With support for 
Keyword: ECOMMERCEMARKETINGAGENCY
Reverse Whois » KEYWORD [ecommercemarketingagency ] { 19 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | ecommercemarketingagency.com | GoDaddy.com, LLC | 13 Mar 2019 | 28 Mar 2025 | 13 Mar 2026 |
| 2 | ecommercemarketingagency.co.uk | - | 2 Jun 2020 | 20 Aug 2024 | 2 Jun 2025 |
| 3 | ecommercemarketingagency.org | Tucows Domains Inc. | 26 Jan 2024 | 8 Mar 2025 | 26 Jan 2025 |
| 4 | ecommercemarketingagencyreviews.com | GoDaddy.com, LLC | 3 Mar 2020 | 15 May 2024 | 3 Mar 2024 |
| 5 | ecommercemarketingagencyfraud.com | GoDaddy.com, LLC | 5 Dec 2020 | 31 Mar 2025 | 5 Dec 2025 |
| 6 | ecommercemarketingagencyscam.com | GoDaddy.com, LLC | 5 Dec 2020 | 31 Mar 2025 | 5 Dec 2025 |
| 7 | ecommercemarketingagency252550.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 29 Jan 2025 | 6 Feb 2025 | 29 Jan 2026 |
| 8 | ecommercemarketingagency589172.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 29 Jan 2025 | 6 Feb 2025 | 29 Jan 2026 |
| 9 | ecommercemarketingagency382736.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 10 Feb 2025 | 21 Feb 2025 | 10 Feb 2026 |
| 10 | ecommercemarketingagency278346.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 10 Feb 2025 | 21 Feb 2025 | 10 Feb 2026 |
| 11 | ecommercemarketingagency185676.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 10 Feb 2025 | 21 Feb 2025 | 10 Feb 2026 |
| 12 | ecommercemarketingagency147096.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 13 | ecommercemarketingagency297323.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 14 | ecommercemarketingagency237630.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 15 | ecommercemarketingagency606427.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 16 | ecommercemarketingagency013702.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 17 | ecommercemarketingagency629315.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 17 Feb 2025 | 22 Feb 2025 | 17 Feb 2026 |
| 18 | ecommercemarketingagency676813.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 24 Feb 2025 | - | 24 Feb 2026 |
| 19 | ecommercemarketingagency929923.icu | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 24 Feb 2025 | - | 24 Feb 2026 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=ecommercemarketingagency
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |