With support for 
Keyword: DERR
Reverse Whois » KEYWORD [derr ] { 14,859 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | derr.xyz | eNom, Inc. | 13 Nov 2017 | 9 Nov 2023 | 13 Nov 2024 |
| 2 | derr.immobilien | Tucows Domains Inc. | 10 Oct 2014 | 14 Oct 2023 | 10 Oct 2024 |
| 3 | derr.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 4 | derr.party | Alpnames Limited | 13 May 2015 | - | 12 May 2016 |
| 5 | derr.click | Uniregistrar Corp | 4 Jul 2015 | 4 Jul 2015 | 4 Jul 2016 |
| 6 | derr.info | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 23 May 2024 | 28 May 2024 | 23 May 2025 |
| 7 | derr.com | OnlineNIC, Inc. | 7 Mar 2000 | 29 Feb 2024 | 7 Mar 2025 |
| 8 | derr.wang | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Feb 2016 | - | 28 Feb 2017 |
| 9 | derr.top | Namesilo, LLC | 20 Mar 2023 | 25 Apr 2024 | 20 Mar 2024 |
| 10 | derr.biz | Mesh Digital Limited | 24 Apr 2008 | 27 Apr 2023 | 23 Apr 2024 |
| 11 | derr.foundation | Google, Inc. | 13 Sep 2016 | 21 May 2024 | 13 Sep 2024 |
| 12 | derr.site | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Oct 2016 | 3 Nov 2017 | 1 Oct 2017 |
| 13 | derr.net | Tucows Domains Inc. | 7 Jul 1998 | 8 Jun 2024 | 6 Jul 2025 |
| 14 | derr.org | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 13 Apr 2002 | 2 Apr 2017 | 13 Apr 2026 |
| 15 | derr.us | TLD Registrar Solutions Ltd. | 24 Apr 2002 | 9 Sep 2023 | 23 Apr 2025 |
| 16 | derr.cloud | Namesilo, LLC | 11 Feb 2021 | 11 Feb 2021 | 11 Feb 2022 |
| 17 | derr.win | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Nov 2016 | 7 Jun 2017 | 9 Nov 2017 |
| 18 | derr.in | - | 3 Sep 2008 | 5 Aug 2017 | 3 Sep 2018 |
| 19 | derr.zone | NameCheap, Inc. | 31 May 2017 | 29 Sep 2017 | 31 May 2018 |
| 20 | derr.tech | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Jul 2021 | 22 Aug 2024 | 20 Jul 2025 |
| 21 | derr.uk | Reserved | 21 Dec 2015 | 20 Dec 2016 | 21 Dec 2018 |
| 22 | derr.co.uk | Reserved | 25 Aug 2013 | 24 Aug 2017 | 25 Aug 2019 |
| 23 | derr.loan | West263 International Limited | 28 Apr 2018 | - | 28 Apr 2019 |
| 24 | derr.pro | CloudFlare, Inc. | 16 Jan 2022 | 9 Dec 2022 | 16 Jan 2025 |
| 25 | derr.design | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 May 2019 | 29 Jun 2020 | 28 May 2020 |
| 26 | derr.wtf | NameCheap, Inc. | 19 Jan 2021 | 19 Jan 2021 | 19 Jan 2022 |
| 27 | derr.digital | NameCheap, Inc. | 14 Oct 2021 | 19 Oct 2021 | 14 Oct 2022 |
| 28 | derr.coach | 1API GmbH | 7 Dec 2021 | 21 Jan 2024 | 7 Dec 2024 |
| 29 | derr.dev | CloudFlare, Inc. | 28 May 2024 | 2 Jun 2024 | 28 May 2025 |
| 30 | derr.io | NameCheap, Inc. | 31 May 2017 | 6 May 2024 | 31 May 2025 |
| 31 | derr.it | - | 14 Jun 2013 | 30 Jun 2024 | 14 Jun 2025 |
| 32 | derr.nl | - | 19 Aug 2015 | 24 Apr 2023 | - |
| 33 | derr.asia | DNSPod, Inc. | 11 Jun 2023 | 11 Jun 2024 | 11 Jun 2025 |
| 34 | derr.family | CloudFlare, Inc. | 6 Aug 2023 | 12 Jul 2024 | 6 Aug 2025 |
| 35 | derr.red | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Nov 2023 | 10 Nov 2023 | 5 Nov 2024 |
| 36 | derr.net.cn | - | 21 Aug 2024 | - | 21 Aug 2025 |
| 37 | derr.one | Porkbun, LLC | 2 Mar 2024 | 7 Mar 2024 | 2 Mar 2025 |
| 38 | derr.codes | Amazon Registrar, Inc. | 28 Mar 2024 | 12 Apr 2024 | 28 Mar 2025 |
| 39 | derr.shop | Namesilo, LLC | 1 Feb 2024 | 6 Mar 2024 | 1 Feb 2025 |
| 40 | derr.ws | GoDaddy.com, LLC | 23 Jul 2001 | 3 Sep 2024 | 3 Sep 2025 |
| 41 | derr.ru | - | 16 Nov 2009 | - | 16 Nov 2024 |
| 42 | derr.su | - | 25 Aug 2015 | - | 25 Aug 2025 |
| 43 | derraumjournalist.net | RegistryGate GmbH | 30 Sep 2011 | 1 Oct 2023 | 30 Sep 2024 |
| 44 | derringers.com.au | - | - | 22 Jun 2024 | - |
| 45 | derrickrosesshoes.net | GMO Internet Inc. | 19 Nov 2015 | 17 Nov 2016 | 19 Nov 2017 |
| 46 | derreichesack.com | PSI-USA, Inc. dba Domain Robot | 18 Jun 2007 | 8 Aug 2024 | 18 Jun 2025 |
| 47 | derry.nh.us | - | 5 Feb 2003 | 9 Nov 2012 | 4 Feb 2015 |
| 48 | derryjournal.com | Register.it SPA | 18 Oct 2015 | 22 Jul 2024 | 15 Jul 2025 |
| 49 | derradeirasgracas.com | eNom, Inc. | 8 May 2007 | 9 May 2024 | 8 May 2025 |
| 50 | derrenbrown.co.uk | - | 30 May 2000 | 22 Jul 2024 | 30 May 2025 |
| 51 | derraleves.com | eNom, Inc. | 14 Jun 2011 | 1 Feb 2022 | 14 Jun 2031 |
| 52 | derrama.org.pe | - | - | - | - |
| 53 | derringerlive.com | GMO Internet Inc. | 25 Feb 2022 | 8 May 2023 | 25 Feb 2023 |
| 54 | derrotalacrisis.com | 10dencehispahard, S.L. | 5 Dec 2013 | 22 Aug 2023 | 5 Dec 2028 |
| 55 | derrycity.gov.uk | - | - | - | - |
| 56 | derrydaily.net | Blacknight Internet Solutions Ltd. | 10 Sep 2012 | 5 Sep 2023 | 10 Sep 2024 |
| 57 | derrynow.com | Blacknight Internet Solutions Ltd. | 30 Mar 2011 | 25 Mar 2024 | 30 Mar 2025 |
| 58 | derrycitybuzz.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 59 | derringtonfinance.com | Webfusion Ltd. | 22 Oct 2014 | 15 Oct 2023 | 22 Oct 2024 |
| 60 | derringtondevelopments.com | Webfusion Ltd. | 22 Oct 2014 | 15 Oct 2023 | 22 Oct 2024 |
| 61 | derricocaffe.com | Tucows Domains Inc. | 19 Oct 2012 | 23 Oct 2014 | 19 Oct 2015 |
| 62 | derricoarchitects.com | Tucows Domains Inc. | 21 Oct 2008 | 23 Oct 2023 | 21 Oct 2024 |
| 63 | derrickrosefan.com | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 64 | derreisefuehrer.com | GoDaddy.com, LLC | 14 Jul 2000 | 15 Jul 2024 | 14 Jul 2025 |
| 65 | derrickvandyke.com | NameCheap, Inc. | 19 Aug 2006 | 20 Jul 2024 | 19 Aug 2025 |
| 66 | derritelodeamor.com | NameCheap, Inc. | 18 Apr 2015 | 29 May 2024 | 18 Apr 2025 |
| 67 | derrykiernan.com | GoDaddy.com, LLC | 23 Oct 2014 | 6 Oct 2022 | 23 Oct 2025 |
| 68 | derrickgillard.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 69 | derrickdouglas.biz | Tucows Domains Inc. | 20 Oct 2007 | 23 Oct 2014 | 19 Oct 2014 |
| 70 | derrickcooksey.com | Network Solutions, LLC | 23 Oct 2014 | 21 Oct 2017 | 23 Oct 2018 |
| 71 | derrotero.net | NameKing.com Inc. | 28 Jul 2021 | 29 Jun 2024 | 28 Jul 2025 |
| 72 | derryfieldoh.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 73 | derrmone.com | Tucows Domains Inc. | 24 Oct 2014 | 28 Oct 2015 | 24 Oct 2016 |
| 74 | derrickabailey.com | GMO Internet Inc. | 4 Feb 2023 | 16 Mar 2024 | 3 Feb 2024 |
| 75 | derrickraymondcultured623.com | GoDaddy.com, LLC | 10 Sep 2014 | 16 Sep 2014 | 10 Sep 2015 |
| 76 | derrickcolton.com | GoDaddy.com, LLC | 25 May 2012 | 26 May 2015 | 25 May 2016 |
| 77 | derrichjdesigns.com | Wild West Domains, LLC | 25 May 2013 | 26 May 2015 | 25 May 2016 |
| 78 | derrybnb.com | GoDaddy.com, LLC | 26 May 2012 | 27 May 2015 | 26 May 2016 |
| 79 | derryberryair.com | GoDaddy.com, LLC | 9 Feb 2012 | 19 Apr 2015 | 9 Feb 2016 |
| 80 | derris.net | Xin Net Technology Corporation | 21 Jun 2022 | 21 Jun 2022 | 21 Jun 2023 |
| 81 | derriss.net | GoDaddy.com, LLC | 27 May 2014 | 28 May 2015 | 27 May 2016 |
| 82 | derriss.com | NameCheap, Inc. | 8 Sep 2022 | 20 Nov 2023 | 8 Sep 2023 |
| 83 | derryapartment.com | DROPCATCH.COM 834 LLC | 8 Aug 2018 | 8 Aug 2018 | 8 Aug 2019 |
| 84 | derrycitysguidedtours.com | - | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2017 |
| 85 | derrynjames.com | GoDaddy.com, LLC | 31 May 2012 | 1 Jun 2015 | 31 May 2016 |
| 86 | derrenburse.com | GoDaddy.com, LLC | 25 Jun 2012 | 24 Apr 2015 | 25 Jun 2016 |
| 87 | derrinandnadiasregistry.com | Domain.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 88 | derrinandnadia.com | eNom, Inc. | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 89 | derrickandcrystal2015.com | eNom, Inc. | 26 Oct 2014 | 26 Oct 2014 | 26 Oct 2015 |
| 90 | derrickmcquade.com | GoDaddy.com, LLC | 30 Jun 2017 | 30 Jun 2017 | 30 Jun 2022 |
| 91 | derryfest.com | TurnCommerce, Inc. DBA NameBright.com | 1 Jul 2014 | 25 Jun 2020 | 1 Jul 2024 |
| 92 | derrickwitt.com | GoDaddy.com, LLC | 27 Oct 2014 | 1 Nov 2023 | 27 Oct 2024 |
| 93 | derrapadas.com | eNom, Inc. | 18 Apr 2011 | 17 Apr 2024 | 18 Apr 2025 |
| 94 | derraz.com | eNom, Inc. | 10 May 2011 | 11 May 2024 | 10 May 2025 |
| 95 | derrickbell.com | eNom, Inc. | 3 Jun 2012 | 5 Jun 2024 | 3 Jun 2025 |
| 96 | derrickward.com | eNom, Inc. | 10 Sep 2011 | 21 Dec 2016 | 10 Sep 2017 |
| 97 | derrota.com | eNom, Inc. | 27 Jun 2003 | 26 Jun 2024 | 27 Jun 2025 |
| 98 | derred.com | eNom, Inc. | 16 Sep 2011 | 25 Sep 2023 | 16 Sep 2024 |
| 99 | derrickjames.com | Dynadot, LLC | 6 Mar 2024 | 9 May 2024 | 6 Mar 2025 |
| 100 | derruhe.com | eNom, Inc. | 7 Jan 2012 | 9 Jan 2024 | 7 Jan 2025 |
| 101 | derreti.com | eNom, Inc. | 19 Jul 2012 | 21 Jul 2017 | 19 Jul 2018 |
| 102 | derrotado.com | eNom, Inc. | 4 Jan 2012 | 3 Jan 2024 | 4 Jan 2025 |
| 103 | derrickwalton.com | NameCheap, Inc. | 15 Dec 2023 | 15 Dec 2023 | 15 Dec 2028 |
| 104 | derrickrose5shoes.com | Name.com, Inc. | 20 Nov 2017 | 20 Nov 2017 | 20 Nov 2018 |
| 105 | derrickrose5.com | Dynadot15 LLC | 14 Apr 2021 | 15 Apr 2021 | 14 Apr 2022 |
| 106 | derrekbertrand.com | NameCheap, Inc. | 28 Oct 2014 | 19 Oct 2023 | 28 Oct 2024 |
| 107 | derriereboutique.info | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 108 | derryberryestates.com | GoDaddy.com, LLC | 14 Oct 2019 | 14 Aug 2024 | 14 Oct 2026 |
| 109 | derrickrosebasketball.com | GoDaddy.com, LLC | 11 Nov 2013 | 4 May 2015 | 11 Nov 2015 |
| 110 | derrick.info | - | 22 Oct 2023 | 26 Feb 2024 | 22 Oct 2024 |
| 111 | derrypetsitting.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 112 | derrypetsitter.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 113 | derryherk.com | NameCheap, Inc. | 29 Oct 2014 | 7 Jun 2023 | 29 Oct 2024 |
| 114 | derrydogwalking.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 115 | derrydogwalker.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2016 | 29 Oct 2017 |
| 116 | derryalaska.com | GoDaddy.com, LLC | 30 Oct 2014 | 6 Oct 2023 | 30 Oct 2025 |
| 117 | derrickweatherly.com | GoDaddy.com, LLC | 4 Aug 2019 | 4 Aug 2024 | 4 Aug 2025 |
| 118 | derrickmoorespeaking.com | GMO Internet Inc. | 30 Oct 2014 | 1 Oct 2016 | 29 Oct 2017 |
| 119 | derreckthompson.com | eNom, Inc. | 8 Aug 2019 | 8 Aug 2019 | 8 Aug 2020 |
| 120 | derrex.com | GoDaddy.com, LLC | 20 Nov 2009 | 21 Nov 2023 | 20 Nov 2024 |
| 121 | derrick-rose.com | GoDaddy.com, LLC | 31 Dec 2022 | 1 Jan 2024 | 31 Dec 2024 |
| 122 | derrywholesaleauto.com | GoDaddy.com, LLC | 6 Jan 2012 | 17 Dec 2023 | 6 Jan 2025 |
| 123 | derre.com | Fabulous.com Pty Ltd. | 25 Jan 2002 | 7 Feb 2024 | 25 Jan 2026 |
| 124 | derradeira.com | eNom, Inc. | 1 Sep 2013 | 21 Dec 2016 | 1 Sep 2017 |
| 125 | derrin.us | GoDaddy.com, LLC | 26 Apr 2017 | 27 Apr 2017 | 25 Apr 2019 |
| 126 | derrickchoyleads.info | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 127 | derryfeed.com | Hongkong Domain Name Information Management Co., L… | 24 Oct 2022 | 2 Dec 2023 | 24 Oct 2023 |
| 128 | derrickequipment.com | Network Solutions, LLC | 21 Feb 1996 | 24 Dec 2023 | 22 Feb 2027 |
| 129 | derry-firenh.org | - | - | - | - |
| 130 | derrytwp.org | GoDaddy.com, LLC | 12 Sep 2023 | 17 Sep 2023 | 12 Sep 2024 |
| 131 | derrytwp.info | 1&1 Internet AG | 6 Jan 2010 | 20 Feb 2024 | 6 Jan 2025 |
| 132 | derramerock.com | OnlineNIC, Inc. | 9 Aug 2020 | 9 Aug 2020 | 9 Aug 2021 |
| 133 | derrama.com | TurnCommerce, Inc. DBA NameBright.com | 27 Sep 2015 | 21 Sep 2020 | 27 Sep 2025 |
| 134 | derringerbooks.com | Network Solutions, LLC | 12 Dec 2009 | 14 Dec 2021 | 12 Dec 2024 |
| 135 | derrypres.org | Network Solutions, LLC | 29 Apr 1999 | 24 Jan 2022 | 29 Apr 2027 |
| 136 | derrickabs.com | GoDaddy.com, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 137 | derrickpics.com | GoDaddy.com, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 138 | derrickathlete.com | GoDaddy.com, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 139 | derrickinternational.com | Network Solutions, LLC | 20 Sep 2000 | 22 Jul 2022 | 20 Sep 2025 |
| 140 | derrickrental.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jan 2003 | 21 Feb 2024 | 15 Jan 2025 |
| 141 | derrt.com | Domain.com, LLC | 12 Mar 2007 | 25 Feb 2024 | 12 Mar 2025 |
| 142 | derrickrealestate.com | NameCheap, Inc. | 23 Nov 2017 | 25 Oct 2022 | 23 Nov 2026 |
| 143 | derrick.com | GoDaddy.com, LLC | 17 Feb 1996 | 29 Nov 2023 | 18 Feb 2026 |
| 144 | derrickrussell.com | eNom, Inc. | 7 Apr 2009 | 23 Apr 2024 | 7 Apr 2025 |
| 145 | derritterhof.com | GoDaddy.com, LLC | 14 Aug 1999 | 5 Sep 2023 | 14 Aug 2025 |
| 146 | derrochandopurpurina.com | GMO Internet Inc. | 6 Apr 2017 | 6 Apr 2017 | 6 Apr 2018 |
| 147 | derrick.xyz | Dynadot, LLC | 23 Jun 2021 | 6 Jun 2024 | 23 Jun 2026 |
| 148 | derry.biz | Blacknight Internet Solutions Ltd. | 23 Jun 2016 | 23 Jun 2024 | 22 Jun 2025 |
| 149 | derricksmedia.com | Internet.bs Corp. | 1 Aug 2014 | 1 Aug 2014 | 1 Aug 2015 |
| 150 | derrynew.com | Moniker Online Services LLC | 29 Nov 2005 | 8 Jun 2015 | 29 Mar 2016 |
| 151 | derrickchen.org | 1&1 Internet AG | 31 Mar 2017 | 31 May 2017 | 31 Mar 2018 |
| 152 | derrieselles.com | Interweb Advertising D.B.A. Profile Builder | 23 Jul 2014 | 23 Jul 2014 | 23 Jul 2015 |
| 153 | derrotandoelestres.info | GoDaddy.com, LLC | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 154 | derrittmeister.com | GoDaddy.com, LLC | 29 May 1998 | 8 Mar 2024 | 21 Oct 2030 |
| 155 | derri-air.com | TLDs LLC dba SRSplus | 28 Apr 1999 | 29 Apr 2024 | 28 Apr 2025 |
| 156 | derricreed.biz | GoDaddy.com, LLC | 10 Jun 2014 | 10 Jun 2015 | 9 Jun 2015 |
| 157 | derrickwilson5678.com | GoDaddy.com, LLC | 9 Jun 2014 | 10 Jun 2015 | 9 Jun 2016 |
| 158 | derricainc.com | TurnCommerce, Inc. DBA NameBright.com | 6 Feb 2018 | 5 Feb 2018 | 5 Feb 2019 |
| 159 | derrytownship.org | Network Solutions, LLC | 5 Aug 1999 | 11 Jun 2024 | 5 Aug 2026 |
| 160 | derrynews.com | Brandsight, Inc. | 31 Jan 1996 | 21 Dec 2023 | 1 Feb 2025 |
| 161 | derrickspottsart.com | Tucows Domains Inc. | 30 Oct 2013 | 3 Nov 2014 | 30 Oct 2015 |
| 162 | derrickloganphotography-video.com | GoDaddy.com, LLC | 6 Jun 2012 | 7 Jun 2015 | 6 Jun 2016 |
| 163 | derrickhickman.com | GoDaddy.com, LLC | 9 Jun 2011 | 10 Jun 2015 | 9 Jun 2016 |
| 164 | derrflooring.com | Network Solutions, LLC | 23 Apr 1997 | 29 Aug 2019 | 24 Apr 2025 |
| 165 | derry-nh.org | GoDaddy.com, LLC | 5 Mar 2001 | 8 Aug 2024 | 5 Mar 2025 |
| 166 | derryfire.com | GoDaddy.com, LLC | 10 Oct 2003 | 14 Oct 2022 | 10 Oct 2027 |
| 167 | derrelsofdothan.com | GoDaddy.com, LLC | 21 Jan 2004 | 22 Jan 2024 | 21 Jan 2025 |
| 168 | derruheblatzmotel.com | GoDaddy.com, LLC | 4 Mar 2002 | 2 Sep 2022 | 4 Mar 2025 |
| 169 | derryberrylaw.com | GoDaddy.com, LLC | 28 Aug 1998 | 16 Aug 2024 | 27 Aug 2025 |
| 170 | derrynh.org | Network Solutions, LLC | 19 Mar 2012 | 18 Jan 2022 | 19 Mar 2027 |
| 171 | derrickmonroe.com | Network Solutions, LLC | 18 Jun 2001 | 22 Jun 2021 | 18 Jun 2026 |
| 172 | derrickshelby.com | 1&1 Internet AG | 3 Nov 2014 | 4 Nov 2016 | 3 Nov 2017 |
| 173 | derrickquinn.com | Squarespace Domains LLC | 8 Jun 2024 | 8 Jun 2024 | 8 Jun 2025 |
| 174 | derrickmotor.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2016 |
| 175 | derrekquinn.com | eNom, Inc. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2016 |
| 176 | derrwazah.com | eNom, Inc. | 5 Aug 2014 | 5 Aug 2014 | 5 Aug 2015 |
| 177 | derrickbarnes.com | DropCatch.com 1164 LLC | 17 Jul 2022 | 31 Aug 2023 | 17 Jul 2024 |
| 178 | derringerfirearms.com | Media Elite Holdings Limited | 1 Nov 2022 | 20 Jan 2024 | 1 Nov 2024 |
| 179 | derrycats.org | NameCheap, Inc. | 19 Jan 2024 | 24 Jan 2024 | 19 Jan 2025 |
| 180 | derrickandclaudia.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 181 | derreauxphotography.com | register.com, Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 182 | derricksilvers.com | GoDaddy.com, LLC | 17 Feb 2022 | 30 Mar 2024 | 17 Feb 2024 |
| 183 | derrfsgu.info | Wild West Domains, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 184 | derrickrwilliams.com | Gransy s.r.o. d/b/a subreg.cz | 20 Jun 2014 | 18 Aug 2014 | 20 Jun 2015 |
| 185 | derricktaylor3700.com | Tucows Domains Inc. | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 186 | derrickwrightgroup.com | GoDaddy.com, LLC | 9 Jan 2020 | 9 Jan 2020 | 9 Jan 2022 |
| 187 | derryfieldschool.com | Fabulous.com Pty Ltd. | 18 Oct 2005 | 3 Nov 2017 | 18 Oct 2018 |
| 188 | derryautoservice.com | GoDaddy.com, LLC | 19 Dec 2023 | 19 Dec 2023 | 19 Dec 2026 |
| 189 | derrickfball.com | TurnCommerce, Inc. DBA NameBright.com | 24 Jan 2020 | 18 Jan 2021 | 24 Jan 2026 |
| 190 | derreisebegleiter.net | 1&1 Internet AG | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 191 | derrickbigwalker.com | GoDaddy.com, LLC | 6 Nov 2015 | 6 Nov 2015 | 6 Nov 2016 |
| 192 | derrickmjoseph.com | GoDaddy.com, LLC | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2016 |
| 193 | derrickstory.com | GoDaddy.com, LLC | 19 Aug 2014 | 20 Aug 2024 | 19 Aug 2025 |
| 194 | derryrsmith.com | Google, Inc. | 19 Aug 2014 | 9 Aug 2024 | 19 Aug 2025 |
| 195 | derrickdeans.com | GoDaddy.com, LLC | 24 Jun 2015 | 25 Jun 2024 | 24 Jun 2027 |
| 196 | derrickruntas.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 197 | derrrannn.com | Key-Systems GmbH | 24 Jun 2015 | 23 Jun 2024 | 24 Jun 2025 |
| 198 | derrygroup.com | GoDaddy.com, LLC | 24 Jun 2015 | 25 Jun 2023 | 24 Jun 2025 |
| 199 | derrycert.org | Dynadot, LLC | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 200 | derryarts.org | GoDaddy.com, LLC | 13 Nov 1997 | 15 Aug 2024 | 12 Nov 2031 |
| 201 | derrickfball.info | 1&1 Internet AG | 5 Nov 2014 | 5 Nov 2017 | 5 Nov 2018 |
| 202 | derreisebegleiter.biz | 1&1 Internet AG | 19 Aug 2014 | - | 18 Aug 2015 |
| 203 | derreisebegleiter.info | 1&1 Internet AG | 19 Aug 2014 | - | 19 Aug 2015 |
| 204 | derreisebegleiter.org | 1&1 Internet AG | 19 Aug 2014 | - | 19 Aug 2015 |
| 205 | derrickstormtv.com | Synergy Wholesale Pty Ltd | 21 Aug 2014 | 25 Aug 2015 | 21 Aug 2017 |
| 206 | derrickstormtv.net | TPP Wholesale Pty Ltd. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 207 | derryandwallis.com | GMO Internet Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 208 | derricadesign.com | Network Solutions, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 209 | derrickacoleman.com | 1&1 Internet AG | 28 Aug 2020 | 28 Aug 2020 | 28 Aug 2021 |
| 210 | derrickhorvath.com | GoDaddy.com, LLC | 12 Jan 2015 | 13 Jan 2023 | 12 Jan 2025 |
| 211 | derrickhorvath.net | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 212 | derrykingdom.com | Tucows Domains Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 213 | derrcoproducts.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2016 | 22 Aug 2017 |
| 214 | derrickasdoor1996.com | Tucows Domains Inc. | 22 Aug 2014 | 26 Aug 2015 | 22 Aug 2016 |
| 215 | derrum.com | Limited Liability Company "Registrar of domain nam… | 19 Apr 2024 | 4 May 2024 | 19 Apr 2025 |
| 216 | derryhamstables.com | Network Solutions, LLC | 6 Nov 2014 | 24 May 2024 | 6 Nov 2026 |
| 217 | derrube.com | Tucows Domains Inc. | 30 Dec 2018 | 30 Dec 2018 | 30 Dec 2019 |
| 218 | derricktucker.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 219 | derrickdillion.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 220 | derrickandkaylene.com | eNom, Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 221 | derrickjonesnelson.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2023 | 7 Feb 2025 |
| 222 | derrickliang.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 223 | derricocustomamps.com | Tucows Domains Inc. | 6 Feb 2015 | 10 Feb 2019 | 6 Feb 2019 |
| 224 | derrotandolacrisis.com | 1&1 Internet AG | 17 Feb 2018 | 17 Feb 2018 | 17 Feb 2019 |
| 225 | derrickfball.org | 1&1 Internet AG | 5 Nov 2014 | 6 Nov 2016 | 5 Nov 2017 |
| 226 | derrickfball.net | 1&1 Internet AG | 5 Nov 2014 | 14 Nov 2017 | 5 Nov 2018 |
| 227 | derrickthomas.net | GoDaddy.com, LLC | 28 Feb 2015 | 1 Mar 2017 | 28 Feb 2018 |
| 228 | derricktuskanvisuals.com | Tucows Domains Inc. | 25 Feb 2014 | 1 Mar 2015 | 25 Feb 2016 |
| 229 | derretegordura.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 May 2023 | 3 Aug 2024 | 22 May 2024 |
| 230 | derricklife.com | Domain.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 231 | derrick-rose-shoes.com | Key-Systems GmbH | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 232 | derrickwwise.com | Wild West Domains, LLC | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 233 | derridaedu.com | West263 International Limited | 10 Apr 2020 | 10 Apr 2020 | 10 Apr 2021 |
| 234 | derryfurniture.com | Xin Net Technology Corporation | 12 Aug 2014 | 10 Aug 2021 | 12 Aug 2030 |
| 235 | derrickbaker.com | eNom, Inc. | 9 Dec 2015 | 28 Jan 2023 | 9 Dec 2027 |
| 236 | derrickdbailey.com | eNom, Inc. | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 237 | derrickmurraycomedy.com | FastDomain Inc. | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 238 | derrysport.com | GoDaddy.com, LLC | 28 Oct 2017 | 28 Oct 2023 | 28 Oct 2024 |
| 239 | derrcc.com | Bizcn.com, Inc. | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 240 | derrickdiesel.com | GoDaddy.com, LLC | 9 Dec 2015 | 20 Sep 2022 | 9 Dec 2027 |
| 241 | derrickhicks.org | FastDomain Inc. | 19 Dec 2022 | 8 Dec 2023 | 19 Dec 2024 |
| 242 | derricks-home-improvement.com | GoDaddy.com, LLC | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 243 | derricksemtrainer.com | NameCheap, Inc. | 26 Aug 2014 | 21 Aug 2024 | 26 Aug 2025 |
| 244 | derricowebsolutions.com | eNom, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 245 | derrefer.net | register.com, Inc. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 246 | derrickehaynes.com | GMO Internet Inc. | 9 Feb 2024 | 10 Feb 2024 | 9 Feb 2025 |
| 247 | derriaircushion.com | GoDaddy.com, LLC | 14 Aug 2014 | 15 Aug 2024 | 14 Aug 2025 |
| 248 | derringerauto.com | register.com, Inc. | 14 Aug 2014 | 30 Jul 2024 | 14 Aug 2026 |
| 249 | derronbuisness.com | register.com, Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 250 | derryberrymassage.com | Google, Inc. | 14 Aug 2014 | 30 Jul 2024 | 14 Aug 2025 |
| 251 | derrickhomeownermisery.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 252 | derrosenheimmba.com | Corehub, S.R.L. | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 253 | derricklewisnoble.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2024 | 15 Aug 2026 |
| 254 | derrydentalimplants.com | GoDaddy.com, LLC | 15 Aug 2014 | 12 Feb 2023 | 15 Aug 2025 |
| 255 | derrydentalimplants.net | GoDaddy.com, LLC | 15 Aug 2014 | 12 Feb 2023 | 15 Aug 2026 |
| 256 | derrydoc.net | Marcaria.com International, Inc. | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 257 | derrylandcompany.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2024 | 15 Aug 2026 |
| 258 | derrymurals.com | Nameling.com LLC | 25 Oct 2013 | 26 Oct 2017 | 25 Oct 2018 |
| 259 | derryplantation.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Aug 2024 | 15 Aug 2026 |
| 260 | derrenstephenson.com | Acens Technologies, S.L.U. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 261 | derrickjeffreyinglut.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 262 | derrickl.com | CloudFlare, Inc. | 28 Aug 2014 | 29 Jul 2024 | 28 Aug 2025 |
| 263 | derricklee21.com | eNom, Inc. | 29 Aug 2014 | 28 Jul 2017 | 29 Aug 2018 |
| 264 | derryappraisal.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 265 | derrycommercial.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 266 | derrycondos.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 267 | derryforeclosures.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 268 | derryland.com | TurnCommerce, Inc. DBA NameBright.com | 15 Nov 2020 | 26 Aug 2021 | 15 Nov 2024 |
| 269 | derrymultifamily.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 270 | derrynewconstruction.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 271 | derrynhappraisal.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 272 | derrynhcommercial.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 273 | derrynhforeclosures.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 274 | derrynhland.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 275 | derrynhmultifamily.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 276 | derrynhnewconstruction.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 277 | derrynhwaterfront.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 278 | derrywaterfront.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2016 | 29 Aug 2017 |
| 279 | derrycontractor.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 280 | derreifenprofi.com | united-domains AG | 10 Nov 2014 | 11 Nov 2017 | 10 Nov 2018 |
| 281 | derrierelesrideaux.com | Marcaria.com International, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 282 | derricklcolemanjrnoexcusefoundation.com | Network Solutions, LLC | 12 Nov 2014 | 24 May 2024 | 12 Nov 2024 |
| 283 | derrickstravelexperience.org | GoDaddy.com, LLC | 12 Nov 2014 | 13 Nov 2016 | 12 Nov 2017 |
| 284 | derrickstravelexperience.info | GoDaddy.com, LLC | 12 Nov 2014 | 13 Nov 2016 | 12 Nov 2017 |
| 285 | derrickstravelexperience.biz | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2016 | 11 Nov 2017 |
| 286 | derrepente.info | Wild West Domains, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 287 | derrickdata.com | GoDaddy.com, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 288 | derrickinglut.org | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 289 | derrickinglut.us | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 27 Aug 2015 |
| 290 | derrickrsmith.com | register.com, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 291 | derryheen.com | Wild West Domains, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 292 | derriansgettingmoney.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 293 | derrickkobrin.com | CloudFlare, Inc. | 12 Sep 2014 | 1 Jul 2024 | 12 Sep 2025 |
| 294 | derrickmcdowell.com | GoDaddy.com, LLC | 12 Sep 2014 | 13 Sep 2023 | 12 Sep 2024 |
| 295 | derring-festival.com | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 296 | derringfestival.com | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 297 | derryfarmcottages.com | Easyspace LTD | 26 Feb 2001 | 18 Jan 2024 | 26 Feb 2026 |
| 298 | derrickrdouglas.com | Tucows Domains Inc. | 10 Nov 2007 | 14 Nov 2014 | 10 Nov 2015 |
| 299 | derrickhelp.com | eNom, Inc. | 13 Nov 2014 | 14 Nov 2014 | 13 Nov 2015 |
| 300 | derresimmigrationlawva.com | Wild West Domains, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 301 | derribosvillenaweb.com | 1&1 Internet AG | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 302 | derrickgreenforheisman.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 303 | derrickgreenheisman.com | GoDaddy.com, LLC | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 304 | derring-festival.info | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 305 | derringfestival.info | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 306 | derring-festival.mobi | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 307 | derring-festival.net | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 308 | derring-festival.org | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 309 | derringfestival.mobi | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 310 | derringfestival.net | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 311 | derringfestival.org | united-domains AG | 12 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 312 | derrickslist.com | eNom, Inc. | 13 Sep 2014 | 10 Sep 2024 | 13 Sep 2025 |
| 313 | derrotar.com | TurnCommerce, Inc. DBA NameBright.com | 13 Sep 2014 | 7 Sep 2020 | 13 Sep 2025 |
| 314 | derrylingunclub.com | 1&1 Internet AG | 13 Sep 2014 | 14 Sep 2016 | 13 Sep 2018 |
| 315 | derrymorefarm.com | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2017 |
| 316 | derricktshaw.com | Wild West Domains, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 317 | derrickdionson.com | eNom, Inc. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 318 | derrierusexpeditus.com | Tucows Domains Inc. | 10 Sep 2012 | 14 Sep 2014 | 10 Sep 2015 |
| 319 | derrabags.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 320 | derricklayne.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 321 | derrente.com | Tucows Domains Inc. | 13 Sep 2013 | 17 Sep 2014 | 13 Sep 2015 |
| 322 | derrickinsure.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 323 | derring.info | united-domains AG | 16 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 324 | derring.mobi | united-domains AG | 16 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 325 | derring.net | united-domains AG | 16 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 326 | derrotic.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 327 | derrickvuong.com | eNom, Inc. | 14 Nov 2014 | 14 Nov 2016 | 14 Nov 2017 |
| 328 | derrick-roberts.com | 1&1 Internet AG | 15 Nov 2014 | 15 Nov 2023 | 15 Nov 2024 |
| 329 | derrenmccormack.com | RegistryGate GmbH | 14 Nov 2014 | 19 Dec 2017 | 14 Nov 2018 |
| 330 | derrickdoss.com | Google, Inc. | 5 Aug 2018 | 22 Jul 2024 | 5 Aug 2025 |
| 331 | derrickpizur.info | eNom, Inc. | 2 Sep 2014 | 4 Aug 2017 | 2 Sep 2018 |
| 332 | derryneite.com | Network Solutions, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 333 | derrechtsanwalt.com | TurnCommerce, Inc. DBA NameBright.com | 15 Sep 2014 | 9 Sep 2020 | 15 Sep 2024 |
| 334 | derrickbashawesomehusband.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 335 | derrickhoward.com | GoDaddy.com, LLC | 16 Sep 2014 | 17 Sep 2022 | 16 Sep 2024 |
| 336 | derrickhowardonline.com | GoDaddy.com, LLC | 16 Sep 2014 | 17 Sep 2022 | 16 Sep 2024 |
| 337 | derrickladams.com | register.com, Inc. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 338 | derrickbentford.com | Internet Domain Services BS Corp | 1 May 2021 | 1 May 2021 | 1 May 2022 |
| 339 | derrickstjulien.com | GoDaddy.com, LLC | 23 Nov 2019 | 24 Nov 2023 | 23 Nov 2024 |
| 340 | derrickvizcarra.com | GoDaddy.com, LLC | 3 Sep 2014 | 4 Sep 2024 | 3 Sep 2026 |
| 341 | derryllwristpus.com | GoDaddy.com, LLC | 8 Jul 2019 | 8 Jul 2024 | 8 Jul 2029 |
| 342 | derring.org | united-domains AG | 16 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 343 | derrickmetz.com | GoDaddy.com, LLC | 16 Nov 2014 | 17 Sep 2022 | 16 Nov 2024 |
| 344 | derrichjohn.com | Tucows Domains Inc. | 15 Nov 2014 | 27 Jul 2022 | 15 Nov 2024 |
| 345 | derricksshoppingmall.com | Total Web Solutions Ltd. trading as TotalRegistrat… | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 346 | derryfieldparents.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 347 | derrickglee.com | Google, Inc. | 4 Sep 2014 | 20 Aug 2024 | 4 Sep 2025 |
| 348 | derriennic.net | Gandi SAS | 5 Sep 2014 | 4 Aug 2024 | 5 Sep 2025 |
| 349 | derrymorepm.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 350 | derrywalls.com | Easyspace LTD | 12 Dec 2001 | 12 Nov 2019 | 12 Dec 2024 |
| 351 | derryjudo.com | Interweb Advertising D.B.A. Profile Builder | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 352 | derribandolaescasez.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 353 | derrickstruth.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2016 | 19 Sep 2017 |
| 354 | derrellslawnsnow.com | eNom, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 355 | derrari-berreto.us | Wild West Domains, LLC | 4 Sep 2014 | 4 Sep 2014 | 3 Sep 2015 |
| 356 | derribossales.com | Dinahosting s.l. | 19 Dec 2005 | 16 Apr 2024 | 19 Dec 2024 |
| 357 | derrickwatkinsphotography.com | Network Solutions, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 358 | derrickwrightanddriven.com | Internet Domain Services BS Corp | 17 Oct 2019 | 7 Oct 2023 | 17 Oct 2024 |
| 359 | derrickrose.org | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 360 | derrickness.com | register.com, Inc. | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 361 | derrynh.us | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 4 Sep 2015 |
| 362 | derrickbuild.com | eNom, Inc. | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 363 | derrickassociates.com | DropCatch.com 384 LLC | 19 Sep 2014 | 20 Sep 2017 | 19 Sep 2018 |
| 364 | derrydrugs.com | Network Solutions, LLC | 19 Sep 2014 | 20 Sep 2014 | 19 Sep 2015 |
| 365 | derrickgeeter.info | GoDaddy.com, LLC | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 366 | derridapearl.com | GMO Internet Inc. | 18 Nov 2014 | 14 Nov 2016 | 17 Nov 2017 |
| 367 | derribosydemoliciones.com | OVH sas | 17 Nov 2014 | 23 Nov 2023 | 17 Nov 2024 |
| 368 | derrav.com | GoDaddy.com, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 369 | derrydance.com | TurnCommerce, Inc. DBA NameBright.com | 31 Oct 2013 | 25 Oct 2020 | 31 Oct 2024 |
| 370 | derryprilian.net | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 371 | derryprilian.com | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 372 | derrickbryantphotography.biz | Wild West Domains, LLC | 21 Sep 2014 | 21 Sep 2014 | 20 Sep 2015 |
| 373 | derry-prilian.net | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 374 | derryarea.org | Google, Inc. | 6 Sep 2021 | 28 Aug 2024 | 6 Sep 2025 |
| 375 | derricksoh.info | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 376 | derrierelhorizon.com | Namesilo, LLC | 4 Feb 2021 | 5 Feb 2021 | 4 Feb 2022 |
| 377 | derrandbuddy.com | Tucows Domains Inc. | 6 Sep 2013 | 9 Sep 2014 | 6 Sep 2015 |
| 378 | derreinigungsprofi.com | PSI-USA, Inc. dba Domain Robot | 9 Sep 2014 | 9 Sep 2024 | 9 Sep 2024 |
| 379 | derrickturnbow.com | Network Solutions, LLC | 9 Sep 2014 | 26 Jan 2018 | 9 Sep 2018 |
| 380 | derruba-net.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 381 | derricknixon.com | Google, Inc. | 19 Feb 2021 | 19 Feb 2021 | 19 Feb 2022 |
| 382 | derrickrealtors.com | GoDaddy.com, LLC | 1 Oct 2014 | 17 Sep 2022 | 1 Oct 2026 |
| 383 | derrvic.com | Marcaria.com International, Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 384 | derricksampract.com | Launchpad, Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 385 | derrickdean.com | DROPCATCH.COM 823 LLC | 5 Feb 2016 | 6 Feb 2017 | 5 Feb 2018 |
| 386 | derrickdeaseministries.org | eNom, Inc. | 2 Oct 2014 | 3 Sep 2017 | 2 Oct 2018 |
| 387 | derrickdavisjr.info | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 388 | derrickkollock.net | GoDaddy.com, LLC | 1 Apr 2015 | 1 Apr 2015 | 1 Apr 2016 |
| 389 | derrid.us | Domain.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 2 Oct 2016 |
| 390 | derrry.com | Webfusion Ltd. | 3 Oct 2014 | 26 Sep 2023 | 3 Oct 2024 |
| 391 | derrckmde.com | Hebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.… | 18 Jun 2016 | 18 Jun 2016 | 18 Jun 2017 |
| 392 | derrickgreenlaw.com | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2016 |
| 393 | derreshop.com | Papaki Ltd. | 4 Oct 2014 | 1 Jul 2015 | 4 Oct 2016 |
| 394 | derryplumber.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 395 | derricksong.com | NameCheap, Inc. | 20 Nov 2014 | 21 Oct 2023 | 20 Nov 2024 |
| 396 | derricksclothing.com | Brandon Gray Internet Services, Inc. (dba NameJuic… | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 397 | derrickisgay.com | Fabulous.com Pty Ltd. | 4 Nov 2008 | 15 May 2017 | 4 Nov 2017 |
| 398 | derrickbrinkley.com | Wild West Domains, LLC | 13 Feb 2021 | 20 Feb 2024 | 13 Feb 2025 |
| 399 | derrickbernardbeauty.com | Advanced Internet Technologies, Inc. (AIT) | 29 Jan 2020 | 29 Jan 2020 | 29 Jan 2021 |
| 400 | derrien-terrassement.com | Gandi SAS | 1 Oct 2014 | 2 Sep 2017 | 1 Oct 2018 |
| 401 | derrysuter.com | - | 31 Jul 2024 | 31 Jul 2024 | 31 Jul 2025 |
| 402 | derrickgreenlaw.net | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 403 | derrickmickens.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 404 | derreiseburo.com | GoDaddy.com, LLC | 11 Sep 2014 | 12 Sep 2014 | 11 Sep 2015 |
| 405 | derrickmarshallonline.com | DreamHost, LLC | 12 Sep 2014 | 14 Sep 2024 | 12 Sep 2025 |
| 406 | derryleckaghcontracts.com | Webfusion Ltd. | 11 Sep 2014 | 4 Sep 2017 | 11 Sep 2018 |
| 407 | derribandolaescasez.org | GoDaddy.com, LLC | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 408 | derrickcantwell.com | GoDaddy.com, LLC | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 409 | derrigo.com | Crazy Domains FZ-LLC | 26 Mar 2016 | 19 Mar 2023 | 26 Mar 2025 |
| 410 | derrickhurst.org | FastDomain Inc. | 1 Oct 2014 | 21 Sep 2023 | 1 Oct 2024 |
| 411 | derribosyplantasxisco.com | Tucows Domains Inc. | 2 Oct 2014 | 6 Oct 2015 | 2 Oct 2016 |
| 412 | derrickshudson.com | register.com, Inc. | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2019 |
| 413 | derrynewhampshireclassifieds.com | Wild West Domains, LLC | 2 Oct 2014 | 4 Aug 2016 | 2 Oct 2017 |
| 414 | derreckkayongo.com | Global Domain Name Trading Center Ltd | 22 Oct 2021 | 22 Oct 2021 | 22 Oct 2022 |
| 415 | derrickclothing.com | Key-Systems GmbH | 11 May 2023 | 11 May 2023 | 11 May 2025 |
| 416 | derrickchng.com | GoDaddy.com, LLC | 21 Jan 2019 | 21 Jan 2019 | 21 Jan 2020 |
| 417 | derribando.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 14 Oct 2021 | 14 Oct 2021 | 14 Oct 2022 |
| 418 | derrellbullock.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Jun 2023 | 23 Aug 2024 | 21 Jun 2024 |
| 419 | derrypages.com | - | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2016 |
| 420 | derry-prilian.org | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 421 | derryprilian.org | Tucows Domains Inc. | 18 Sep 2013 | 22 Sep 2014 | 18 Sep 2015 |
| 422 | derrickoilngas.com | GoDaddy.com, LLC | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2019 |
| 423 | derrosa.com | eNom, Inc. | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2015 |
| 424 | derroterosdelmediterraneo.com | 10dencehispahard, S.L. | 30 Sep 2011 | 1 Oct 2017 | 30 Sep 2018 |
| 425 | derrowcars.com | GoDaddy.com, LLC | 24 Sep 2014 | 17 Sep 2022 | 24 Sep 2024 |
| 426 | derralriggle.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2017 | 24 Sep 2018 |
| 427 | derrickmedicalequipmentrepair.com | Tucows Domains Inc. | 20 Nov 2014 | 22 Oct 2023 | 20 Nov 2024 |
| 428 | derrickconstructions.com | Beijing Lanhai Jiye Technology Co., Ltd | 1 Feb 2024 | 1 Feb 2024 | 1 Feb 2025 |
| 429 | derrickemery.net | Google, Inc. | 8 Oct 2014 | 25 Apr 2024 | 8 Oct 2024 |
| 430 | derrickhossain.com | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 431 | derrickwhite.info | Google, Inc. | 26 Mar 2017 | 25 May 2017 | 26 Mar 2018 |
| 432 | derrikdynamos.com | Tucows Domains Inc. | 11 Jan 2003 | 10 Jan 2024 | 11 Jan 2025 |
| 433 | derrote.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Oct 2014 | 8 Aug 2024 | 7 Oct 2024 |
| 434 | derrycash.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 435 | derriereleglise.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 May 2022 | 22 Jun 2024 | 21 May 2024 |
| 436 | derrickfielding.com | Tucows Domains Inc. | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 437 | derreksmith.com | Tucows Domains Inc. | 21 Nov 2014 | 25 Nov 2015 | 21 Nov 2016 |
| 438 | derrickfreeman.com | Domain.com, LLC | 8 Oct 2014 | 23 Sep 2023 | 8 Oct 2024 |
| 439 | derrickho.com | GoDaddy.com, LLC | 24 Jul 2021 | 28 Jul 2024 | 24 Jul 2025 |
| 440 | derrynewhampshire.net | Omnis Network, LLC | 4 Sep 2007 | 29 Sep 2015 | 4 Sep 2016 |
| 441 | derrickandnatalie.com | Google, Inc. | 19 Jan 2020 | 26 Apr 2024 | 19 Jan 2025 |
| 442 | derricktham.com | NameCheap, Inc. | 28 Aug 2012 | 29 Jul 2024 | 28 Aug 2025 |
| 443 | derrickdavidbryant.com | register.com, Inc. | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 444 | derramecreativo.com | FastDomain Inc. | 30 Sep 2014 | 30 Sep 2016 | 30 Sep 2017 |
| 445 | derricksuwaimadavis.com | Tucows Domains Inc. | 29 Sep 2014 | 3 Oct 2018 | 29 Sep 2018 |
| 446 | derrickdkglover.com | eNom, Inc. | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 447 | derrickfrancismasonry.com | eNom, Inc. | 16 Oct 2014 | 10 Oct 2023 | 16 Oct 2024 |
| 448 | derricklaudesign.com | Internet Domain Services BS Corp | 16 Oct 2014 | 12 Jun 2017 | 16 Oct 2018 |
| 449 | derrida.info | GoDaddy.com, LLC | 16 Oct 2014 | 17 Oct 2016 | 16 Oct 2017 |
| 450 | derringtonperformance.com | Network Solutions, LLC | 17 Oct 2014 | 1 Nov 2016 | 17 Oct 2020 |
| 451 | derrysdz.com | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 452 | derrickhollowell.com | GoDaddy.com, LLC | 11 Oct 2014 | 12 Oct 2016 | 11 Oct 2017 |
| 453 | derrickreeby.net | Tucows Domains Inc. | 12 Oct 2014 | 16 Oct 2015 | 12 Oct 2016 |
| 454 | derrikshaw.com | NameCheap, Inc. | 13 Oct 2014 | 24 Aug 2023 | 13 Oct 2024 |
| 455 | derrotaurgente.com | 10dencehispahard, S.L. | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 456 | derrotransfer.com | Internetters Limited | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 457 | derrocktados.com | NameCheap, Inc. | 27 Feb 2022 | 9 May 2024 | 27 Feb 2024 |
| 458 | derrickvcan.com | GoDaddy.com, LLC | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 459 | derrickmagwoodassociates.com | Tucows Domains Inc. | 22 Sep 2007 | 7 Sep 2023 | 22 Sep 2024 |
| 460 | derricklevasseur.com | NameCheap, Inc. | 26 Sep 2014 | 23 Sep 2023 | 26 Sep 2024 |
| 461 | derrichs.com | Tucows Domains Inc. | 26 Sep 2014 | 25 Sep 2023 | 26 Sep 2024 |
| 462 | derretasuagordura.com | Wix.com Ltd. | 1 Feb 2021 | 5 Feb 2023 | 1 Feb 2024 |
| 463 | derrimutpizza.com | Key-Systems GmbH | 14 Oct 2014 | 22 May 2023 | 14 Oct 2024 |
| 464 | derrymoretax.com | Mesh Digital Limited | 13 Oct 2014 | 28 Sep 2016 | 13 Oct 2017 |
| 465 | derry-tech.com | DomainName Path, Inc. | 4 Apr 2022 | 13 Jun 2023 | 4 Apr 2023 |
| 466 | derrittmeistermilitaria.com | GoDaddy.com, LLC | 24 Nov 2014 | 12 Mar 2024 | 24 Nov 2025 |
| 467 | derrecksmith.com | GoDaddy.com, LLC | 14 Oct 2014 | 15 Oct 2023 | 14 Oct 2026 |
| 468 | derricklevassure.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2016 |
| 469 | derrick-levasseur.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 470 | derrickmurphy.net | GoDaddy.com, LLC | 16 Oct 2014 | 17 Oct 2015 | 16 Oct 2018 |
| 471 | derryguyed.com | eNom, Inc. | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 472 | derryanimalhospitalhbg.com | GoDaddy.com, LLC | 25 Nov 2014 | 17 Sep 2022 | 25 Nov 2030 |
| 473 | derringertubs.com | GoDaddy.com, LLC | 25 Nov 2014 | 26 Nov 2022 | 25 Nov 2024 |
| 474 | derringerdip.com | GoDaddy.com, LLC | 25 Nov 2014 | 26 Nov 2022 | 25 Nov 2024 |
| 475 | derringercigar.com | GoDaddy.com, LLC | 25 Nov 2014 | 26 Nov 2023 | 25 Nov 2026 |
| 476 | derriere-le-hublot.com | RegistryGate GmbH | 7 Oct 2005 | 8 Oct 2023 | 7 Oct 2024 |
| 477 | derrydiocese.com | Namesilo, LLC | 24 Aug 2023 | 31 Aug 2024 | 24 Aug 2025 |
| 478 | derronandlisseth.com | GoDaddy.com, LLC | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 479 | derrickbyrdfitness.com | Launchpad, Inc. | 19 Oct 2014 | 7 Nov 2016 | 19 Oct 2017 |
| 480 | derryadama.com | 1&1 Internet AG | 26 Nov 2014 | 27 Nov 2016 | 26 Nov 2017 |
| 481 | derrickvi.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 25 Nov 2014 | 26 Oct 2023 | 25 Nov 2024 |
| 482 | derrience.com | NameCheap, Inc. | 27 Nov 2014 | 9 Jan 2018 | 27 Nov 2018 |
| 483 | derrickandchristina.com | Wild West Domains, LLC | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 484 | derrenbrownforum.com | NameCheap, Inc. | 25 Jul 2021 | - | 25 Jul 2022 |
| 485 | derryberryfilm.com | Tucows Domains Inc. | 25 Nov 2013 | 29 Nov 2014 | 25 Nov 2015 |
| 486 | derryayre.com | DNC Holdings, Inc. | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 487 | derrd.info | Crazy Domains FZ-LLC | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 488 | derrycustomclothing.com | GoDaddy.com, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 489 | derringdoproductions.com | Launchpad, Inc. | 29 Nov 2014 | 13 Dec 2016 | 29 Nov 2017 |
| 490 | derrickandchelsea.com | Wild West Domains, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 491 | derrickwrites.com | - | 27 Feb 2023 | 28 Feb 2024 | 27 Feb 2025 |
| 492 | derry-bnb.com | GMO Internet Inc. | 1 Dec 2014 | 2 Dec 2014 | 1 Dec 2015 |
| 493 | derricksmusic.com | Tucows Domains Inc. | 16 Feb 2016 | 17 Jan 2024 | 16 Feb 2025 |
| 494 | derricksheller.com | Tucows Domains Inc. | 2 Dec 2014 | 30 Apr 2021 | 2 Dec 2024 |
| 495 | derricklamondtaylor.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 496 | derrymoda.com | Tucows Domains Inc. | 12 Mar 2008 | 16 Mar 2017 | 12 Mar 2017 |
| 497 | derryacupuncture.com | Tucows Domains Inc. | 3 Dec 2014 | 8 Dec 2019 | 3 Dec 2019 |
| 498 | derrillcole.com | West263 International Limited | 21 Feb 2022 | 27 Apr 2023 | 21 Feb 2023 |
| 499 | derrickireland.com | GoDaddy.com, LLC | 4 Dec 2014 | 5 Dec 2016 | 4 Dec 2018 |
| 500 | derrick-bass.com | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 501 | derrstroffdentiste.com | Gandi SAS | 6 Dec 2014 | 13 Nov 2017 | 6 Dec 2018 |
| 502 | derrbx.com | Namesilo, LLC | 26 Aug 2022 | 26 Oct 2023 | 26 Aug 2023 |
| 503 | derrusti.com | Namesilo, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 504 | derrowchrysler.com | GoDaddy.com, LLC | 8 Dec 2014 | 17 Sep 2022 | 1 Jul 2025 |
| 505 | derrickvandykeproducts.com | eNom, Inc. | 8 Dec 2014 | 6 Dec 2016 | 8 Dec 2017 |
| 506 | derrickjoseph.com | Squarespace Domains LLC | 8 Dec 2014 | 4 Mar 2024 | 8 Dec 2026 |
| 507 | derrock.net | Network Solutions, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 508 | derrickbrown.net | easyDNS Technologies, Inc. | 11 Nov 2020 | 22 Dec 2023 | 11 Nov 2023 |
| 509 | derryfieldalumni.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 510 | derrickrachelholdings.com | OnlineNIC, Inc. | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 511 | derricklancejohnson.com | NameCheap, Inc. | 11 Dec 2014 | 11 Nov 2023 | 11 Dec 2024 |
| 512 | derrickadjie.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 513 | derricklouiephotography.com | Tucows Domains Inc. | 11 Dec 2014 | 15 Dec 2022 | 11 Dec 2022 |
| 514 | derrickchenry.com | GoDaddy.com, LLC | 11 Dec 2014 | 12 Dec 2023 | 11 Dec 2024 |
| 515 | derracingseries.net | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 516 | derreckt.com | GoDaddy.com, LLC | 6 Dec 2021 | 7 Dec 2023 | 6 Dec 2024 |
| 517 | derryprintstudios.com | eNom, Inc. | 13 Dec 2014 | 12 Dec 2023 | 13 Dec 2024 |
| 518 | derrollerspezialist.com | 1&1 Internet AG | 3 Feb 2019 | 3 Feb 2019 | 3 Feb 2020 |
| 519 | derricpark.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 520 | derrenrobb.com | Tucows Domains Inc. | 15 Dec 2014 | 19 Dec 2019 | 15 Dec 2019 |
| 521 | derryberrywindowcleaning.com | GoDaddy.com, LLC | 21 Aug 2018 | 2 Sep 2024 | 21 Aug 2025 |
| 522 | derrickpizarro.com | FastDomain Inc. | 16 Dec 2014 | 30 Nov 2023 | 16 Dec 2024 |
| 523 | derry-local.com | Name.com, Inc. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 524 | derrynedwards.com | GoDaddy.com, LLC | 22 May 2017 | 23 May 2023 | 22 May 2025 |
| 525 | derryestateagents.com | Key-Systems GmbH | 12 Aug 2020 | 12 Aug 2020 | 12 Aug 2021 |
| 526 | derrrrrn.com | Tucows Domains Inc. | 14 Dec 2010 | 18 Dec 2014 | 14 Dec 2015 |
| 527 | derriesling.com | RegistryGate GmbH | 17 Dec 2014 | 18 Dec 2023 | 17 Dec 2024 |
| 528 | derragh.com | Beijing Lanhai Jiye Technology Co., Ltd | 26 May 2021 | 27 Jun 2024 | 26 May 2024 |
| 529 | derrieredenim.com | GoDaddy.com, LLC | 14 Jun 2016 | 14 Jun 2016 | 14 Jun 2017 |
| 530 | derriere-denim.com | OVH sas | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 531 | derricktonio.com | Gandi SAS | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 532 | derreisreichtnie.com | Vautron Rechenzentrum AG | 14 May 2018 | 16 May 2024 | 14 May 2025 |
| 533 | derrierediva.com | GoDaddy.com, LLC | 20 Dec 2014 | 28 Nov 2016 | 20 Dec 2017 |
| 534 | derricklowbusinesscard.com | GoDaddy.com, LLC | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 535 | derrickandkatherine.com | Google, Inc. | 21 Dec 2014 | 20 Apr 2024 | 21 Dec 2025 |
| 536 | derrycourts.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 537 | derrickyeek.com | eNom, Inc. | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2015 |
| 538 | derricktoups.com | Dai Nippon Joho System Co., Ltd. | 30 Apr 2022 | 13 Jul 2024 | 30 Apr 2024 |
| 539 | derrickspoolservice.com | Tucows Domains Inc. | 22 Dec 2014 | 26 Dec 2017 | 22 Dec 2017 |
| 540 | derrickspools.com | Tucows Domains Inc. | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 541 | derrickcompany.com | Tucows Domains Inc. | 17 Feb 2000 | 16 Feb 2023 | 17 Feb 2027 |
| 542 | derrickhuntington.com | Name.com, Inc. | 14 Mar 2016 | 21 Feb 2024 | 14 Mar 2025 |
| 543 | derricksfirstwebsite.com | GMO Internet Inc. | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 544 | derrizielpierce.com | Gandi SAS | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 545 | derrickguay.com | Tucows Domains Inc. | 24 Dec 2010 | 28 Dec 2014 | 24 Dec 2015 |
| 546 | derrickcamerino.com | GoDaddy.com, LLC | 28 Dec 2014 | 7 Jul 2016 | 28 Dec 2017 |
| 547 | derrylivelist.com | 1&1 Internet AG | 28 Dec 2014 | 29 Dec 2016 | 28 Dec 2017 |
| 548 | derrsurf.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 549 | derrochandofilosofia.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 550 | derrobin154.com | 1&1 Internet AG | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 551 | derrickunitedjanitorialservice.com | Marcaria.com International, Inc. | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 552 | derrickclarke.info | 1&1 Internet AG | 29 Dec 2014 | - | 29 Dec 2015 |
| 553 | derrty.com | NameKing.com Inc. | 28 Nov 2008 | 26 Dec 2023 | 28 Nov 2024 |
| 554 | derrteeshirts.com | GoDaddy.com, LLC | 4 Apr 2024 | 4 Apr 2024 | 4 Apr 2025 |
| 555 | derrio.com | Dynadot, LLC | 29 Mar 2018 | 31 Mar 2024 | 29 Mar 2025 |
| 556 | derrikjlang.com | Automattic Inc. | 31 Dec 2014 | 25 Oct 2023 | 31 Dec 2024 |
| 557 | derrikandkyler.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2016 |
| 558 | derrickmotel.com | FastDomain Inc. | 23 Mar 2018 | 7 Mar 2024 | 23 Mar 2025 |
| 559 | derringtonstandardpoodles.com | Tucows Domains Inc. | 3 Jan 2015 | 7 Jan 2016 | 3 Jan 2017 |
| 560 | derringstone.com | Webfusion Ltd. | 2 Jan 2015 | 3 Jan 2024 | 2 Jan 2025 |
| 561 | derrickheeney.com | Network Solutions, LLC | 2 Jan 2015 | 31 Dec 2016 | 2 Jan 2018 |
| 562 | derrickgilland.com | NameCheap, Inc. | 2 Jan 2015 | 3 Dec 2023 | 2 Jan 2025 |
| 563 | derrinharveyvo.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2017 |
| 564 | derringerdentalcare.com | GoDaddy.com, LLC | 4 Jan 2015 | 29 Dec 2023 | 4 Jan 2025 |
| 565 | derrickrose-shoes.com | URL Solutions, Inc. | 4 Jan 2015 | 10 Jan 2024 | 4 Jan 2025 |
| 566 | derricklarane.com | GoDaddy.com, LLC | 3 Jan 2015 | 7 May 2023 | 3 Jan 2026 |
| 567 | derrekhull.com | Tucows Domains Inc. | 3 Jan 2015 | 7 Jan 2019 | 3 Jan 2019 |
| 568 | derreal.com | Wild West Domains, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 569 | derryastros.com | Key-Systems GmbH | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 570 | derricho.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2017 |
| 571 | derrelgambler.com | GoDaddy.com, LLC | 3 Aug 2020 | 3 Aug 2020 | 3 Aug 2021 |
| 572 | derrickwilliams.info | Wild West Domains, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 573 | derry.voting | RegistryGate GmbH | 23 Jul 2014 | - | 23 Jul 2015 |
| 574 | derrywedding.photography | 101domain, Inc. | 22 Jul 2014 | 22 Jul 2014 | 22 Jul 2015 |
| 575 | derryinsurance.xyz | Network Solutions, LLC | 27 Jul 2014 | 27 Jul 2014 | 27 Jul 2015 |
| 576 | derren.photo | 1&1 Internet AG | 27 Jul 2014 | 10 Sep 2016 | 27 Jul 2017 |
| 577 | derricksky.xyz | Network Solutions, LLC | 28 Jul 2014 | 29 Jul 2014 | 28 Jul 2015 |
| 578 | derrick.voting | RegistryGate GmbH | 24 Jul 2014 | - | 24 Jul 2015 |
| 579 | derrymeeting.house | Tucows Domains Inc. | 30 Jul 2014 | 29 Jul 2024 | 30 Jul 2025 |
| 580 | derrick.guru | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 581 | derrick.wtf | NameCheap, Inc. | 12 Sep 2016 | 18 Aug 2024 | 12 Sep 2025 |
| 582 | derringer.rocks | DomainSite, Inc. | 6 Aug 2014 | 6 Aug 2014 | 6 Aug 2015 |
| 583 | derrick.rocks | Blue Razor Domains, LLC | 6 Aug 2014 | 6 Aug 2024 | 6 Aug 2025 |
| 584 | derrickrose.shoes | 1&1 Internet AG | 4 Aug 2014 | 4 Aug 2014 | 4 Aug 2015 |
| 585 | derrekdowns.webcam | 1API GmbH | 1 Jul 2014 | - | 30 Jun 2015 |
| 586 | derrav.photography | GoDaddy.com, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 587 | derring.events | united-domains AG | 16 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 588 | derring.digital | united-domains AG | 16 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 589 | derribos.uno | Soluciones Corporativas IP, SLU | 7 Sep 2014 | - | 6 Sep 2015 |
| 590 | derrick.hiphop | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 591 | derring.place | united-domains AG | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 592 | derrick.codes | Amazon Registrar, Inc. | 28 Mar 2024 | 12 Apr 2024 | 28 Mar 2025 |
| 593 | derriedberger.immobilien | Key-Systems, LLC | 9 Oct 2014 | 23 Nov 2017 | 9 Oct 2018 |
| 594 | derrickdodge.credit | Webnames.ca Inc. | 23 Oct 2014 | 29 Nov 2017 | 23 Oct 2018 |
| 595 | derry.xyz | West263 International Limited | 22 Sep 2021 | 25 May 2024 | 22 Sep 2026 |
| 596 | derryjsc.com | Launchpad, Inc. | 11 Aug 2015 | 27 Jul 2017 | 11 Aug 2018 |
| 597 | derrickmarshall.org | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 598 | derrickmarshall.net | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 599 | derrickmarshall.info | GoDaddy.com, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 600 | derrethjohnson.realtor | Name Share, Inc. | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 601 | derrechtsanwalt.wien | EPAG Domainservices GmbH | 12 Nov 2014 | 12 Nov 2023 | 12 Nov 2024 |
| 602 | derrick.pics | 1API GmbH | 19 Nov 2014 | 11 Sep 2017 | 19 Nov 2018 |
| 603 | derrylma.pink | 1API GmbH | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 604 | derregistrar.hosting | 1API GmbH | 25 Nov 2014 | 29 Feb 2024 | 25 Nov 2024 |
| 605 | derryvillage.webcam | Alpnames Limited | 27 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 606 | derryvillage.trade | Alpnames Limited | 27 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 607 | derriennic.bzh | 1&1 Internet AG | 4 Dec 2014 | 4 Dec 2016 | 4 Dec 2017 |
| 608 | derrien.bzh | Gandi SAS | 4 Dec 2014 | 1 Dec 2017 | 4 Dec 2018 |
| 609 | derrty.fitness | eNom, Inc. | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 610 | derrickbass.dance | Google, Inc. | 12 Dec 2014 | 26 Jan 2017 | 12 Dec 2017 |
| 611 | derritory.red | GMO Internet Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 612 | derrickgoh.website | eNom, Inc. | 31 Dec 2014 | 13 Mar 2017 | 31 Dec 2017 |
| 613 | derrick.technology | GoDaddy.com, LLC | 13 Jan 2015 | 6 Jul 2024 | 13 Jan 2028 |
| 614 | derrick.solutions | GoDaddy.com, LLC | 13 Jan 2015 | 6 Jul 2024 | 13 Jan 2028 |
| 615 | derrowshirkeyfordmontpelier.com | Brandsight, Inc. | 12 Aug 2015 | 13 Jul 2024 | 12 Aug 2025 |
| 616 | derronard.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 617 | derringerguns.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 618 | derrickwalton.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 619 | derrickwalton.org | NameCheap, Inc. | 12 Aug 2015 | 18 Jul 2024 | 12 Aug 2025 |
| 620 | derradji.pics | OVH sas | 12 Aug 2015 | 1 Aug 2024 | 12 Aug 2025 |
| 621 | derradji.photos | OVH sas | 12 Aug 2015 | 10 Jul 2024 | 12 Aug 2025 |
| 622 | derrickbriscoe.photo | eNom, Inc. | 28 Jan 2015 | 11 Mar 2017 | 28 Jan 2017 |
| 623 | derrickalanhiggins.realtor | Name Share, Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 624 | derrymore.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 625 | derry.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 626 | derrickcity.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 627 | derrow.coach | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 628 | derritor.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2015 | - | 8 Mar 2016 |
| 629 | derrickmurray.website | Global Domains International, Inc. DBA DomainCostC… | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 630 | derrytaberna.eus | Key-Systems, LLC | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 631 | derrick.services | GoDaddy.com, LLC | 15 Sep 2016 | 19 Jul 2024 | 15 Sep 2025 |
| 632 | derrick.equipment | Network Solutions, LLC | 13 Nov 2021 | 19 Sep 2023 | 13 Nov 2024 |
| 633 | derrick.business | eNom, Inc. | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 634 | derrick.international | GoDaddy.com, LLC | 7 May 2021 | 26 Jul 2023 | 7 May 2026 |
| 635 | derry.london | Mesh Digital Limited | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 636 | derraworlphy.science | Alpnames Limited | 2 Apr 2015 | - | 1 Apr 2016 |
| 637 | derracelent.science | Alpnames Limited | 1 Apr 2015 | - | 31 Mar 2016 |
| 638 | derrick.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 639 | derred.work | Instra Corporation Pty Ltd. | 9 Apr 2015 | 10 Apr 2015 | 9 Apr 2016 |
| 640 | derriere.tokyo | GMO Internet Inc. | 13 Aug 2015 | - | 13 Aug 2016 |
| 641 | derrickhutchinson.com | GoDaddy.com, LLC | 13 Aug 2015 | 19 Sep 2022 | 13 Aug 2025 |
| 642 | derrickelaw.info | GoDaddy.com, LLC | 13 Aug 2015 | 25 Aug 2023 | 13 Aug 2024 |
| 643 | derryvillage.science | Alpnames Limited | 24 Feb 2015 | 1 May 2015 | 23 Feb 2016 |
| 644 | derry.science | Alpnames Limited | 24 Feb 2015 | 1 May 2015 | 23 Feb 2016 |
| 645 | derrybeg.xyz | Gandi SAS | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 646 | derrickvw.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 647 | derriere-ecology.com | Network Solutions, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 648 | derrickshomesforsale.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 649 | derricklelacheur.com | GoDaddy.com, LLC | 7 Jan 2015 | 5 Dec 2023 | 4 Dec 2024 |
| 650 | derrickdoesit.com | GoDaddy.com, LLC | 30 Jun 2018 | 30 Jun 2018 | 30 Jun 2019 |
| 651 | derrickcpa.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2018 |
| 652 | derrylinks.com | Internet Domain Services BS Corp | 28 Dec 1999 | 14 May 2016 | 28 Dec 2017 |
| 653 | derricknorrisphotographer.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 654 | derricknorrisphotograpgher.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Jan 2015 | 7 Jan 2015 | 7 Jan 2016 |
| 655 | derrytreskgac.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 7 Jan 2024 | 8 Jan 2025 |
| 656 | derricksl-uae.com | Webfusion Ltd. | 8 Jan 2015 | 9 Jan 2024 | 8 Jan 2025 |
| 657 | derrickmcleod.com | GoDaddy.com, LLC | 21 Jun 2019 | 21 Jun 2024 | 21 Jun 2025 |
| 658 | derradji.photo | OVH sas | 14 Aug 2015 | 28 Jun 2016 | 14 Aug 2017 |
| 659 | derrax.com | Annulet LLC | 16 Jun 2005 | 3 Aug 2024 | 16 Jun 2025 |
| 660 | derrymusiccity.com | Tucows Domains Inc. | 6 Jan 2014 | 10 Jan 2015 | 6 Jan 2016 |
| 661 | derrint.com | Domain.com, LLC | 26 Apr 2006 | 10 Jan 2015 | 26 Apr 2015 |
| 662 | derrielandersonmoving.com | Tucows Domains Inc. | 7 Jan 2009 | 11 Jan 2018 | 7 Jan 2018 |
| 663 | derrias.com | Uniregistrar Corp | 30 Jul 2020 | 31 Jul 2024 | 30 Jul 2025 |
| 664 | derriant.com | Domain.com, LLC | 26 Apr 2006 | 10 Jan 2015 | 26 Apr 2015 |
| 665 | derrial.com | Domain.com, LLC | 26 Apr 2006 | 10 Jan 2015 | 26 Apr 2015 |
| 666 | derria.com | Annulet LLC | 19 Jul 2005 | 4 Sep 2023 | 19 Jul 2024 |
| 667 | derreon.com | Annulet LLC | 26 Apr 2006 | 13 Jun 2024 | 26 Apr 2025 |
| 668 | derreo.com | Domain.com, LLC | 26 Apr 2006 | 10 Jan 2015 | 26 Apr 2015 |
| 669 | derrent.com | Realtime Register B.V. | 21 May 2024 | 4 Sep 2024 | 21 May 2025 |
| 670 | derryweb.com | DropCatch.com 370 LLC | 11 Jan 2015 | 12 Jan 2017 | 11 Jan 2018 |
| 671 | derrickblue.com | GoDaddy.com, LLC | 3 Jul 2019 | 3 Jul 2019 | 3 Jul 2021 |
| 672 | derrellowens.com | Network Solutions, LLC | 11 Jan 2015 | 1 Jul 2017 | 11 Jan 2022 |
| 673 | derrel.us | NameCheap, Inc. | 11 Jan 2015 | 7 Mar 2019 | 10 Jan 2026 |
| 674 | derrysellshouses.com | Tucows Domains Inc. | 13 Jan 2015 | 17 Jan 2016 | 13 Jan 2017 |
| 675 | derrypropertiesllc.com | Tucows Domains Inc. | 13 Jan 2015 | 17 Jan 2016 | 13 Jan 2017 |
| 676 | derrynaneinshorerescue.com | CloudFlare, Inc. | 13 Jan 2015 | 11 Jan 2023 | 13 Jan 2025 |
| 677 | derrybuyshouses.com | Tucows Domains Inc. | 13 Jan 2015 | 17 Jan 2016 | 13 Jan 2017 |
| 678 | derrickbutts.com | GoDaddy.com, LLC | 14 Nov 2019 | 31 Oct 2022 | 14 Nov 2024 |
| 679 | derreklett.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 680 | derricomultimedia.com | Network Solutions, LLC | 14 Jan 2015 | 5 Mar 2017 | 14 Jan 2018 |
| 681 | derrickjohnmorrison.com | Tucows Domains Inc. | 28 Apr 2011 | 2 May 2020 | 28 Apr 2020 |
| 682 | derrickdar.com | GoDaddy.com, LLC | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2017 |
| 683 | derricksdelicacieskingslynn.com | Tucows Domains Inc. | 15 Jan 2015 | 19 Jan 2016 | 15 Jan 2017 |
| 684 | derrera.com | GoDaddy.com, LLC | 11 Apr 2020 | 14 Nov 2022 | 11 Apr 2026 |
| 685 | derrenbrowntricks.com | Internet.bs Corp. | 14 Jan 2014 | 15 Jan 2015 | 14 Jan 2016 |
| 686 | derrenbrownsecrets.com | Internet.bs Corp. | 14 Jan 2014 | 15 Jan 2015 | 14 Jan 2016 |
| 687 | derruetz.name | - | - | - | - |
| 688 | derrickkeith.net | FastDomain Inc. | 14 Jan 2015 | 11 Feb 2019 | 14 Jan 2019 |
| 689 | derrywoodhealthcare.com | Register.it SPA | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 690 | derrolthorn.com | Web Drive Ltd | 17 Jan 2015 | 17 Jan 2015 | 17 Jan 2016 |
| 691 | derrickbutts.org | 1API GmbH | 25 Nov 2022 | 11 Jan 2024 | 25 Nov 2024 |
| 692 | derrickbutts.net | eNom, Inc. | 7 Jan 2019 | 7 Jan 2019 | 7 Jan 2020 |
| 693 | derrickbutts.info | Domain.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2017 |
| 694 | derrick.mobi | GoDaddy.com, LLC | 13 Jan 2015 | 6 Jul 2024 | 13 Jan 2025 |
| 695 | derrechtsanwalt.tirol | InterNetworX Ltd. & Co. KG | 1 Jun 2015 | 1 Jun 2024 | 1 Jun 2025 |
| 696 | derrycityfootball.club | 1API GmbH | 7 May 2014 | 12 Jun 2015 | 6 May 2016 |
| 697 | derritors.work | Minds + Machines Registrar Limited | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 698 | derricknylander.website | Global Domains International, Inc. DBA DomainCostC… | 22 Apr 2015 | 13 Jun 2015 | 22 Apr 2016 |
| 699 | derrick.website | GoDaddy.com, LLC | 15 Sep 2016 | 8 Jun 2024 | 15 Sep 2024 |
| 700 | derrick.wang | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 6 Sep 2021 | - | 6 Sep 2022 |
| 701 | derryvillage.date | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 702 | derry.date | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 703 | derringer.agency | 1&1 Internet AG | 1 Jul 2015 | 1 Jul 2017 | 1 Jul 2018 |
| 704 | derryvillage.faith | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 705 | derryhotels.review | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 706 | derry.faith | Alpnames Limited | 2 Jul 2015 | - | 1 Jul 2016 |
| 707 | derryvillage.review | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 708 | derry.review | Alpnames Limited | 1 Jul 2015 | - | 30 Jun 2016 |
| 709 | derryvillagehotels.review | Alpnames Limited | 4 Jul 2015 | - | 3 Jul 2016 |
| 710 | derrouiche.com | OVH sas | 16 Aug 2015 | 17 Aug 2024 | 16 Aug 2025 |
| 711 | derrigtalbot.com | Sibername Internet and Software Technologies Inc. | 17 Aug 2015 | 12 Aug 2024 | 17 Aug 2025 |
| 712 | derrickbythegrape.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2017 | 5 Nov 2017 | 5 Nov 2018 |
| 713 | derryvillage.accountant | Alpnames Limited | 7 Aug 2015 | - | 6 Aug 2016 |
| 714 | derr66.com | Network Solutions, LLC | 17 Jan 2015 | 24 May 2024 | 17 Jan 2025 |
| 715 | derrierelevolant.com | GoDaddy.com, LLC | 13 Apr 2022 | 30 Sep 2022 | 13 Apr 2025 |
| 716 | derricknylander.com | Porkbun, LLC | 20 Jan 2015 | 14 Jan 2024 | 20 Jan 2025 |
| 717 | derregalo.com | Network Solutions, LLC | 13 Nov 2018 | 13 Nov 2018 | 13 Nov 2019 |
| 718 | derryrunner.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 719 | derry07.com | - | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2017 |
| 720 | derrinngercompany.com | Tucows Domains Inc. | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 721 | derricprice.com | GoDaddy.com, LLC | 25 Jan 2023 | 25 Jan 2023 | 25 Jan 2025 |
| 722 | derronpayne.com | GoDaddy.com, LLC | 9 Sep 2021 | 12 Sep 2024 | 9 Sep 2025 |
| 723 | derrickdove.com | Tucows Domains Inc. | 1 May 2008 | 6 Apr 2024 | 1 May 2025 |
| 724 | derr4eerfew.com | Tucows Domains Inc. | 16 Jan 2014 | 20 Jan 2015 | 16 Jan 2016 |
| 725 | derricknylander.net | Porkbun, LLC | 20 Jan 2015 | 14 Jan 2024 | 20 Jan 2025 |
| 726 | derrechercheur.net | GMO Internet Inc. | 5 Apr 2017 | 5 Apr 2017 | 5 Apr 2018 |
| 727 | derr4eerfewga.net | Tucows Domains Inc. | 16 Jan 2014 | 20 Jan 2015 | 16 Jan 2016 |
| 728 | derr4eerfewalbany.net | Tucows Domains Inc. | 16 Jan 2014 | 20 Jan 2015 | 16 Jan 2016 |
| 729 | derr4eerfew.net | Tucows Domains Inc. | 16 Jan 2014 | 20 Jan 2015 | 16 Jan 2016 |
| 730 | derrydonegalphoto.com | GoDaddy.com, LLC | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 731 | derringermusic.com | DropCatch.com 392 LLC | 21 Jan 2015 | 22 Jan 2017 | 21 Jan 2018 |
| 732 | derricksdetailedwash.com | PSI-USA, Inc. dba Domain Robot | 30 Jun 2021 | 30 Jun 2021 | 30 Jun 2022 |
| 733 | derricklweston.com | Wild West Domains, LLC | 21 Jan 2015 | 22 Dec 2023 | 21 Jan 2026 |
| 734 | derrellcleaneres.com | Tucows Domains Inc. | 18 Jan 2014 | 22 Jan 2015 | 18 Jan 2016 |
| 735 | derribandoelmuro.com | Key-Systems GmbH | 9 Nov 2022 | 23 Jan 2024 | 9 Nov 2023 |
| 736 | derrekgunnells.com | Tucows Domains Inc. | 23 Jan 2015 | 8 Jan 2024 | 23 Jan 2025 |
| 737 | derrauchmacher.com | Vautron Rechenzentrum AG | 23 Jan 2015 | 25 Jan 2017 | 23 Jan 2018 |
| 738 | derrankyle.com | Key-Systems GmbH | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 739 | derryfieldschool.net | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 740 | derrickdavidson.net | Google, Inc. | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 741 | derrickjamesphotography.com | GoDaddy.com, LLC | 6 May 2019 | 6 May 2019 | 6 May 2020 |
| 742 | derrickagius.com | GoDaddy.com, LLC | 24 Jan 2015 | 24 Jan 2015 | 24 Jan 2016 |
| 743 | derrybooks.com | Wix.com Ltd. | 21 Apr 2020 | 22 Mar 2024 | 21 Apr 2025 |
| 744 | derritelodeamorweb.com | Namesilo, LLC | 18 Aug 2015 | 23 Jul 2017 | 18 Aug 2017 |
| 745 | derrickmcallister.net | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 746 | derrick.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 747 | derreich.com | Annulet LLC | 18 Aug 2015 | 5 Oct 2023 | 18 Aug 2024 |
| 748 | derrycityofmusic.com | Tucows Domains Inc. | 13 Apr 2015 | 17 Apr 2017 | 13 Apr 2017 |
| 749 | derrickjonesspeaks.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 750 | derrickcooke.com | 1&1 Internet AG | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 751 | derrickmiller.org | NameCheap, Inc. | 18 May 2024 | 23 May 2024 | 18 May 2025 |
| 752 | derryqueen.com | GoDaddy.com, LLC | 3 May 2023 | 3 May 2023 | 3 May 2024 |
| 753 | derrickwallacefordistrict6.com | GMO Internet Inc. | 31 Jan 2015 | 11 Jan 2017 | 30 Jan 2018 |
| 754 | derricktatumphotography.com | GoDaddy.com, LLC | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 755 | derrickhinmandesign.com | GoDaddy.com, LLC | 30 Jan 2015 | 30 Jan 2024 | 30 Jan 2025 |
| 756 | derrickdstephens.com | DropCatch.com 920 LLC | 17 Apr 2016 | 18 Apr 2017 | 17 Apr 2018 |
| 757 | derreichesack.info | 1&1 Internet AG | 29 Jan 2015 | - | 29 Jan 2016 |
| 758 | derrickortega.com | DropCatch.com 530 LLC | 31 Jan 2015 | 1 Feb 2017 | 31 Jan 2018 |
| 759 | derrickedgar.com | register.com, Inc. | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2018 |
| 760 | derricclemmonsart.net | eNom, Inc. | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 761 | derrettungshund.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Apr 2023 | 26 Mar 2024 | 17 Apr 2025 |
| 762 | derrimax.com | Web Commerce Communications Limited dba WebNic.cc | 10 Oct 2019 | 10 Oct 2019 | 10 Oct 2020 |
| 763 | derrilfilemon.com | Hostinger, UAB | 1 Jul 2024 | 1 Jul 2024 | 1 Jul 2025 |
| 764 | derrickspencephotography.net | Tucows Domains Inc. | 16 Aug 2011 | 20 Aug 2015 | 16 Aug 2016 |
| 765 | derricknelsonguitars.com | Network Solutions, LLC | 19 Aug 2015 | 21 Aug 2024 | 19 Aug 2025 |
| 766 | derrickellisbooks.com | In2net Network, Inc. | 27 Jul 2009 | 25 Jul 2024 | 27 Jul 2025 |
| 767 | derrixedition.com | Moniker Online Services LLC | 7 Jun 2024 | 22 Jun 2024 | 7 Jun 2025 |
| 768 | derricknash.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 769 | derrickmonumentco.com | eNom, Inc. | 2 Feb 2015 | 31 Jan 2017 | 2 Feb 2018 |
| 770 | derricklovejones.com | NameCheap, Inc. | 2 Feb 2015 | 26 Jan 2024 | 2 Feb 2025 |
| 771 | derribosenvalencia.com | GMO Internet Inc. | 13 Jul 2023 | 24 Aug 2024 | 13 Jul 2024 |
| 772 | derrieresvips.com | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 773 | derrickfreske.com | GoDaddy.com, LLC | 3 Feb 2015 | 4 Feb 2024 | 3 Feb 2025 |
| 774 | derraffihovannisian.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 775 | derryberryconcretedesigns.net | eNom, Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 776 | derryscorey.com | Webfusion Ltd. | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2017 |
| 777 | derryrevitalization.com | Internet Domain Services BS Corp | 8 May 2021 | 8 May 2021 | 8 May 2022 |
| 778 | derrickmichael.com | GoDaddy.com, LLC | 2 Oct 2020 | 14 Dec 2023 | 2 Oct 2023 |
| 779 | derrickfree.com | GoDaddy.com, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 780 | derrickansley.com | GoDaddy.com, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 781 | derrickandjennifer.com | MAFF Inc. | 25 May 2018 | 25 May 2018 | 25 May 2019 |
| 782 | derribosyexcavacioneskiko.com | Soluciones Corporativas IP, SLU | 4 Feb 2015 | 28 Nov 2023 | 4 Feb 2025 |
| 783 | derrickbeining.com | Google, Inc. | 21 Jul 2017 | 21 Jul 2017 | 21 Jul 2018 |
| 784 | derrickandkatie.com | eNom, Inc. | 9 Apr 2021 | 9 Apr 2021 | 9 Apr 2022 |
| 785 | derral.com | eNom, Inc. | 5 Feb 2015 | 8 Mar 2023 | 5 Feb 2027 |
| 786 | derricklewis.net | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Apr 2019 | 24 Apr 2019 | 24 Apr 2020 |
| 787 | derricklewis.info | GoDaddy.com, LLC | 4 Feb 2015 | 5 Jan 2016 | 4 Feb 2018 |
| 788 | derrickgeorge.org | Wild West Domains, LLC | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 789 | derrickfree.org | GoDaddy.com, LLC | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 790 | derrtee-shirts.com | GoDaddy.com, LLC | 25 Jan 2021 | 25 Jan 2021 | 25 Jan 2022 |
| 791 | derrota-la-crisis.com | 1&1 Internet AG | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 792 | derrellejaney.com | Wild West Domains, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 793 | derrnco.org | - | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2017 |
| 794 | derrillsharets.review | Alpnames Limited | 20 Aug 2015 | - | 19 Aug 2016 |
| 795 | derrier.net | Dynadot, LLC | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 796 | derrickg.com | eNom, Inc. | 24 Feb 2021 | 24 Feb 2021 | 24 Feb 2022 |
| 797 | derrickdunn.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 798 | derrickcoston.com | Namesilo, LLC | 1 May 2020 | 2 May 2020 | 1 May 2021 |
| 799 | derrickfan.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 800 | derred.info | Limited Liability Company "Registrar of domain nam… | 20 Mar 2018 | 20 Mar 2018 | 20 Mar 2019 |
| 801 | derrotaladiabetes.com | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 802 | derrifmooyy.com | GMO Internet Inc. | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 803 | derrickgage.com | - | 15 Oct 2016 | 15 Oct 2016 | 15 Oct 2018 |
| 804 | derribandolosgigantes.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 805 | derrickdstephens.biz | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 10 Feb 2016 |
| 806 | derricopianoforti1.com | Tucows Domains Inc. | 12 Feb 2015 | 24 Apr 2024 | 12 Feb 2024 |
| 807 | derrickwebinar.com | Tucows Domains Inc. | 8 Feb 2013 | 12 Feb 2015 | 8 Feb 2016 |
| 808 | derricksonmeat.com | Hongkong Domain Name Information Management Co., L… | 20 Nov 2022 | 30 Dec 2023 | 20 Nov 2023 |
| 809 | derrible.info | NameCheap, Inc. | 1 Sep 2017 | 1 Sep 2017 | 1 Sep 2018 |
| 810 | derricksandwick.net | Tucows Domains Inc. | 8 Feb 2008 | 12 Feb 2015 | 8 Feb 2016 |
| 811 | derrickdstephens.net | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 812 | derrickdstephens.info | GoDaddy.com, LLC | 11 Feb 2015 | - | 11 Feb 2016 |
| 813 | derricksandwick.org | Tucows Domains Inc. | 8 Feb 2008 | 12 Feb 2015 | 8 Feb 2016 |
| 814 | derrickmattis.com | GoDaddy.com, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2018 |
| 815 | derrylove.info | GoDaddy.com, LLC | 13 Feb 2015 | - | 13 Feb 2016 |
| 816 | derrickpouliot.com | CloudFlare, Inc. | 31 Mar 2022 | 28 Jul 2024 | 31 Mar 2025 |
| 817 | derrickpeever.com | Launchpad, Inc. | 15 Feb 2015 | 15 Feb 2017 | 15 Feb 2018 |
| 818 | derrickpayton.com | Network Solutions, LLC | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 819 | derrytimes.com | TurnCommerce, Inc. DBA NameBright.com | 8 Nov 2018 | 2 Nov 2020 | 8 Nov 2024 |
| 820 | derryradio.com | eNom, Inc. | 21 Aug 2015 | 23 Jul 2017 | 21 Aug 2018 |
| 821 | derryalert.com | TurnCommerce, Inc. DBA NameBright.com | 21 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 822 | derricksouthworth.com | Tucows Domains Inc. | 30 Jul 2018 | 26 Jul 2024 | 30 Jul 2025 |
| 823 | derrickrealtor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2017 | 8 Jul 2017 | 8 May 2018 |
| 824 | derrickpatterson.com | CloudFlare, Inc. | 6 Nov 2022 | 19 Oct 2023 | 6 Nov 2024 |
| 825 | derrickousley.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 826 | derrickkrumlauf.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 827 | derrickboundsmusic.com | Wild West Domains, LLC | 19 May 2016 | 1 Jun 2024 | 19 May 2025 |
| 828 | derricklspratley.com | Dynadot, LLC | 4 Nov 2021 | 5 Nov 2021 | 4 Nov 2022 |
| 829 | derrellgambler.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jul 2017 | 25 Jul 2017 | 25 Jul 2018 |
| 830 | derrickkrumlauf.net | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 831 | derrickkrumlauf.info | GoDaddy.com, LLC | 18 Feb 2015 | - | 18 Feb 2016 |
| 832 | derrickkrumlauf.org | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 833 | derrickcwright.com | GoDaddy.com, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2017 |
| 834 | derrekfalor.com | GoDaddy.com, LLC | 19 Feb 2015 | 20 Feb 2024 | 19 Feb 2026 |
| 835 | derraping.com | 1&1 Internet AG | 19 Feb 2015 | 8 Mar 2018 | 19 Feb 2025 |
| 836 | derry-income.com | eNom, Inc. | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 837 | derrmstuff.com | eNom, Inc. | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 838 | derrmglow.com | eNom, Inc. | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 839 | derrickburbage.com | 1&1 Internet AG | 21 Feb 2015 | 8 Mar 2018 | 21 Feb 2025 |
| 840 | derrellleggett.com | GoDaddy.com, LLC | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2018 |
| 841 | derrah.org | GoDaddy.com, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 842 | derrah.net | GoDaddy.com, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 843 | derrah.info | GoDaddy.com, LLC | 19 Feb 2015 | - | 19 Feb 2016 |
| 844 | derrmify.com | eNom, Inc. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 845 | derrickladkins.com | register.com, Inc. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 846 | derraschicboutique.com | 1&1 Internet AG | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 847 | derrynhfleamarket.net | GoDaddy.com, LLC | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 848 | derryurgentdentalcare.com | GoDaddy.com, LLC | 23 Feb 2015 | 27 Feb 2023 | 23 Feb 2025 |
| 849 | derryurgentdental.com | GoDaddy.com, LLC | 23 Feb 2015 | 27 Feb 2023 | 23 Feb 2025 |
| 850 | derryndavies.com | Tucows Domains Inc. | 23 Feb 2015 | 27 Feb 2022 | 23 Feb 2022 |
| 851 | derrylin-plant.com | Tucows Domains Inc. | 20 Feb 2013 | 24 Feb 2015 | 20 Feb 2016 |
| 852 | derrycoxphotography.com | FastDomain Inc. | 23 Feb 2015 | 23 Feb 2017 | 23 Feb 2018 |
| 853 | derrycommunityscreen.com | Key-Systems GmbH | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 854 | derrickslaughter.com | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2017 |
| 855 | derrickcobb.com | DropCatch.com 1037 LLC | 13 Dec 2021 | 13 Jan 2024 | 13 Dec 2023 |
| 856 | derrickboden.com | Launchpad, Inc. | 23 Feb 2015 | 8 Feb 2024 | 23 Feb 2025 |
| 857 | derricocostruzioni.com | Tucows Domains Inc. | 21 Feb 2005 | 25 Feb 2015 | 21 Feb 2016 |
| 858 | derricocostruzioni.biz | Tucows Domains Inc. | 21 Feb 2005 | 24 Feb 2015 | 20 Feb 2015 |
| 859 | derrickrozario.com | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 860 | derrickjammison.com | Tucows Domains Inc. | 24 Feb 2015 | 1 Mar 2019 | 24 Feb 2020 |
| 861 | derrickcharles.com | eNom, Inc. | 24 Feb 2015 | 14 Mar 2017 | 24 Feb 2018 |
| 862 | derringher.com | GoDaddy.com, LLC | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 863 | derringersanantonio.com | Domain.com, LLC | 26 Feb 2015 | 11 Feb 2017 | 26 Feb 2018 |
| 864 | derriereaficionado.com | 1&1 Internet AG | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 865 | derricocostruzioni.net | Tucows Domains Inc. | 21 Feb 2005 | 25 Feb 2015 | 21 Feb 2016 |
| 866 | derricocostruzioni.info | Tucows Domains Inc. | 21 Feb 2005 | 25 Feb 2015 | 21 Feb 2016 |
| 867 | derrickjonesburnfoundation.org | GoDaddy.com, LLC | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 868 | derrekpowell.net | Tucows Domains Inc. | 22 Feb 2015 | 26 Feb 2017 | 22 Feb 2017 |
| 869 | derrelsofsothan.com | - | - | - | - |
| 870 | derricocostruzioni.org | Tucows Domains Inc. | 21 Feb 2005 | 25 Feb 2015 | 21 Feb 2016 |
| 871 | derrekholland.com | GoDaddy.com, LLC | 26 Feb 2015 | 18 Sep 2022 | 26 Feb 2030 |
| 872 | derreblauser.com | 1API GmbH | 26 Feb 2015 | 26 Apr 2023 | 26 Feb 2025 |
| 873 | derrytele.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 874 | derrysulaiman.com | CV. Rumahweb Indonesia | 4 Sep 2019 | - | 4 Sep 2020 |
| 875 | derryanddaisy.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2017 |
| 876 | derrickfortucson.com | DreamHost, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 877 | derrickthomas.biz | GoDaddy.com, LLC | 28 Feb 2015 | 1 Mar 2017 | 27 Feb 2018 |
| 878 | derrickc.info | GoDaddy.com, LLC | 28 Feb 2015 | 27 Feb 2019 | 28 Feb 2021 |
| 879 | derrick1.info | GoDaddy.com, LLC | 1 Mar 2015 | - | 1 Mar 2016 |
| 880 | derrickmv.com | FastDomain Inc. | 1 Mar 2015 | 1 Mar 2017 | 1 Mar 2018 |
| 881 | derryworker.com | GoDaddy.com, LLC | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 882 | derringtonforex.com | Webfusion Ltd. | 2 Mar 2015 | 23 Feb 2017 | 2 Mar 2018 |
| 883 | derringtoncapital.com | Webfusion Ltd. | 25 Sep 2018 | 18 Sep 2023 | 25 Sep 2024 |
| 884 | derringerdr.com | CloudFlare, Inc. | 3 Mar 2015 | 23 Sep 2023 | 3 Mar 2025 |
| 885 | derrickbaskin.com | Network Solutions, LLC | 3 Mar 2015 | 8 May 2024 | 3 Mar 2027 |
| 886 | derrycraftvillagecollective.com | Wild West Domains, LLC | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 887 | derrmalift.com | eNom, Inc. | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 888 | derricklewisbasketball.com | GoDaddy.com, LLC | 3 Mar 2015 | 4 Mar 2024 | 3 Mar 2025 |
| 889 | derrickhasabuyer.com | GoDaddy.com, LLC | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 890 | derrickanthonyjones.com | Tucows Domains Inc. | 28 Feb 2012 | 4 Mar 2015 | 28 Feb 2016 |
| 891 | derreichredner.com | Mesh Digital Limited | 3 Mar 2015 | 3 Mar 2017 | 3 Mar 2018 |
| 892 | derrydrivinglessons.com | Uniregistrar Corp | - | - | - |
| 893 | derrycityandstrabane.com | Mesh Digital Limited | 4 Mar 2015 | 28 Feb 2024 | 4 Mar 2026 |
| 894 | derryandstrabane.com | Mesh Digital Limited | 4 Mar 2015 | 28 Feb 2024 | 4 Mar 2026 |
| 895 | derrickroses.com | GoDaddy.com, LLC | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 896 | derrickradford.com | GMO Internet Inc. | 8 Aug 2023 | 1 Aug 2024 | 8 Aug 2025 |
| 897 | derrickadkinsmma.com | DropCatch.com 1465 LLC | 1 Feb 2018 | 1 Feb 2018 | 1 Feb 2019 |
| 898 | derrotebaron.com | GMO Internet Inc. | 7 Jun 2019 | 7 Jun 2019 | 7 Jun 2020 |
| 899 | derrmasky.com | eNom, Inc. | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 900 | derrikemiller.com | Tucows Domains Inc. | 5 Mar 2015 | 9 Mar 2016 | 5 Mar 2017 |
| 901 | derrickyangslp.com | Name.com, Inc. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 902 | derrickengoy.us | GoDaddy.com, LLC | 5 Mar 2015 | 10 Mar 2024 | 4 Mar 2025 |
| 903 | derrickcalacsan.com | GoDaddy.com, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 904 | derrik-elevator.com | Hangzhou Best Domain Technology Co., LTD | 10 Oct 2022 | 10 Oct 2023 | 10 Oct 2024 |
| 905 | derrie-air.com | GoDaddy.com, LLC | 10 Sep 2019 | 30 Oct 2022 | 10 Sep 2024 |
| 906 | derrickmcmeanssharingthehope.com | - | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 907 | derrickhho.com | Key-Systems GmbH | 10 Nov 2022 | 23 Jan 2024 | 10 Nov 2023 |
| 908 | derrickgreaves.com | Webfusion Ltd. | 24 Aug 2015 | 17 Aug 2023 | 24 Aug 2026 |
| 909 | derrick-darby.com | GoDaddy.com, LLC | 24 Aug 2015 | 25 Aug 2015 | 24 Aug 2016 |
| 910 | derricmcrae.com | Hosting Concepts B.V. dba Openprovider | 13 Nov 2021 | 15 Nov 2021 | 13 Nov 2022 |
| 911 | derrickfleming.com | Google, Inc. | 22 Nov 2022 | 19 Apr 2024 | 22 Nov 2024 |
| 912 | derrickadhipratama.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 913 | derrik-elevator.net | - | 10 Aug 2016 | 10 Aug 2016 | 10 Aug 2017 |
| 914 | derrochedeamor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jun 2020 | 9 Jun 2020 | 9 Jun 2021 |
| 915 | derrickspa.com | register.com, Inc. | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2017 |
| 916 | derrebe.com | Tucows Domains Inc. | 10 Mar 2015 | 14 Mar 2017 | 10 Mar 2017 |
| 917 | derricksmith.us | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2017 | 8 Mar 2018 |
| 918 | derrickbattle.com | FastDomain Inc. | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 919 | derrellejaney.net | Wild West Domains, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 920 | derricks-of-destiny.com | NameCheap, Inc. | 12 Mar 2015 | 11 Feb 2024 | 12 Mar 2025 |
| 921 | derrickvianna.com | Tucows Domains Inc. | 6 Mar 2014 | 20 Feb 2024 | 6 Mar 2025 |
| 922 | derrickalexander.com | Dynadot, LLC | 28 Sep 2023 | 10 Jan 2024 | 28 Sep 2024 |
| 923 | derracuda.com | Wild West Domains, LLC | 14 Mar 2015 | 14 Mar 2015 | 14 Mar 2016 |
| 924 | derryinspiringstyles.net | Domain.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2017 |
| 925 | derryhistorymuseum.com | Tucows Domains Inc. | 1 Jun 2020 | 31 May 2024 | 1 Jun 2025 |
| 926 | derrickswerve.com | Tucows Domains Inc. | 14 Mar 2015 | 18 Mar 2017 | 14 Mar 2017 |
| 927 | derrickrdesigns.com | Domain.com, LLC | 14 Mar 2015 | 1 Mar 2017 | 14 Mar 2018 |
| 928 | derrinperkins.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 929 | derringerproducts.com | GoDaddy.com, LLC | 25 Aug 2015 | 26 Aug 2023 | 25 Aug 2025 |
| 930 | derridge2.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 931 | derrickriddle.com | Hosting Concepts B.V. dba Openprovider | 25 Aug 2015 | 1 Aug 2024 | 25 Aug 2024 |
| 932 | derrickhooks.com | eNom, Inc. | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 933 | derrickbrinkman.com | Tucows Domains Inc. | 25 Aug 2015 | 11 Aug 2024 | 25 Aug 2025 |
| 934 | derret.com | - | 26 Feb 2018 | 23 Feb 2024 | 26 Feb 2025 |
| 935 | derrickandjamie.com | DreamHost, LLC | 26 Jun 2016 | 26 Jun 2016 | 26 Jun 2017 |
| 936 | derryhistorymuseum.org | Tucows Domains Inc. | 14 Mar 2015 | 13 Mar 2017 | 14 Mar 2018 |
| 937 | derryfleadh.com | Tucows Domains Inc. | 13 Mar 2004 | 17 Mar 2015 | 13 Mar 2016 |
| 938 | derrickwee.com | GoDaddy.com, LLC | 17 Mar 2015 | 17 Mar 2024 | 17 Mar 2025 |
| 939 | derrickmcrae.com | DropCatch.com 499 LLC | 16 Mar 2015 | 17 Mar 2017 | 16 Mar 2018 |
| 940 | derrickbrucks.com | Wild West Domains, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 941 | derrelldayrealty.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 942 | derrellday.com | GoDaddy.com, LLC | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 943 | derrickthomasacademy.org | GMO Internet Inc. | 1 Sep 2017 | 1 Sep 2017 | 1 Sep 2018 |
| 944 | derrickkinney.com | Domain.com, LLC | 29 Jun 2000 | 18 Jun 2024 | 29 Jun 2025 |
| 945 | derrickjessica.com | GoDaddy.com, LLC | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 946 | derrickjamesmiller.com | GoDaddy.com, LLC | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 947 | derricktyranblog.com | Domain.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 948 | derrickharveydesign.com | NameCheap, Inc. | 8 Jul 2020 | 19 Jun 2024 | 8 Jul 2025 |
| 949 | derrickandterryshowcom.com | GoDaddy.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2017 |
| 950 | derrickandterry.com | GoDaddy.com, LLC | 19 Mar 2015 | 18 Sep 2022 | 19 Mar 2027 |
| 951 | derroy.com | GoDaddy.com, LLC | 20 Sep 2022 | 20 Sep 2022 | 20 Sep 2023 |
| 952 | derrickwidmark.com | NameCheap, Inc. | 20 Mar 2015 | 19 Feb 2024 | 20 Mar 2025 |
| 953 | derrickldavis.com | GoDaddy.com, LLC | 26 Aug 2015 | 31 Aug 2024 | 26 Aug 2025 |
| 954 | derrickpinkus.com | Melbourne IT, Ltd | 22 Jun 2018 | 16 Jun 2024 | 22 Jun 2025 |
| 955 | derrickandterryshow.com | GoDaddy.com, LLC | 22 Mar 2015 | 23 Mar 2023 | 22 Mar 2025 |
| 956 | derringdo-7ha.com | GMO Internet Inc. | 23 Mar 2015 | 24 Mar 2015 | 23 Mar 2016 |
| 957 | derrickloving.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 958 | derrickkollock.com | Tucows Domains Inc. | 6 Dec 2020 | 2 Dec 2023 | 6 Dec 2024 |
| 959 | derrickchhaydesign.com | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 960 | derrygmosafety.com | Key-Systems GmbH | 24 Mar 2015 | 29 Apr 2015 | 24 Mar 2016 |
| 961 | derriencpa.com | Tucows Domains Inc. | 24 Mar 2015 | 28 Dec 2022 | 24 Mar 2026 |
| 962 | derrythomson.com | 1&1 Internet AG | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 963 | derrykohlscards.com | Key-Systems GmbH | 25 Mar 2015 | 29 Apr 2015 | 25 Mar 2016 |
| 964 | derrickwise.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 965 | derricklyons.com | GoDaddy.com, LLC | 22 Mar 2012 | 29 Apr 2024 | 22 Mar 2026 |
| 966 | derrickandbrookedestinationwedding.com | Dynadot, LLC | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 967 | derriccolvard.com | Tucows Domains Inc. | 26 Mar 2015 | 25 Mar 2024 | 26 Mar 2025 |
| 968 | derriereleweb.com | OVH sas | 21 Feb 2020 | 1 Feb 2024 | 21 Feb 2025 |
| 969 | derricksmithcentre.com | GoDaddy.com, LLC | 26 Mar 2015 | 3 Jul 2023 | 26 Mar 2032 |
| 970 | derrymorefoods.com | Register.it SPA | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2025 |
| 971 | derryberryheatandair.com | Tucows Domains Inc. | 24 Aug 2010 | 28 Aug 2015 | 24 Aug 2016 |
| 972 | derrickkbrown.com | Tucows Domains Inc. | 24 Aug 2012 | 28 Aug 2015 | 24 Aug 2016 |
| 973 | derrickandsheila.com | GoDaddy.com, LLC | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 974 | derramamentoknowhhow.com | GoDaddy.com, LLC | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 975 | derryshare.com | eNom, Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 976 | derricksrenos.com | Tucows Domains Inc. | 24 Mar 2014 | 28 Mar 2015 | 24 Mar 2016 |
| 977 | derricksandjames.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 978 | derrickpughinc.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 979 | derrickhortonandthejaystreetband.com | GoDaddy.com, LLC | 27 Mar 2015 | 1 Apr 2024 | 27 Mar 2026 |
| 980 | derrickhickmanarts.com | GoDaddy.com, LLC | 27 Mar 2015 | 28 Mar 2024 | 27 Mar 2025 |
| 981 | derrickdelise.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 982 | derrickchong.com | Tucows Domains Inc. | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2017 |
| 983 | derrickarchieatjaxeliterealty.com | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 984 | derrickanddaniel.com | Wild West Domains, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 985 | derramedeideas.com | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 986 | derralf.com | 1&1 Internet AG | 27 Mar 2015 | 28 Mar 2016 | 27 Mar 2019 |
| 987 | derricksandjames.org | GoDaddy.com, LLC | 26 Mar 2015 | 27 Mar 2017 | 26 Mar 2018 |
| 988 | derricksandjames.net | GoDaddy.com, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 989 | derricksandjames.info | GoDaddy.com, LLC | 26 Mar 2015 | 27 Mar 2017 | 26 Mar 2018 |
| 990 | derrellejaney.org | Wild West Domains, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 991 | derramedeideas.net | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 992 | derralf.net | 1&1 Internet AG | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 993 | derricocycles.com | Synergy Wholesale Pty Ltd | 12 Mar 2013 | 11 Jan 2024 | 12 Mar 2025 |
| 994 | derricklam.com | Key-Systems GmbH | 30 Mar 2015 | 27 Mar 2024 | 30 Mar 2025 |
| 995 | derryvalesnooker.com | Easyspace LTD | 3 May 2000 | 31 Mar 2015 | 3 May 2015 |
| 996 | derricksasphalt.com | Tucows Domains Inc. | 28 Mar 2012 | 28 Mar 2012 | 28 Mar 2017 |
| 997 | derryndeceuster.com | GoDaddy.com, LLC | 1 Apr 2015 | 2 Apr 2015 | 1 Apr 2020 |
| 998 | derritek.com | GoDaddy.com, LLC | 31 May 2024 | 31 May 2024 | 31 May 2025 |
| 999 | derricknewspaper.com | Fabulous.com Pty Ltd. | 30 Mar 2005 | 2 Apr 2017 | 30 Mar 2018 |
| 1000 | derrequip.com | Fabulous.com Pty Ltd. | 19 Mar 2005 | 2 Apr 2017 | 19 Mar 2018 |
Displaying 1,000 out of 14,859 domains starting with the keyword "DERR". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=derr
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |