 4 Sep 2015 |
| 408 | chpipe.com | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Sep 2016 | 29 Sep 2016 | 29 Sep 2025 |
| 409 | chplay-2014.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 410 | chp-ace.com | eNom, Inc. | 16 Nov 2014 | 6 Nov 2017 | 16 Nov 2018 |
| 411 | chpets.net | Network Solutions, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 412 | chphil.org | Domain.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 413 | chpavcilar.com | IHS Telekom, Inc. | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 414 | chpaxbs.com | Network Solutions, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 415 | chpreport.com | Fabulous.com Pty Ltd. | 12 Aug 2007 | 8 Aug 2024 | 12 Aug 2025 |
| 416 | chprk.us | - | 20 Sep 2014 | - | 19 Sep 2015 |
| 417 | chpvm.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Jan 2022 | 8 Oct 2024 | 5 Jan 2025 |
| 418 | chptfitness.com | GoDaddy.com, LLC | 17 Nov 2014 | 10 Nov 2016 | 17 Nov 2017 |
| 419 | chpmesaj.com | Tucows Domains Inc. | 17 Nov 2014 | 21 Nov 2015 | 17 Nov 2016 |
| 420 | chp8.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Aug 2024 | 26 Aug 2024 | 10 Aug 2025 |
| 421 | chprog.com | Google, Inc. | 13 Sep 2014 | 26 Apr 2024 | 13 Sep 2032 |
| 422 | chpevents.biz | Network Solutions, LLC | 8 Sep 2014 | 27 Sep 2016 | 7 Sep 2017 |
| 423 | chpglonetree.com | Network Solutions, LLC | 8 Sep 2014 | 24 Jan 2018 | 8 Sep 2018 |
| 424 | chpglonetree.org | Network Solutions, LLC | 8 Sep 2014 | 2 Feb 2018 | 8 Sep 2018 |
| 425 | chpglonetreeprimarycare.com | Network Solutions, LLC | 8 Sep 2014 | 27 Jan 2018 | 8 Sep 2018 |
| 426 | chpglonetreeprimarycare.org | Network Solutions, LLC | 8 Sep 2014 | 3 Feb 2018 | 8 Sep 2018 |
| 427 | chpasohnx.org | GMO Internet Inc. | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 428 | chpweb.com | Tucows Domains Inc. | 20 Dec 2001 | 5 Dec 2023 | 20 Dec 2024 |
| 429 | chpclientgallery.com | register.com, Inc. | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 430 | chpanket.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 431 | chpmesaj.org | Tucows Domains Inc. | 17 Nov 2014 | 21 Nov 2015 | 17 Nov 2016 |
| 432 | chpsosyal.org | FBS Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 433 | chpackage.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 7 Nov 2020 | 8 Nov 2024 | 7 Nov 2025 |
| 434 | chptekirdag.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 435 | chparkdistrict.com | DropCatch.com 427 LLC | 3 Oct 2014 | 4 Oct 2017 | 3 Oct 2018 |
| 436 | chp-sale.com | eNom, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 437 | chplatform.com | register.com, Inc. | 10 Sep 2014 | 11 Aug 2023 | 10 Sep 2025 |
| 438 | chpowc.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 May 2020 | 28 May 2023 | 27 May 2024 |
| 439 | chpajamas.com | eNom, Inc. | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 440 | chpstore.org | GoDaddy.com, LLC | 30 Sep 2016 | 30 Sep 2016 | 30 Sep 2017 |
| 441 | chpfb23235.com | GoDaddy.com, LLC | 1 Oct 2014 | 2 Oct 2014 | 1 Oct 2015 |
| 442 | chpbroker.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 443 | chpclean.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 444 | chpdepot.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 445 | chpdirect.com | TurnCommerce, Inc. DBA NameBright.com | 29 Jul 2020 | 23 Jul 2021 | 29 Jul 2025 |
| 446 | chpeisbad4ny.com | GoDaddy.com, LLC | 11 Sep 2014 | 12 Sep 2016 | 11 Sep 2018 |
| 447 | chpengineers.com | GoDaddy.com, LLC | 25 Jun 2020 | 26 Jun 2024 | 25 Jun 2025 |
| 448 | chpfunding.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 449 | chpgrant.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 450 | chplist.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 451 | chpnj.com | GoDaddy.com, LLC | 8 Feb 2022 | 9 Feb 2024 | 8 Feb 2026 |
| 452 | chpresource.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 453 | chpworld.com | Hostinger, UAB | 28 Oct 2023 | 28 Oct 2024 | 28 Oct 2024 |
| 454 | chpyerel.com | FBS Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 455 | chpzone.com | GoDaddy.com, LLC | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2016 |
| 456 | chplearns.org | Tucows Domains Inc. | 8 Dec 2011 | 12 Dec 2015 | 8 Dec 2016 |
| 457 | chpcc.mobi | GMO Internet Inc. | 3 Oct 2014 | - | 3 Oct 2015 |
| 458 | chpst.net | GoDaddy.com, LLC | 24 Apr 2020 | 24 Apr 2020 | 24 Apr 2021 |
| 459 | chpvc.com | GoDaddy.com, LLC | 10 Dec 2020 | 5 Aug 2024 | 10 Dec 2025 |
| 460 | chprofessionalclean.com | register.com, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 461 | chpinteriordesigns.com | register.com, Inc. | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2016 |
| 462 | chptickets.info | Moniker Online Services LLC | 6 Oct 2014 | 7 Oct 2014 | 6 Oct 2015 |
| 463 | chpcp.com | Web Commerce Communications Limited dba WebNic.cc | 26 Mar 2023 | 26 Oct 2022 | 26 Mar 2024 |
| 464 | chplayapp.com | NameKing.com Inc. | 19 Dec 2022 | 17 Dec 2023 | 19 Dec 2024 |
| 465 | chpwdsc.com | Xin Net Technology Corporation | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 466 | chplumbingca.com | register.com, Inc. | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 467 | chportic.info | Dynadot, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 468 | chpzile.com | Network Solutions, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 469 | chpwzf.com | Xin Net Technology Corporation | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 470 | chprs.com | GoDaddy.com, LLC | 4 Jun 2021 | 16 Jul 2023 | 4 Jun 2023 |
| 471 | chpatent.net | Regional Network Information Center, JSC dba RU-CE… | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 472 | chp-goods.com | Cronon AG | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 473 | chpadaylari.info | Tucows Domains Inc. | 5 Oct 2013 | 9 Oct 2014 | 5 Oct 2015 |
| 474 | chpmnstudios.com | Tucows Domains Inc. | 8 Oct 2014 | 23 Sep 2024 | 8 Oct 2025 |
| 475 | chpegasus.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Oct 2018 | 16 Sep 2024 | 5 Oct 2025 |
| 476 | chpadaymatbasi.com | Tucows Domains Inc. | 25 Sep 2013 | 29 Sep 2014 | 25 Sep 2015 |
| 477 | chpegitim.org | Bizcn.com, Inc. | 20 Sep 2013 | 27 Sep 2014 | 20 Sep 2015 |
| 478 | chpetrou.net | Papaki Ltd. | 28 Sep 2014 | 19 Aug 2022 | 28 Sep 2030 |
| 479 | chplk.com | NameCheap, Inc. | 13 Dec 2021 | - | 13 Dec 2022 |
| 480 | chpryd.com | Network Solutions, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 481 | chpadaymatbaasi.com | Tucows Domains Inc. | 25 Sep 2013 | 29 Sep 2014 | 25 Sep 2015 |
| 482 | chpustanki.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 483 | chplay2014.info | GoDaddy.com, LLC | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 484 | chpmf.com | Cloud Yuqu LLC | 28 Feb 2020 | 28 Feb 2020 | 28 Feb 2021 |
| 485 | chpformation.com | Wix.com Ltd. | 11 May 2020 | 21 Jun 2024 | 11 May 2025 |
| 486 | chphome.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 487 | chprochemical.com | GoDaddy.com, LLC | 22 Nov 2014 | 23 Nov 2023 | 22 Nov 2026 |
| 488 | chpmarketplace.com | GoDaddy.com, LLC | 13 Oct 2022 | 14 Oct 2024 | 13 Oct 2025 |
| 489 | chplucky.com | Network Solutions, LLC | 9 Feb 2021 | 25 Apr 2023 | 9 Feb 2023 |
| 490 | chparkdistrict.org | Tucows Domains Inc. | 17 Nov 2010 | 21 Nov 2014 | 17 Nov 2015 |
| 491 | chplaine.com | Register.it SPA | 16 Oct 2014 | 18 Nov 2024 | 16 Oct 2025 |
| 492 | chpmilletvekilleri.com | DropCatch.com 1361 LLC | 21 Mar 2018 | 21 Mar 2018 | 21 Mar 2019 |
| 493 | chpsecmen.com | Ä°simtescil BiliÅŸim A.Åž. | 16 Oct 2014 | 25 Sep 2024 | 16 Oct 2028 |
| 494 | chpress-admin.com | Tucows Domains Inc. | 11 Oct 2014 | 15 Oct 2019 | 11 Oct 2019 |
| 495 | chpbalikesir.com | DropCatch.com 379 LLC | 10 Feb 2016 | 11 Feb 2017 | 10 Feb 2018 |
| 496 | chptunceli.org | EPAG Domainservices GmbH | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 497 | chpbalikesir.net | GoDaddy.com, LLC | 23 Nov 2014 | 23 Nov 2014 | 23 Nov 2015 |
| 498 | chpbalikesir.info | GoDaddy.com, LLC | 23 Nov 2014 | 23 Nov 2014 | 23 Nov 2015 |
| 499 | chp2013-whp2013.com | GMO Internet Inc. | 24 Feb 2017 | 27 Mar 2017 | 24 Feb 2018 |
| 500 | chparklaw.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 501 | chpec.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 25 Jul 2024 | 25 Jul 2024 | 25 Jul 2025 |
| 502 | chpzz.com | Uniregistrar Corp | 8 Nov 2015 | 8 Nov 2015 | 8 Nov 2016 |
| 503 | chplideri.com | OnlineNIC, Inc. | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 504 | chplco.com | Vodien Internet Solutions Pte Ltd | 3 Apr 2016 | 5 Apr 2017 | 3 Apr 2018 |
| 505 | chpsor1dev0bkuhnqweg.com | GMO Internet Inc. | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 506 | chpcmtv.com | Eranet International Limited | 25 Apr 2022 | 2 Jun 2023 | 25 Apr 2023 |
| 507 | chpoubs.com | Gandi SAS | 14 Oct 2014 | 27 Sep 2024 | 14 Oct 2025 |
| 508 | chpproductions.com | GoDaddy.com, LLC | 14 Oct 2014 | 15 Oct 2016 | 14 Oct 2017 |
| 509 | chptrbit.us | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 13 Oct 2015 |
| 510 | chpyalova.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 511 | chpokov.com | EvoPlus Ltd. | 27 Mar 2018 | 27 Mar 2018 | 27 Mar 2019 |
| 512 | chplay-apk.com | GMO Internet Inc. | 7 Mar 2017 | 7 Mar 2017 | 7 Mar 2018 |
| 513 | chpinge.com | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 514 | chpinabox.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 515 | chpgg.com | GoDaddy.com, LLC | 2 Jan 2016 | 13 Dec 2023 | 2 Jan 2025 |
| 516 | chp-translations.com | Key-Systems GmbH | 17 Oct 2014 | 3 Oct 2016 | 17 Oct 2017 |
| 517 | chpbalikesir.org | GoDaddy.com, LLC | 23 Nov 2014 | 23 Nov 2014 | 23 Nov 2015 |
| 518 | chpokov.net | Domaincatcher LLC | 13 Jul 2018 | 14 Jul 2018 | 13 Jul 2019 |
| 519 | chpoki.net | Center of Ukrainian Internet Names dba UKRNAMES | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 520 | chplkerala.com | GoDaddy.com, LLC | 18 Oct 2014 | 28 Oct 2016 | 18 Oct 2018 |
| 521 | chplayviet.com | GMO Internet Inc. | 8 Apr 2016 | 8 Apr 2016 | 8 Apr 2017 |
| 522 | chpdyqhil.us | - | 24 Nov 2014 | - | 23 Nov 2015 |
| 523 | chpkj.com | Xin Net Technology Corporation | 4 Dec 2023 | 9 May 2024 | 4 Dec 2024 |
| 524 | chplindia.org | GoDaddy.com, LLC | 18 Oct 2014 | 28 Oct 2016 | 18 Oct 2018 |
| 525 | chpp.biz | Regional Network Information Center, JSC dba RU-CE… | 8 Oct 2009 | 11 Oct 2024 | 7 Oct 2025 |
| 526 | chpoxter.com | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2016 |
| 527 | chphgkhw.us | - | 25 Nov 2014 | - | 24 Nov 2015 |
| 528 | chpmilletvekiliadayadaylari.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 529 | chpankaramilletvekiliadaylari.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 530 | chpadayadaylari.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 531 | chpplans.com | GoDaddy.com, LLC | 10 Mar 2017 | 11 Mar 2024 | 10 Mar 2025 |
| 532 | chpmy.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Apr 2022 | 5 May 2024 | 3 Apr 2024 |
| 533 | chpmilletvekili.com | FBS Inc. | 28 Nov 2014 | 29 Nov 2014 | 28 Nov 2015 |
| 534 | chpgenelmerkezi.com | Ä°simtescil BiliÅŸim A.Åž. | 8 Dec 2022 | 20 Feb 2024 | 8 Dec 2023 |
| 535 | chprameditacion.com | GoDaddy.com, LLC | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 536 | chpllaw.com | GoDaddy.com, LLC | 1 Dec 2014 | 28 Nov 2022 | 1 Dec 2025 |
| 537 | chpgotomarket.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2017 |
| 538 | chpzls.net | GoDaddy.com, LLC | 26 Nov 2017 | 21 Oct 2023 | 26 Nov 2024 |
| 539 | chptechnologies.com | GoDaddy.com, LLC | 13 Apr 2019 | 7 May 2024 | 13 Apr 2025 |
| 540 | chp13aug.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 541 | chptaxcredits.com | DomainPeople, Inc. | 13 Sep 2011 | 4 Dec 2014 | 13 Sep 2016 |
| 542 | chpbftl.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2016 |
| 543 | chpoint24.com | 1API GmbH | 5 Dec 2014 | 8 Nov 2016 | 5 Dec 2018 |
| 544 | chpisco.com | PSI-USA, Inc. dba Domain Robot | 21 Aug 2023 | 21 Oct 2024 | 21 Aug 2024 |
| 545 | chpf1212.com | Shanghai Meicheng Technology Information Co., Ltd | 6 Dec 2014 | 22 Feb 2017 | 6 Dec 2016 |
| 546 | chp88.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 22 Oct 2021 | 21 Nov 2022 | 22 Oct 2022 |
| 547 | chpk.us | Tucows Domains Inc. | 5 Dec 2014 | 8 Dec 2015 | 4 Dec 2015 |
| 548 | chptatlisu.com | GoDaddy.com, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 549 | chpoultary.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Dec 2013 | 8 Dec 2014 | 7 Dec 2015 |
| 550 | chpie.com | Xin Net Technology Corporation | 1 Apr 2017 | 21 Feb 2024 | 1 Apr 2025 |
| 551 | chppowers.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 552 | chpflooring.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2022 | 9 Dec 2024 |
| 553 | chpall.com | - | 2 Dec 2022 | 3 Jan 2024 | 2 Dec 2023 |
| 554 | chpzx.com | PocketDomain.com Inc. | 27 Feb 2016 | 28 Feb 2016 | 27 Feb 2017 |
| 555 | chpxz.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Nov 2023 | 25 Oct 2024 | 23 Nov 2025 |
| 556 | chpbu.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 557 | chprusloans.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2016 |
| 558 | chpruscredit.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2016 |
| 559 | chpbu.info | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 560 | chpokman.com | 1&1 Internet AG | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 561 | chpr-international.com | GoDaddy.com, LLC | 30 Sep 2019 | 30 Sep 2019 | 30 Sep 2020 |
| 562 | chpbx.com | Beijing Lanhai Jiye Technology Co., Ltd | 18 May 2017 | 1 Nov 2024 | 18 May 2025 |
| 563 | chpvekilim.com | FBS Inc. | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 564 | chpvekil.com | FBS Inc. | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 565 | chpvekilim.net | FBS Inc. | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 566 | chpvekil.net | FBS Inc. | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 567 | chpciftlikkoy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 568 | chpodologia.com | Dinahosting s.l. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 569 | chpo.com | NameKing.com Inc. | 15 Nov 1996 | 14 Nov 2024 | 14 Nov 2024 |
| 570 | chp-nawa.com | GMO Internet Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 571 | chplaygame.com | DOMAIN NAME NETWORK PTY LTD | 30 Nov 2021 | 30 Nov 2021 | 30 Nov 2022 |
| 572 | chpscw.com | Hosting Concepts B.V. dba Openprovider | 1 Sep 2019 | 1 Sep 2019 | 1 Sep 2020 |
| 573 | chpmehmetarslan.com | IHS Telekom, Inc. | 22 Dec 2014 | 30 Dec 2016 | 22 Dec 2017 |
| 574 | chpantibank.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 575 | chpmehmetarslan.org | IHS Telekom, Inc. | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 576 | chpmehmetarslan.net | IHS Telekom, Inc. | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 577 | chpantiback.com | GoDaddy.com, LLC | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 578 | chping.com | GoDaddy.com, LLC | 8 Oct 2020 | 17 Sep 2024 | 8 Oct 2025 |
| 579 | chph-xsuu0vxhy.com | GMO Internet Inc. | 25 Dec 2014 | 25 Dec 2014 | 25 Dec 2015 |
| 580 | chpfk120.com | Xin Net Technology Corporation | 26 Dec 2014 | 24 Dec 2023 | 26 Dec 2024 |
| 581 | chpeixun.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 14 Jul 2024 | 14 Jul 2024 | 14 Jul 2025 |
| 582 | chpantibeok.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 583 | chpantibeek.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 584 | chpantibeck.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 585 | chpabuse.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 586 | chproadconditions.com | Tucows Domains Inc. | 24 Dec 2006 | 28 Dec 2014 | 24 Dec 2015 |
| 587 | chpbeykozgenc.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 588 | chpowerplus.com | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 589 | chpi1stop.com | MarkMonitor Inc. | 29 Dec 2014 | 27 Nov 2023 | 29 Dec 2025 |
| 590 | chpetsitters.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 591 | chpahmetkaya.com | IHS Telekom, Inc. | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 592 | chp1stop.com | MarkMonitor Inc. | 29 Dec 2014 | 27 Nov 2023 | 29 Dec 2025 |
| 593 | chpahmetkaya.org | IHS Telekom, Inc. | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 594 | chpahmetkaya.net | IHS Telekom, Inc. | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 595 | chp2012.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 13 Apr 2022 | 13 Jun 2023 | 13 Apr 2023 |
| 596 | chpple.com | Xiamen Nawang Technology Co., Ltd | 19 Feb 2019 | 19 Feb 2019 | 19 Feb 2020 |
| 597 | chpets.com | TurnCommerce, Inc. DBA NameBright.com | 2 Jan 2015 | 27 Dec 2020 | 2 Jan 2025 |
| 598 | chproductsupplier.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 599 | chpohio.com | GoDaddy.com, LLC | 4 Jan 2015 | 5 Jan 2020 | 4 Jan 2025 |
| 600 | chpetk.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 601 | chplastic.net | OpenTLD B.V. | 14 Apr 2021 | 28 Jun 2023 | 14 Apr 2023 |
| 602 | chplastic.xyz | Network Solutions, LLC | 19 Jul 2014 | 21 Jul 2014 | 19 Jul 2015 |
| 603 | chp-sf.xyz | Network Solutions, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 604 | chp-law.xyz | Network Solutions, LLC | 28 Jul 2014 | 29 Jul 2014 | 28 Jul 2015 |
| 605 | chpmail.xyz | Network Solutions, LLC | 23 Jul 2014 | 24 Jul 2014 | 23 Jul 2015 |
| 606 | chpsgf7.xyz | GMO Internet Inc. | 6 Aug 2014 | 6 Aug 2014 | 6 Aug 2015 |
| 607 | chpbiqfa.xyz | GMO Internet Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 608 | chp01.xyz | Xin Net Technology Corporation | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 609 | chpb.xyz | NameCheap, Inc. | 5 Nov 2021 | 5 Nov 2021 | 5 Nov 2022 |
| 610 | chpop.archi | Gandi SAS | 29 Sep 2014 | 25 Sep 2024 | 29 Sep 2025 |
| 611 | chpcny.nyc | Go China Domains, LLC | 8 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 612 | chpc.nyc | Go Montenegro Domains, LLC | 8 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 613 | chptn.xyz | GoDaddy.com, LLC | 13 Dec 2022 | 25 Dec 2023 | 13 Dec 2024 |
| 614 | chpqh.xyz | Todaynic.com Inc. | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2015 |
| 615 | chpkk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 616 | chpgestioncomercial.com | Tucows Domains Inc. | 11 Aug 2015 | 22 Oct 2023 | 11 Aug 2023 |
| 617 | chpcolombia.com | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 618 | chps.plumbing | Mesh Digital Limited | 7 Dec 2014 | 6 Jan 2017 | 7 Dec 2017 |
| 619 | chpm.top | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Mar 2016 | 8 Mar 2016 | 8 Mar 2017 |
| 620 | chpgwn.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jan 2015 | - | 1 Jan 2016 |
| 621 | chpno.red | GMO Internet Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 622 | chplay.xyz | NameCheap, Inc. | 1 Jul 2024 | 12 Jul 2024 | 1 Jul 2025 |
| 623 | chpadaylari.kim | FBS Inc. | 28 Jan 2015 | - | 28 Jan 2016 |
| 624 | chps.club | GoDaddy.com, LLC | 12 Feb 2015 | 9 Jun 2024 | 11 Feb 2025 |
| 625 | chpmilletvekiliadaylari.kim | FBS Inc. | 12 Mar 2015 | - | 12 Mar 2016 |
| 626 | chpaluche.club | 1&1 Internet AG | 20 Mar 2015 | 4 May 2024 | 19 Mar 2025 |
| 627 | chpwi.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Aug 2015 | 14 Aug 2015 | 13 Aug 2016 |
| 628 | chponto.com | - | - | - | - |
| 629 | chpmanrelo.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 630 | chpm.us | NameKing.com Inc. | 25 Aug 2022 | 24 Sep 2023 | 25 Aug 2023 |
| 631 | chplay-vn.org | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 632 | chpem.click | Xiamen Nawang Technology Co., Ltd | 13 Aug 2015 | - | 13 Aug 2016 |
| 633 | chpb7by.xyz | GMO Internet Inc. | 13 Apr 2015 | - | 13 Apr 2016 |
| 634 | chpcu.science | Alpnames Limited | 22 Apr 2015 | - | 21 Apr 2016 |
| 635 | chpbp.science | Alpnames Limited | 21 Apr 2015 | 21 Apr 2015 | 20 Apr 2016 |
| 636 | chpija.science | Alpnames Limited | 25 Apr 2015 | - | 24 Apr 2016 |
| 637 | chpj.science | Alpnames Limited | 23 Apr 2015 | - | 22 Apr 2016 |
| 638 | chpe.top | Foshan YiDong Network Co., LTD | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 639 | chpdyg.science | Alpnames Limited | 1 May 2015 | - | 30 Apr 2016 |
| 640 | chpdg.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 May 2015 | 5 May 2015 | 4 May 2016 |
| 641 | chpohio.net | GoDaddy.com, LLC | 4 Jan 2015 | 5 Jan 2023 | 4 Jan 2025 |
| 642 | chpmanedu.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 643 | chpmfg.com | 1&1 Internet AG | 6 Jan 2015 | 7 Jan 2017 | 6 Jan 2018 |
| 644 | chppf.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Dec 2015 | 7 Dec 2015 | 7 Dec 2016 |
| 645 | chppc.org | CloudFlare, Inc. | 16 Apr 2024 | 21 Apr 2024 | 16 Apr 2025 |
| 646 | chpf999.com | eNom663, Inc. | 1 Jun 2020 | 2 Jun 2020 | 1 Jun 2021 |
| 647 | chpt353mophgolfclassic.com | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 648 | chpp-pro.com | GMO Internet Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 649 | chpilbang.com | Gabia, Inc. | 23 Feb 2020 | 23 Feb 2020 | 23 Feb 2021 |
| 650 | chpgmrja.com | Xin Net Technology Corporation | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 651 | chpffotograaf.com | Cronon AG | 14 Aug 2015 | 3 Oct 2024 | 14 Aug 2025 |
| 652 | chpcs-totalwellness.com | Tucows Domains Inc. | 11 Aug 2010 | 15 Aug 2015 | 11 Aug 2016 |
| 653 | chptrade.com | Annulet LLC | 17 Aug 2005 | 4 Oct 2024 | 17 Aug 2025 |
| 654 | chpdor.com | Domain.com, LLC | 26 May 2006 | 10 Jan 2015 | 26 May 2015 |
| 655 | chpcin.com | Network Solutions, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 656 | chpakistan.com | 1&1 Internet AG | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 657 | chpisqe.org | GoDaddy.com, LLC | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2017 |
| 658 | chpmersinmilletvekilleri.com | IHS Telekom, Inc. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 659 | chpine.com | TurnCommerce, Inc. DBA NameBright.com | 10 Jan 2015 | 24 Feb 2020 | 10 Jan 2025 |
| 660 | chphysicaltherapy.info | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 661 | chpbbs.com | Xin Net Technology Corporation | 9 Jun 2017 | 13 Oct 2020 | 9 Jun 2021 |
| 662 | chp-store.com | Wild West Domains, LLC | 29 Aug 2018 | 29 Aug 2024 | 29 Aug 2025 |
| 663 | chpile.com | Xin Net Technology Corporation | 12 Jan 2015 | 16 Jan 2016 | 12 Jan 2017 |
| 664 | chperezbros.com | Key-Systems GmbH | 22 Jun 2023 | 4 Sep 2024 | 22 Jun 2024 |
| 665 | chpactiveandheathy.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 666 | chp-hamamatsu.com | Go Canada Domains, LLC | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2016 |
| 667 | chpfatih.org | Domain.com, LLC | 29 Aug 2005 | 10 Jan 2015 | 29 Aug 2015 |
| 668 | chpfrsale.com | Xin Net Technology Corporation | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 669 | chpbm.com | Web Commerce Communications Limited dba WebNic.cc | 14 Jan 2015 | 18 Apr 2016 | 14 Jan 2027 |
| 670 | chp-designs.com | GoDaddy.com, LLC | 18 Mar 2017 | 23 Mar 2024 | 18 Mar 2025 |
| 671 | chptbmm.com | Launchpad, Inc. | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 672 | chpromo.com | Xin Net Technology Corporation | 5 Apr 2021 | 31 Aug 2021 | 5 Apr 2022 |
| 673 | chpaliengin.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 674 | chpforum.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 675 | chpshop.xyz | Realtime Register B.V. | 15 Aug 2015 | 15 Aug 2015 | 15 Aug 2016 |
| 676 | chpeyup.info | GoDaddy.com, LLC | 15 Aug 2015 | - | 15 Aug 2016 |
| 677 | chpeyup.com | TurnCommerce, Inc. DBA NameBright.com | 2 Nov 2017 | 27 Oct 2020 | 2 Nov 2024 |
| 678 | chp-mehmetyilmaz.com | FBS Inc. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 679 | chpqntqg.us | - | 13 Jan 2015 | - | 12 Jan 2016 |
| 680 | chppom.webcam | Alpnames Limited | 13 May 2015 | 13 May 2015 | 12 May 2016 |
| 681 | chpqt.party | Alpnames Limited | 17 May 2015 | - | 16 May 2016 |
| 682 | chpfxp.party | Alpnames Limited | 26 May 2015 | - | 25 May 2016 |
| 683 | chpxce.party | Alpnames Limited | 25 May 2015 | - | 24 May 2016 |
| 684 | chpjk.party | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 May 2015 | - | 23 May 2016 |
| 685 | chp4.city | 1&1 Internet AG | 29 May 2015 | 13 Jul 2024 | 29 May 2025 |
| 686 | chp4.london | 1&1 Internet AG | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 687 | chph837tf.click | GMO Internet Inc. | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 688 | chpx.wang | eName Technology Co., Ltd. | 1 Jul 2015 | 22 Nov 2016 | 1 Jul 2018 |
| 689 | chptnboots.com | Hongkong Domain Name Information Management Co., L… | 2 Nov 2022 | 12 Dec 2023 | 2 Nov 2023 |
| 690 | chprotect.com | DNSPod, Inc. | 21 Jul 2021 | 21 Jul 2021 | 21 Jul 2022 |
| 691 | chpcity.com | TurnCommerce, Inc. DBA NameBright.com | 9 Sep 2022 | 20 Oct 2024 | 9 Sep 2024 |
| 692 | chp101.com | GoDaddy.com, LLC | 5 Jan 2021 | 29 Dec 2023 | 5 Jan 2025 |
| 693 | chpuk.space | Xin Net Technology Corporation | 9 Jul 2015 | - | 9 Jul 2016 |
| 694 | chpzj.click | Uniregistrar Corp | 17 Jul 2015 | 17 Jul 2015 | 17 Jul 2016 |
| 695 | chpmb.click | Uniregistrar Corp | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 696 | chpo.faith | Alpnames Limited | 28 Jul 2015 | - | 27 Jul 2016 |
| 697 | chpybh.date | Alpnames Limited | 4 Aug 2015 | - | 3 Aug 2016 |
| 698 | chpccn.review | Alpnames Limited | 4 Aug 2015 | - | 3 Aug 2016 |
| 699 | chpxg.date | Alpnames Limited | 6 Aug 2015 | - | 5 Aug 2016 |
| 700 | chpzn.com | Tucows Domains Inc. | 17 Jan 2015 | 21 Jan 2023 | 17 Jan 2023 |
| 701 | chph-holding.com | Limited Liability Company "Registrar of domain nam… | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 702 | chpetz.com | Shanghai Meicheng Technology Information Co., Ltd | 18 Jan 2015 | 20 Dec 2016 | 18 Jan 2019 |
| 703 | chpaneho.org | eNom, Inc. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 704 | chp-mehmetyilmaz.net | FBS Inc. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 705 | chpaboston.org | Tucows Domains Inc. | 13 Aug 2004 | 17 Aug 2015 | 13 Aug 2016 |
| 706 | chpsecim.com | IHS Telekom, Inc. | 30 Apr 2023 | 1 May 2024 | 30 Apr 2025 |
| 707 | chpgenelsecim.com | GoDaddy.com, LLC | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 708 | chpk.org | CSC Corporate Domains, Inc. | 27 Sep 2023 | 23 Sep 2024 | 27 Sep 2025 |
| 709 | chpbeykozgenc.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 18 Jan 2015 | - | 18 Jan 2016 |
| 710 | chpde.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 9 Nov 2024 | 9 Nov 2024 | 9 Nov 2025 |
| 711 | chpyy.com | Namesilo, LLC | 1 Nov 2020 | 1 Nov 2020 | 1 Nov 2021 |
| 712 | chpanetwork.com | Network Solutions, LLC | 24 Jan 2015 | 5 Nov 2019 | 24 Jan 2025 |
| 713 | chpde.net | HiChina Zhicheng Technology Limited | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 714 | chptr4.com | Webfusion Ltd. | 11 Oct 2017 | 11 Oct 2017 | 11 Oct 2019 |
| 715 | chprz.com | Network Solutions, LLC | 27 Jan 2015 | 27 Nov 2022 | 27 Jan 2025 |
| 716 | chplihaber.com | FBS Inc. | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 717 | chplibelediyeler.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 16 Oct 2024 | 16 Oct 2024 | 16 Oct 2025 |
| 718 | chplans.com | - | 11 Mar 2023 | 12 Apr 2024 | 11 Mar 2024 |
| 719 | chpeco.com | register.com, Inc. | 1 Oct 2018 | 1 Oct 2018 | 1 Oct 2019 |
| 720 | chpdpoa.com | Launchpad, Inc. | 16 Mar 2018 | 16 Mar 2018 | 16 Mar 2019 |
| 721 | chpbagcilar.com | FBS Inc. | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2016 |
| 722 | chpabogados.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jan 2015 | 26 Jan 2015 | 26 Jan 2016 |
| 723 | chp-2014.com | Tucows Domains Inc. | 23 Jan 2014 | 27 Jan 2015 | 23 Jan 2016 |
| 724 | chplibelediyeler.org | FBS Inc. | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 725 | chprs.org | Tucows Domains Inc. | 20 Jan 2014 | 24 Jan 2015 | 20 Jan 2016 |
| 726 | chpsanliurfa.org | OnlineNIC, Inc. | 20 Jan 2015 | 20 Jan 2015 | 20 Jan 2016 |
| 727 | chpmd.org | Tucows Domains Inc. | 20 Jan 2015 | 22 Feb 2017 | 20 Jan 2018 |
| 728 | chplus.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Nov 2021 | 7 Jan 2024 | 8 Nov 2023 |
| 729 | chpmsk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 730 | chpsevkiyilmaz.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 731 | chpride.com | GoDaddy.com, LLC | 28 Jan 2015 | 29 Jan 2023 | 28 Jan 2025 |
| 732 | chpistanbuladaylari.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 733 | chpatw.org | Net-Chinese Co., Ltd. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 734 | chp-2014.org | Tucows Domains Inc. | 23 Jan 2014 | 27 Jan 2015 | 23 Jan 2016 |
| 735 | chpyesor.com | Hangzhou AiMing Network Co., LTD | 9 Jul 2019 | 9 Jul 2019 | 9 Jul 2020 |
| 736 | chpig.com | - | 13 Apr 2023 | 14 Apr 2024 | 13 Apr 2025 |
| 737 | chpartner.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 30 Jan 2015 | 1 Jan 2023 | 30 Jan 2025 |
| 738 | chp2023.com | Google, Inc. | 26 May 2023 | 26 Jul 2024 | 26 May 2024 |
| 739 | chp2023.org | GoDaddy.com, LLC | 30 Jul 2023 | 10 Sep 2024 | 30 Jul 2024 |
| 740 | chpatw.net | Net-Chinese Co., Ltd. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 741 | chpcc.party | Alpnames Limited | 10 May 2015 | 10 May 2015 | 9 May 2016 |
| 742 | chph.science | Alpnames Limited | 9 May 2015 | - | 8 May 2016 |
| 743 | chpccs.party | Alpnames Limited | 12 May 2015 | - | 11 May 2016 |
| 744 | chpkayseri.com | Cloud Yuqu LLC | 22 Feb 2021 | 22 Feb 2021 | 22 Feb 2022 |
| 745 | chpmagazine.org | GoDaddy.com, LLC | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 746 | chpert.net | Realtime Register B.V. | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2017 |
| 747 | chpyeoyver.com | 1&1 Internet AG | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 748 | chpsk8.com | GoDaddy.com, LLC | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2017 |
| 749 | chpkongreleri.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Aug 2015 | 19 Oct 2015 | 19 Aug 2017 |
| 750 | chpftwin.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 751 | chpyeoyver.org | 1&1 Internet AG | 1 Feb 2015 | 2 Feb 2015 | 1 Feb 2016 |
| 752 | chpyeoyver.net | 1&1 Internet AG | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 753 | chpgenckanat.org | Nics Telekomünikasyon Ticaret Ltd. Şti. | 1 Feb 2015 | - | 1 Feb 2016 |
| 754 | chplay88.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 755 | chpcfriends.us | NameCheap, Inc. | 2 Feb 2015 | 9 Dec 2016 | 1 Feb 2020 |
| 756 | chpcfriends.org | eNom, Inc. | 2 Feb 2015 | 11 May 2016 | 2 Feb 2020 |
| 757 | chptech.com | TurnCommerce, Inc. DBA NameBright.com | 22 Aug 2021 | 16 Aug 2022 | 22 Aug 2025 |
| 758 | chpkepez.com | DropCatch.com 891 LLC | 23 Apr 2016 | 24 Apr 2017 | 23 Apr 2018 |
| 759 | chpk9academy.com | GoDaddy.com, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 760 | chpbakioglu.com | FBS Inc. | 4 Feb 2015 | 19 May 2017 | 4 Feb 2018 |
| 761 | chparchive.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 762 | chpmahmutlar.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 763 | chphd.com | Xin Net Technology Corporation | 6 Jun 2019 | 9 May 2024 | 6 Jun 2025 |
| 764 | chpep.com | DropCatch.com 537 LLC | 13 Apr 2018 | 13 Apr 2018 | 13 Apr 2019 |
| 765 | chpad.com | TurnCommerce, Inc. DBA NameBright.com | 13 Apr 2018 | 7 Apr 2021 | 13 Apr 2025 |
| 766 | chpkepez.org | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 767 | chpkepez.net | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 768 | chpkepez.info | GoDaddy.com, LLC | 4 Feb 2015 | - | 4 Feb 2016 |
| 769 | chpbakioglu.org | FBS Inc. | 4 Feb 2015 | 19 May 2017 | 4 Feb 2018 |
| 770 | chpbakioglu.net | FBS Inc. | 4 Feb 2015 | 19 May 2017 | 4 Feb 2018 |
| 771 | chpdursunbulut.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 772 | chpolh.us | - | 6 Feb 2015 | - | 5 Feb 2016 |
| 773 | chpiledegisimzamani.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 774 | chphacettepe.org | - | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2017 |
| 775 | chphacettepe.com | - | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2017 |
| 776 | chpgcompanies.com | CSC Corporate Domains, Inc. | 9 Feb 2015 | 5 Feb 2024 | 9 Feb 2025 |
| 777 | chplays.net | GMO Internet Inc. | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 778 | chpfeiffer.net | Tucows Domains Inc. | 3 Jun 2024 | 2 Jul 2024 | 3 Jun 2025 |
| 779 | chparkerplumbing.com | Register.it SPA | 10 Feb 2015 | 10 Feb 2024 | 10 Feb 2025 |
| 780 | chparkerplumbers.com | Register.it SPA | 30 Mar 2016 | 24 Mar 2016 | 10 Feb 2018 |
| 781 | chparker-plumbing.com | Register.it SPA | 30 Mar 2016 | 24 Mar 2016 | 10 Feb 2018 |
| 782 | chparker-plumbers.com | Register.it SPA | 30 Mar 2016 | 24 Mar 2016 | 10 Feb 2018 |
| 783 | chpsrecipes.com | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2024 | 12 Feb 2025 |
| 784 | chprecipes.com | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2024 | 12 Feb 2025 |
| 785 | chplay.mobi | Namesilo, LLC | 11 Sep 2023 | 11 Sep 2024 | 11 Sep 2025 |
| 786 | chpcerkezkoy.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 787 | chps.biz | GoDaddy.com, LLC | 12 Feb 2015 | 26 Jun 2024 | 11 Feb 2025 |
| 788 | chpsrecipes.net | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2024 | 12 Feb 2025 |
| 789 | chpsrecipes.info | GoDaddy.com, LLC | 12 Feb 2015 | 7 Jul 2024 | 12 Feb 2025 |
| 790 | chproduktion.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 12 Feb 2015 | 30 Dec 2022 | 12 Feb 2025 |
| 791 | chprecipes.net | GoDaddy.com, LLC | 12 Feb 2015 | 12 Feb 2024 | 12 Feb 2025 |
| 792 | chprecipes.info | GoDaddy.com, LLC | 12 Feb 2015 | 7 Jul 2024 | 12 Feb 2025 |
| 793 | chpofohio.com | GoDaddy.com, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2017 |
| 794 | chpsrecipes.org | GoDaddy.com, LLC | 12 Feb 2015 | 8 Jul 2024 | 12 Feb 2025 |
| 795 | chprecipes.org | GoDaddy.com, LLC | 12 Feb 2015 | 8 Jul 2024 | 12 Feb 2025 |
| 796 | chpservicesllc.com | GoDaddy.com, LLC | 13 Feb 2015 | 22 Feb 2024 | 13 Feb 2026 |
| 797 | chps.us | GoDaddy.com, LLC | 12 Feb 2015 | 17 Feb 2024 | 11 Feb 2025 |
| 798 | chphomesllc.com | GoDaddy.com, LLC | 13 Feb 2015 | 25 Feb 2024 | 13 Feb 2025 |
| 799 | chpsslab.com | FastDomain Inc. | 14 Feb 2015 | 30 Jan 2024 | 14 Feb 2025 |
| 800 | chpitsale.com | Xin Net Technology Corporation | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2016 |
| 801 | chpstanding.com | GoDaddy.com, LLC | 8 Jul 2019 | 8 Jul 2019 | 8 Jul 2020 |
| 802 | chpwexposaz.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 803 | chplunk.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Feb 2024 | 27 Feb 2024 | 26 Feb 2025 |
| 804 | chpkns.com | eNom, Inc. | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 805 | chpii.com | GoDaddy.com, LLC | 26 Aug 2019 | 25 Sep 2024 | 26 Aug 2025 |
| 806 | chpicturesblog.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 807 | chpcup.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 808 | chpahmetgokalp.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 809 | chpadaylari2015.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 810 | chpnurtepe.com | FBS Inc. | 19 Feb 2015 | 20 Feb 2015 | 19 Feb 2016 |
| 811 | chpkirsehir.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 812 | chpbeylikduzu.com | DropCatch.com 696 LLC | 19 Feb 2015 | 20 Feb 2017 | 19 Feb 2018 |
| 813 | chpukg.com | Network Solutions, LLC | 18 Feb 2014 | 20 Feb 2015 | 18 Feb 2016 |
| 814 | chpotatostarch.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 May 2024 | 29 May 2024 | 28 May 2027 |
| 815 | chpv.org | FastDomain Inc. | 17 Jan 2012 | 6 Jan 2024 | 17 Jan 2025 |
| 816 | chpadaylari.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Apr 2018 | 30 Apr 2018 | 30 Apr 2019 |
| 817 | chpsecimanketi.com | IHS Telekom, Inc. | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2016 |
| 818 | chphuzurevleri.com | FBS Inc. | 21 Feb 2015 | 19 May 2017 | 21 Feb 2018 |
| 819 | chpeskisehir.com | Realtime Register B.V. | 9 Feb 2024 | 14 Feb 2024 | 9 Feb 2025 |
| 820 | chptraining.net | Tucows Domains Inc. | 17 Feb 2014 | 21 Feb 2015 | 17 Feb 2016 |
| 821 | chptp.com | TurnCommerce, Inc. DBA NameBright.com | 23 Jan 2018 | 17 Jan 2021 | 23 Jan 2025 |
| 822 | chpch.org | GoDaddy.com, LLC | 22 Aug 2015 | 6 Oct 2024 | 22 Aug 2025 |
| 823 | chpsecimleri.com | FBS Inc. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 824 | chprd.com | Xiamen ChinaSource Internet Service Co., Ltd. | 13 Apr 2023 | 13 Apr 2023 | 13 Apr 2025 |
| 825 | chportillo.com | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 826 | chpxj.com | HiChina Zhicheng Technology Limited | 24 Jan 2016 | 24 Jan 2016 | 24 Jan 2017 |
| 827 | chp2014blog.com | Tucows Domains Inc. | 21 Feb 2014 | 25 Feb 2015 | 21 Feb 2016 |
| 828 | chpcenterma.org | OnlineNIC, Inc. | 10 May 2016 | 28 Apr 2017 | 10 May 2018 |
| 829 | chpwv.com | Domain.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 830 | chpgenclik.org | Ä°simtescil BiliÅŸim A.Åž. | 7 Nov 2024 | 7 Nov 2024 | 7 Nov 2025 |
| 831 | chpetgifts.com | Tucows Domains Inc. | 23 Feb 2009 | 27 Feb 2015 | 23 Feb 2016 |
| 832 | chp-bilecik.com | OVH sas | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 833 | chpwatches.com | Heavydomains.net LLC | 23 Jul 2017 | 24 Jul 2017 | 23 Jul 2018 |
| 834 | chprodevents.com | Gandi SAS | 1 Mar 2015 | 29 Jan 2017 | 1 Mar 2018 |
| 835 | chp-travel.com | 1API GmbH | 18 Aug 2019 | 18 Aug 2019 | 18 Aug 2020 |
| 836 | chphi.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Apr 2023 | 10 Jun 2024 | 9 Apr 2024 |
| 837 | chpay.net | HiChina Zhicheng Technology Limited | 3 Jan 2018 | 1 Jan 2023 | 3 Jan 2025 |
| 838 | chptrvdt.com | eNom, Inc. | 11 May 2020 | 11 May 2020 | 11 May 2021 |
| 839 | chplayapk.com | Domainhysteria.com LLC | 26 Jan 2024 | 13 Sep 2024 | 26 Jan 2025 |
| 840 | chpmc.com | P.A. Viet Nam Company Limited | 26 Sep 2024 | 26 Sep 2024 | 26 Sep 2025 |
| 841 | chpgulsoysuren.com | - | - | - | - |
| 842 | chplayandroid.net | NameCheap, Inc. | 12 May 2020 | - | 12 May 2021 |
| 843 | chp12.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 844 | chproduccionlatin.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 845 | chpianos.com | Tucows Domains Inc. | 12 Feb 2009 | 14 Feb 2024 | 12 Feb 2025 |
| 846 | chpxedq.com | Network Solutions, LLC | 4 Mar 2014 | 6 Mar 2015 | 4 Mar 2016 |
| 847 | chpcpa.com | Wild West Domains, LLC | 6 Mar 2015 | 7 Mar 2023 | 6 Mar 2025 |
| 848 | chporgutgucu.com | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 849 | chpizmiradaylari.com | FBS Inc. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 850 | chpizmiradayadaylari.com | FBS Inc. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 851 | chpgtr.com | Network Solutions, LLC | 5 Mar 2014 | 7 Mar 2015 | 5 Mar 2016 |
| 852 | chpradio.com | Tucows Domains Inc. | 4 Mar 2014 | 8 Mar 2015 | 4 Mar 2016 |
| 853 | chpcja.com | Tucows Domains Inc. | 4 Mar 2013 | 3 Feb 2024 | 4 Mar 2025 |
| 854 | chpbizim.com | DropCatch.com 570 LLC | 25 May 2017 | 16 Jul 2017 | 25 May 2018 |
| 855 | chplay36.com | Koreacenter.com co., Ltd. | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2019 |
| 856 | chpileri.org | Reg2C.com Inc. | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 857 | chpaintglobal.com | CloudFlare, Inc. | 10 Mar 2015 | 7 Oct 2024 | 10 Mar 2026 |
| 858 | chporgutgucu.org | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 859 | chpbizim.org | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 860 | chpbizim.net | GoDaddy.com, LLC | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 861 | chpbizim.info | GoDaddy.com, LLC | 7 Mar 2015 | - | 7 Mar 2016 |
| 862 | chppendik.com | GoDaddy.com, LLC | 17 Aug 2017 | 5 Jun 2024 | 17 Aug 2025 |
| 863 | chpvp.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 864 | chpga.com | HiChina Zhicheng Technology Limited | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 865 | chpkocaeli.com | - | 10 Mar 2024 | 11 Mar 2024 | 10 Mar 2025 |
| 866 | chpebnn.biz | GMO Internet Inc. | 12 Mar 2015 | 12 Mar 2015 | 11 Mar 2016 |
| 867 | chptpbu.com | Tucows Domains Inc. | 10 Mar 2014 | 14 Mar 2015 | 10 Mar 2016 |
| 868 | chpadaylaricanliyayinda.com | FBS Inc. | 13 Mar 2015 | 13 Mar 2015 | 13 Mar 2016 |
| 869 | chpga.net | HiChina Zhicheng Technology Limited | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 870 | chpxy.com | - | 11 Aug 2023 | 13 Oct 2024 | 11 Aug 2024 |
| 871 | chpropertycareandmaintenance.com | Network Solutions, LLC | 14 Mar 2015 | 1 Apr 2017 | 14 Mar 2018 |
| 872 | chpropertiesrealestate.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2017 |
| 873 | chprocess.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 874 | chplay.top | NameCheap, Inc. | 26 Nov 2016 | 26 Nov 2016 | 26 Nov 2017 |
| 875 | chphoto.org | Tucows Domains Inc. | 15 Feb 2021 | 5 Feb 2024 | 15 Feb 2025 |
| 876 | chpurgup.com | FBS Inc. | 15 Mar 2015 | 15 Mar 2015 | 15 Mar 2017 |
| 877 | chpttg.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 11 Mar 2014 | 15 Mar 2015 | 11 Mar 2016 |
| 878 | chpaimai8.com | eNom, Inc. | 21 Dec 2016 | 22 Nov 2023 | 21 Dec 2024 |
| 879 | chpok.net | CommuniGal Communication Ltd. | 29 Mar 2024 | 30 Mar 2024 | 29 Mar 2025 |
| 880 | chpshowcase.com | GoDaddy.com, LLC | 16 Mar 2015 | 30 Mar 2024 | 16 Mar 2025 |
| 881 | chpaydinsecim.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 882 | chppp.com | Dynadot, LLC | 25 May 2016 | 4 Jul 2024 | 25 May 2024 |
| 883 | chpeishi.com | 1API GmbH | 18 Mar 2015 | 1 May 2024 | 18 Mar 2024 |
| 884 | chpagwatch.com | Web Commerce Communications Limited dba WebNic.cc | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2025 |
| 885 | chpiktidara.com | GoDaddy.com, LLC | 18 Mar 2015 | 19 Mar 2015 | 18 Mar 2016 |
| 886 | chpauto.com | GoDaddy.com, LLC | 18 Mar 2015 | 19 Mar 2024 | 18 Mar 2025 |
| 887 | chpainting.com | Dynadot, LLC | 2 Mar 2023 | 28 Mar 2024 | 2 Mar 2025 |
| 888 | chpcb.net | Santiamdomains.com LLC | 4 Nov 2017 | 5 Nov 2017 | 4 Nov 2018 |
| 889 | chpshp.com | Google, Inc. | 11 Nov 2017 | 27 Oct 2024 | 11 Nov 2025 |
| 890 | chpbelediyeleri.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 9 Apr 2019 | 7 Apr 2024 | 9 Apr 2025 |
| 891 | chpsecimtakip.com | IHS Telekom, Inc. | 20 Mar 2015 | 21 Mar 2015 | 20 Mar 2016 |
| 892 | chpoe.com | HiChina Zhicheng Technology Limited | 7 Nov 2019 | 8 Nov 2019 | 7 Nov 2020 |
| 893 | chpmaltepe.com | GMO Internet Inc. | 30 Jul 2024 | 30 Jul 2024 | 30 Jul 2025 |
| 894 | chpaluche.com | 1&1 Internet AG | 20 Mar 2015 | 6 Mar 2018 | 20 Mar 2025 |
| 895 | chp239.com | 1API GmbH | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 896 | chpwa.org | GoDaddy.com, LLC | 26 Aug 2015 | 12 Aug 2024 | 26 Aug 2025 |
| 897 | chprotraining.com | GoDaddy.com, LLC | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 898 | chpaliaga.org | IHS Telekom, Inc. | 19 Mar 2015 | 19 May 2015 | 19 Mar 2019 |
| 899 | chpzs.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Dec 2021 | 28 Feb 2024 | 27 Dec 2023 |
| 900 | chpafyon.com | Network Solutions, LLC | 26 Jul 2019 | 26 Jul 2019 | 26 Jul 2020 |
| 901 | chpchp.com | OnlineNIC, Inc. | 7 Aug 2020 | 20 Aug 2020 | 7 Aug 2021 |
| 902 | chpshzx.com | GMO Internet Inc. | 2 Oct 2024 | 4 Oct 2024 | 2 Oct 2025 |
| 903 | chp3.com | TurnCommerce, Inc. DBA NameBright.com | 22 Mar 2015 | 16 Mar 2021 | 22 Mar 2025 |
| 904 | chpedu.com | DropCatch.com 1430 LLC | 1 Nov 2023 | 7 Nov 2024 | 1 Nov 2024 |
| 905 | chphotographer.com | 35 Technology Co., Ltd. | 14 Jul 2022 | 22 Aug 2023 | 14 Jul 2023 |
| 906 | chpajx.com | HiChina Zhicheng Technology Limited | 26 Mar 2015 | 25 Mar 2017 | 26 Mar 2018 |
| 907 | chpmuftuoglu.com | FBS Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 908 | chpt.info | GoDaddy.com, LLC | 27 Aug 2021 | 28 Aug 2021 | 27 Aug 2022 |
| 909 | chpmersin.net | Namesilo, LLC | 22 Mar 2015 | 23 Apr 2019 | 22 Mar 2020 |
| 910 | chpadayadaylari.org | Reg2C.com Inc. | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 911 | chpt4.com | Webfusion Ltd. | 6 Jun 2021 | 6 Jun 2021 | 6 Jun 2022 |
| 912 | chpool.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 913 | chpgsportsmed.org | Network Solutions, LLC | 27 Aug 2015 | 17 Jul 2017 | 27 Aug 2018 |
| 914 | chpgsportsmed.com | Network Solutions, LLC | 27 Aug 2015 | 17 Jul 2017 | 27 Aug 2018 |
| 915 | chpersonalizados.com | Universo Online S/A (UOL) | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 916 | chptransportes.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 917 | chprat.com | GMO Internet Inc. | 27 Mar 2015 | 12 Mar 2017 | 27 Mar 2018 |
| 918 | chpmh.com | MAFF Inc. | 8 Apr 2022 | 17 Jun 2023 | 8 Apr 2023 |
| 919 | chpankaragenclik.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 920 | chpankaragenc.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 921 | chpmotorsports.net | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 922 | chpsurgery.com | GoDaddy.com, LLC | 29 Mar 2015 | 30 Mar 2024 | 29 Mar 2025 |
| 923 | chppoc.net | Network Solutions, LLC | 27 Mar 2015 | 26 Jan 2023 | 27 Mar 2028 |
| 924 | chpropertiesinvestments.com | GoDaddy.com, LLC | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2020 |
| 925 | chpheatrecovery.com | Online SAS | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 926 | chpfireprotection.com | LCN.COM Ltd. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 927 | chp-coach.com | Cronon AG | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2018 |
| 928 | chpnge.net | TPP Wholesale Pty Ltd. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 929 | chpearce.net | GoDaddy.com, LLC | 30 Mar 2015 | 1 Apr 2024 | 30 Mar 2027 |
| 930 | chpyc.com | TravelDomains, Incorporated | 28 Dec 2022 | 10 Feb 2024 | 28 Dec 2023 |
| 931 | chpgov.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 1 Apr 2022 | 1 May 2023 | 1 Apr 2023 |
| 932 | chpxw.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Oct 2020 | 23 Oct 2020 | 23 Oct 2021 |
| 933 | chpaltindag.org | FBS Inc. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 934 | chppayment.com | GMO Internet Inc. | 28 Aug 2015 | 29 Jul 2017 | 28 Aug 2018 |
| 935 | chplaygame.net | GoDaddy.com, LLC | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 936 | chpdl.racing | Xiamen Nawang Technology Co., Ltd | 28 Aug 2015 | - | 27 Aug 2016 |
| 937 | chpbh.com | Web Commerce Communications Limited dba WebNic.cc | 5 Jan 2020 | 5 Jan 2020 | 5 Jan 2021 |
| 938 | chpavinginc.com | Melbourne IT, Ltd | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 939 | chpretro.com | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 940 | chpmunk.com | GoDaddy.com, LLC | 3 Apr 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 941 | chpraip.us | - | 2 Apr 2015 | - | 1 Apr 2016 |
| 942 | chpdeal.com | Network Solutions, LLC | 5 Apr 2015 | 5 Apr 2015 | 5 Apr 2016 |
| 943 | chpstudiolive.com | Network Solutions, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2017 |
| 944 | chpatterson.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 945 | chpl.london | GoDaddy.com, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 946 | chpinax.com | HiChina Zhicheng Technology Limited | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 947 | chpmphilly.com | GoDaddy.com, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2017 |
| 948 | chpre.com | TurnCommerce, Inc. DBA NameBright.com | 30 Aug 2015 | 15 Sep 2023 | 13 Oct 2024 |
| 949 | chpprotective.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 950 | chpinhui.net | eName Technology Co., Ltd. | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2016 |
| 951 | chpinhui.com | eName Technology Co., Ltd. | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2016 |
| 952 | chpindemnity.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 953 | chpin.net | eName Technology Co., Ltd. | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2016 |
| 954 | chpforlife.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 955 | chpbhg.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 956 | chpberkshireinsurance.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 957 | chpberkshire.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 958 | chpaccidentandhealth.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 959 | chpaandh.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 960 | chp4life.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2017 |
| 961 | chp-goes-green.info | Dynadot, LLC | 22 Jan 2020 | 22 Mar 2020 | 22 Jan 2021 |
| 962 | chpulpit.com | HiChina Zhicheng Technology Limited | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 963 | chpap6gh3t.com | GMO Internet Inc. | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 964 | chpsisli.com | IHS Telekom, Inc. | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 965 | chpfxk.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 966 | chp9s5.net | GMO Internet Inc. | 18 Jun 2014 | 8 Apr 2015 | 18 Jun 2015 |
| 967 | chpshy.com | HiChina Zhicheng Technology Limited | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2018 |
| 968 | chp-2014.biz | eNom, Inc. | 10 Apr 2015 | 10 Apr 2015 | 9 Apr 2016 |
| 969 | chpmku.com | GoDaddy.com, LLC | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 970 | chpcigar.com | eNombre Corporation | 12 Nov 2018 | 13 Nov 2018 | 12 Nov 2019 |
| 971 | chpgdq.com | Beijing Lanhai Jiye Technology Co., Ltd | 18 Jun 2022 | 19 Jun 2024 | 18 Jun 2025 |
| 972 | chp11-99luau.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Apr 2015 | 21 Mar 2017 | 10 Apr 2018 |
| 973 | chpwsale.info | GoDaddy.com, LLC | 4 Sep 2015 | - | 4 Sep 2016 |
| 974 | chprovisions.com | - | - | - | - |
| 975 | chpmemorialwallfoundation.org | Name.com, Inc. | 5 Sep 2015 | 19 Aug 2024 | 5 Sep 2025 |
| 976 | chpmemorialwallfoundation.com | Name.com, Inc. | 5 Sep 2015 | 14 Aug 2024 | 5 Sep 2025 |
| 977 | chpdyes.com | Google, Inc. | 4 Sep 2015 | 4 Nov 2024 | 4 Sep 2024 |
| 978 | chpmemorialwall.foundation | Name.com, Inc. | 5 Sep 2015 | 19 Aug 2024 | 5 Sep 2025 |
| 979 | chpj168.com | Shanghai Meicheng Technology Information Co., Ltd | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 980 | chpurla.com | IHS Telekom, Inc. | 3 Dec 2023 | 2 Feb 2024 | 3 Dec 2024 |
| 981 | chptijuana.com | GoDaddy.com, LLC | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2016 |
| 982 | chpzl.com | HiChina Zhicheng Technology Limited | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 983 | chpyb.com | HiChina Zhicheng Technology Limited | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 984 | chpodiatry.com | Tucows Domains Inc. | 13 Apr 2010 | 17 Apr 2015 | 13 Apr 2016 |
| 985 | chphealth.com | GoDaddy.com, LLC | 16 Apr 2015 | 22 Aug 2024 | 16 Apr 2025 |
| 986 | chp-sa.org | GoDaddy.com, LLC | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 987 | chp-sa.info | GoDaddy.com, LLC | 5 Sep 2015 | - | 5 Sep 2016 |
| 988 | chprize.com | GMO Internet Inc. | 29 Nov 2019 | 29 Nov 2019 | 29 Nov 2020 |
| 989 | chpgultepe.com | FBS Inc. | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 990 | chpbank.com | TLD Registrar Solutions Ltd. | 29 Nov 2023 | 4 Feb 2024 | 29 Nov 2024 |
| 991 | chpshop.com | GoDaddy.com, LLC | 13 Mar 2024 | 13 Mar 2024 | 13 Mar 2029 |
| 992 | chp360.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jul 2017 | 6 Jul 2017 | 6 Jul 2018 |
| 993 | chpeguy.net | GoDaddy.com, LLC | 6 Sep 2015 | 30 Aug 2024 | 6 Sep 2025 |
| 994 | chpshop.net | HiChina Zhicheng Technology Limited | 19 Apr 2015 | 19 Apr 2015 | 19 Apr 2016 |
| 995 | chp360.net | HiChina Zhicheng Technology Limited | 19 Apr 2015 | 19 Apr 2015 | 19 Apr 2016 |
| 996 | chpcenterse.org | NameCheap, Inc. | 21 Oct 2024 | 21 Oct 2024 | 21 Oct 2025 |
| 997 | chp-health.org | Porkbun, LLC | 3 Sep 2023 | 16 Nov 2024 | 3 Sep 2024 |
| 998 | chpt8.com | Realtime Register B.V. | 2 Jan 2020 | 2 Jan 2020 | 2 Jan 2021 |
| 999 | chpscotland.com | 1&1 Internet AG | 1 Jul 2024 | 1 Jul 2024 | 1 Jul 2025 |
| 1000 | chproyectos.com | Metaregistrar BV Applications | 10 Mar 2024 | 15 Mar 2024 | 10 Mar 2025 |
Displaying 1,000 out of 11,830 domains starting with the keyword "CHP". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=chp
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |