Keyword: CLEANSWEEPCHIMNEYSERVICES
Reverse Whois » KEYWORD [cleansweepchimneyservices ] { 7 domain names }
Num | Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|---|
1 | cleansweepchimneyservices.biz | NameCheap, Inc. | 28 Sep 2021 | 6 Sep 2024 | 28 Sep 2025 |
2 | cleansweepchimneyservices.com | Dynadot, LLC | 18 Dec 2023 | 28 Feb 2025 | 18 Dec 2024 |
3 | cleansweepchimneyservices.co.uk | - | 30 Apr 2009 | 1 Sep 2024 | 30 Apr 2025 |
4 | cleansweepchimneyservices.shop | Hostinger, UAB | 4 Feb 2025 | 4 Feb 2025 | 4 Feb 2026 |
5 | cleansweepchimneyservicesllc.com | Wild West Domains, LLC | 28 Jun 2011 | 29 Jun 2024 | 28 Jun 2025 |
6 | cleansweepchimneyservicestaffordshire.com | Webfusion Ltd. | 7 Oct 2020 | 7 Oct 2020 | 7 Oct 2021 |
7 | cleansweepchimneyservicesinc.com | Wild West Domains, LLC | 3 Oct 2017 | 23 Sep 2024 | 3 Oct 2025 |

Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=cleansweepchimneyservices
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |