Our database now contains whois records of 581 Million (581,549,913) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [581 Million Domains] $10,000 Details

Keyword: ENERGYE

Reverse Whois » KEYWORD [energye ]  { 5,469 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1energye.orgTucows Domains Inc.23 Dec 202327 Jan 202423 Dec 2024
2energye.netPDR Ltd. d/b/a PublicDomainRegistry.com31 Jan 202431 Jan 202431 Jan 2025
3energye.comGoDaddy.com, LLC12 Dec 200313 Dec 202312 Dec 2024
4energye.eu----
5energye.cn-8 Jul 2021-8 Jul 2026
6energye.it-18 May 202030 Sep 202428 Jun 2025
7energye.ru-5 Jul 2013-5 Jul 2025
8energyequation.me--5 Jun 20125 Apr 2013
9energyefficiencynews.comNameCheap, Inc.22 Nov 200722 Dec 202322 Nov 2024
10energyevaluationsnb.ca-10 May 201210 May 201210 May 2013
11energyefficientdevices.orgWild West Domains, LLC29 Aug 201030 Aug 202429 Aug 2025
12energyenhancement.orgGoDaddy.com, LLC16 Jul 19989 Jun 202415 Jul 2026
13energyefficiencymarkets.comAmazon Registrar, Inc.16 Jan 201312 Dec 202316 Jan 2025
14energyexchange.com.auNetRegistry Pty Ltd.-20 May 2014-
15energyexpo.co.krInames Co. Ltd.25 Mar 200416 May 201625 Mar 2022
16energyefficientreplacementwindow.comWild West Domains, LLC22 Oct 201427 Oct 202322 Oct 2024
17energyefficienthomes.ieProtocol Internet Technology Limited T/A Hosting I…13 Feb 200926 Mar 202413 Feb 2025
18energyeastpipeline.comGoDaddy.com, LLC27 Nov 201214 Mar 202427 Nov 2024
19energyefficientsolutions.comWild West Domains, LLC18 Sep 200319 Sep 202418 Sep 2026
20energyefficiencyasia.orgEdomains LLC27 Dec 20238 Jan 202427 Dec 2024
21energyequipmentsolutions.comWild West Domains, LLC12 Jun 201712 Jun 201712 Jun 2018
22energyeedg.comGoDaddy.com, LLC27 May 201228 May 201527 May 2016
23energyeconomic.comGoDaddy.com, LLC12 Nov 20237 Feb 202412 Nov 2024
24energyentrepeneurs.comGoDaddy.com, LLC10 Nov 201419 Apr 201510 Nov 2015
25energyefficientkettle.comGoDaddy.com, LLC1 Jun 20102 Jun 20151 Jun 2016
26energyethos.netGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
27energyethos.orgGoDaddy.com, LLC1 Mar 20246 Mar 20241 Mar 2025
28energyethos.infoGoDaddy.com, LLC2 Jun 20142 Jun 20152 Jun 2016
29energyempath.comDynadot, LLC11 Oct 202411 Oct 202411 Oct 2025
30energyefficientfixtures.comeNom, Inc.24 Mar 20117 Mar 202424 Mar 2025
31energyexporter.comAerotek Bilisim Taahut Sanayi Ve Ticaret Ltd Sti.16 Feb 201112 Mar 202416 Feb 2027
32energyefficientlamp.comeNom, Inc.8 Jan 201123 Jan 20178 Jan 2018
33energyefficientelectric.comeNom, Inc.7 Jan 20129 Jan 20247 Jan 2025
34energyefficientspa.comeNom, Inc.1 Mar 20098 Mar 20171 Mar 2018
35energyefficientspas.comeNom, Inc.2 Mar 20098 Mar 20172 Mar 2018
36energyefficiencyanalysis.comeNom, Inc.13 Aug 201110 Aug 202413 Aug 2025
37energyefficiencyassociation.comeNom, Inc.7 Aug 201212 Jul 20177 Aug 2017
38energyefficiencybenefits.comeNom, Inc.24 Sep 201121 Dec 201624 Sep 2017
39energyefficiencyincentives.comGoogle, Inc.24 Mar 202228 Oct 202324 Mar 2024
40energyefficiencymarket.comeNom, Inc.27 Jun 20109 Aug 202027 Jun 2020
41energyefficiencyproject.comeNom, Inc.23 Apr 201022 Apr 202423 Apr 2025
42energyefficientmaterials.comeNom, Inc.15 Oct 201011 Oct 202315 Oct 2024
43energyefficientresources.comeNom, Inc.14 Mar 20088 Mar 201714 Mar 2018
44energyefficientstrategies.comeNom, Inc.17 Apr 201210 May 201717 Apr 2018
45energyefficientsystem.comDynadot5 LLC5 Jan 20226 Jan 20225 Jan 2023
46energyelectricservice.comGoDaddy.com, LLC27 Aug 202327 Aug 202327 Aug 2025
47energyentertainmentgroup.comeNom, Inc.27 Sep 201121 Dec 201627 Sep 2017
48energyequipmentsupply.comeNom, Inc.15 Jan 201125 Jan 202415 Jan 2025
49energyevolve.comGoDaddy.com, LLC16 Jun 20092 Jul 202416 Jun 2026
50energyenviro.comeNom, Inc.17 Dec 200918 Dec 202317 Dec 2024
51energyexam.comGoDaddy.com, LLC15 Mar 200910 Mar 202415 Mar 2025
52energyefficiencygroup.comTurnCommerce, Inc. DBA NameBright.com10 Nov 20174 Nov 202010 Nov 2024
53energyeastoil.comeNom, Inc.15 Aug 201317 Jul 201715 Aug 2017
54energyefficientairconditioning.comKey-Systems GmbH20 Mar 201319 Apr 202420 Mar 2026
55energyefficiencynetwork.comeNom, Inc.25 Aug 201324 Aug 202425 Aug 2025
56energyextractor.comTurnCommerce, Inc. DBA NameBright.com20 Sep 201714 Sep 202020 Sep 2024
57energyexecs.comBeijing Lanhai Jiye Technology Co., Ltd5 Mar 202327 Feb 20245 Mar 2025
58energyefficientnews.comName.com, Inc.28 Apr 201628 Apr 201628 Apr 2017
59energyecho.comDynadot, LLC28 Feb 201130 May 202428 Feb 2026
60energyexpense.comGoDaddy.com, LLC21 Dec 20079 Jan 202421 Dec 2024
61energyequipment.comNetwork Solutions, LLC19 Nov 199719 Sep 202418 Nov 2025
62energyesources.comGoDaddy.com, LLC23 May 200826 May 201523 May 2016
63energyefficienthouses.comDynadot, LLC7 Aug 200326 Sep 20247 Aug 2025
64energyese.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2015
65energyeastmed.comGoDaddy.com, LLC31 Oct 20141 Nov 201631 Oct 2017
66energyexperts.orgDNC Holdings, Inc.5 Oct 200430 Sep 20245 Oct 2025
67energyeastpipelines.comeNom, Inc.13 Dec 201431 Jul 201513 Dec 2016
68energyefficiencies.comeNom, Inc.23 May 200025 May 202423 May 2025
69energyefficient.netNameSourceDomains, LLC18 Jun 202018 Jul 202418 Jun 2025
70energyefficienthomesindelaware.comGoDaddy.com, LLC24 Jul 200818 Apr 201524 Jul 2015
71energyefficiencyblog.comMoniker Online Services LLC7 Dec 20099 Jan 20157 Dec 2015
72energyefficiencyforum.comMoniker Online Services LLC7 Dec 20099 Jan 20157 Dec 2015
73energyecenter.comGoDaddy.com, LLC13 May 201014 May 202413 May 2026
74energyefficienthotel.comGoDaddy.com, LLC10 Feb 201011 Feb 201510 Feb 2016
75energyevaluate.comGoDaddy.com, LLC16 Jan 201117 Jan 202416 Jan 2025
76energyearth.comGoDaddy.com, LLC3 Nov 200329 Jul 20243 Nov 2025
77energyevents.comeNom, Inc.24 Apr 200622 Apr 202424 Apr 2025
78energyefficienthometips.netGransy s.r.o. d/b/a subreg.cz19 Sep 20232 Oct 202419 Sep 2024
79energyempathy.comDropCatch.com 413 LLC3 Nov 20144 Nov 20173 Nov 2018
80energyefficientwindowsseattle.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2015
81energyexecutivemgmt.netTucows Domains Inc.26 Oct 200820 Jun 202426 Oct 2024
82energyeditorial.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…26 Apr 20233 Jun 202426 Apr 2024
83energyefficiencytips.comTurnCommerce, Inc. DBA NameBright.com4 Nov 201429 Oct 20204 Nov 2024
84energyefficientroofingexperts.comeNom, Inc.11 Sep 201511 Sep 201511 Sep 2016
85energyeasagent.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
86energyeastsnake.comFastDomain Inc.18 Aug 201418 Aug 201618 Aug 2017
87energyefficiencyprograms.orgPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 201616 Dec 20174 Nov 2018
88energyefficiencystore.comGoDaddy.com, LLC19 Aug 20149 Jul 202419 Aug 2025
89energyequipmentauctioneers.comeNom, Inc.19 Aug 201421 Jul 202419 Aug 2025
90energyevaluation.bizNetwork Solutions, LLC18 Aug 201418 Aug 201417 Aug 2015
91energyefficiencycentral.comGoDaddy.com, LLC16 Jun 201417 Jun 201516 Jun 2016
92energyexpresso.comGoDaddy.com, LLC5 Nov 20146 Nov 20235 Nov 2024
93energyefficient-led.netGoDaddy.com, LLC20 Jun 201220 Jun 201520 Jun 2016
94energyefficient-led.comGoDaddy.com, LLC20 Jun 201220 Jun 202420 Jun 2026
95energyeci.comNameCheap, Inc.5 Jul 202411 Jul 20245 Jul 2025
96energyefficiencyauditsforbusiness.comWebfusion Ltd.19 Aug 201411 Aug 201719 Aug 2018
97energyefficiencyauditsforbusiness.orgMesh Digital Limited19 Aug 201411 Aug 201719 Aug 2018
98energyequalsincome.comGoDaddy.com, LLC19 Aug 201419 Aug 201419 Aug 2017
99energyexcell.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…16 Aug 202015 Aug 202416 Aug 2025
100energyearthgas.comGoDaddy.com, LLC24 Jun 201525 Jun 202424 Jun 2025
101energyearthpower.comGoDaddy.com, LLC24 Jun 20155 Sep 202424 Jun 2024
102energyearthsolar.comGoDaddy.com, LLC24 Jun 201525 Jun 202424 Jun 2025
103energyearthutilities.comGoDaddy.com, LLC24 Jun 20155 Sep 202424 Jun 2024
104energyearthutility.comGoDaddy.com, LLC24 Jun 20155 Sep 202424 Jun 2024
105energyeyepatch.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
106energyefficiencyexhbitions.comTucows Domains Inc.17 Aug 201221 Aug 201417 Aug 2015
107energyequipmentsales.comGoDaddy.com, LLC15 Jul 20192 May 202415 Jul 2024
108energyefficiency-asia.comSafeNames Ltd.21 Aug 201422 Aug 202421 Aug 2025
109energyefficiencyusa.orgGoDaddy.com, LLC21 Aug 201421 Aug 201421 Aug 2015
110energyequipmentservices.comGoDaddy.com, LLC21 Aug 201421 Aug 202320 Aug 2025
111energyetik.comeNom, Inc.21 Aug 201423 Jul 202421 Aug 2025
112energyevaluationstjohns.comTucows Domains Inc.21 Aug 20141 Nov 202321 Aug 2023
113energyemergencies.orgCloudFlare, Inc.6 Feb 201526 Feb 20236 Feb 2033
114energyemergency.orgCloudFlare, Inc.6 Feb 20159 Mar 20236 Feb 2025
115energyeverafter.comGoDaddy.com, LLC27 Mar 201928 Mar 202327 Mar 2025
116energyexpobusiness.comUniverso Online S/A (UOL)6 Feb 20156 Feb 20156 Feb 2016
117energyexplosion.orgGMO Internet Inc.30 Jun 201713 Oct 201730 Jun 2018
118energyefficencyusa.netGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
119energyeagle.usGoDaddy.com, LLC14 Jul 20092 Sep 201413 Jul 2019
120energyefficiencyexhibitions.comTucows Domains Inc.23 Aug 201226 Aug 201423 Aug 2015
121energyeastltd.comTucows Domains Inc.14 Aug 201418 Aug 201514 Aug 2016
122energyeastltd.orgTucows Domains Inc.14 Aug 201418 Aug 201514 Aug 2016
123energyefficientvegas.comTucows Domains Inc.24 Aug 201228 Aug 201424 Aug 2015
124energyemu.comGoDaddy.com, LLC28 Aug 201829 Aug 202428 Aug 2025
125energyefficiencymagazine.comGenious Communications SARL/AU6 Aug 202019 Sep 20246 Aug 2025
126energyefficienticf.comBeijing Lanhai Jiye Technology Co., Ltd12 Aug 202113 Aug 202312 Aug 2024
127energyeasylink.comChengdu West Dimension Digital Technology Co., Ltd…11 Nov 201411 Nov 201411 Nov 2015
128energyehs.netOVH sas9 Nov 20149 Nov 20149 Nov 2015
129energyefficentcy.comGoDaddy.com, LLC17 Aug 201417 Aug 201417 Aug 2015
130energyefficient-lighting-systems-inc.com1&1 Internet AG11 Nov 201411 Nov 201411 Nov 2015
131energyefficiancyexperts.comGoDaddy.com, LLC12 Sep 201412 Sep 201412 Sep 2015
132energyexplode.comTurnCommerce, Inc. DBA NameBright.com26 Nov 202123 Aug 202226 Nov 2024
133energyerupt.comGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2015
134energyeco.infoKey-Systems GmbH13 Nov 201429 Oct 202313 Nov 2024
135energyequityalliance.orgFastDomain Inc.12 Sep 201413 Sep 201712 Sep 2018
136energyevent.orgGoDaddy.com, LLC22 May 201622 Sep 202222 May 2027
137energyefficientresearch.comGoDaddy.com, LLC14 Sep 201414 Sep 201414 Sep 2015
138energyeasynetwork.comGoDaddy.com, LLC1 Sep 20141 Sep 20141 Sep 2015
139energyenrollmentfirm.comWild West Domains, LLC2 Sep 20148 Sep 20162 Sep 2017
140energyefficients.comTucows Domains Inc.15 Nov 201419 Nov 201515 Nov 2016
141energyefficiencyrd.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2015
142energyenvironment.usWild West Domains, LLC15 Sep 201415 Sep 201414 Sep 2015
143energyessentials4wellness.comGoDaddy.com, LLC15 Sep 201416 Sep 201615 Sep 2018
144energyefficiencydiscountscheme.comTucows Domains Inc.2 Mar 20176 Mar 20202 Mar 2020
145energyefficientcustombuilder.comGoDaddy.com, LLC3 Sep 20144 Sep 20183 Sep 2019
146energyexchangepartners.comDynadot, LLC25 Aug 201825 Aug 201825 Aug 2019
147energyeventsco.comFastDomain Inc.18 Sep 201418 Sep 201718 Sep 2018
148energyecuador.comNameCheap, Inc.21 Mar 201929 Feb 202421 Mar 2025
149energyefficientfridges.com1&1 Internet AG20 Sep 201420 Sep 201420 Sep 2015
150energyefficienthometips.comeNom, Inc.17 Nov 201417 Nov 201417 Nov 2015
151energyeventsupply.comDropCatch.com 1260 LLC8 Dec 20188 Dec 20188 Dec 2019
152energyefficiency4all.comNameCheap, Inc.9 Sep 201410 Sep 20249 Sep 2025
153energyedison.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2015
154energyeconstrategy.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2016
155energyeconomicsstrategy.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2016
156energyeconomicsstrategies.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2016
157energyefficiency4all.orgNameCheap, Inc.9 Sep 20149 Sep 20249 Sep 2025
158energyefficiencyforall.orgregister.com, Inc.9 Sep 201415 Aug 20249 Sep 2028
159energyefficiencyplan.comGoDaddy.com, LLC26 Jan 202426 Jan 202426 Jan 2025
160energyefficiencysd.comDomain.com, LLC10 Sep 201410 Sep 201410 Sep 2015
161energyefficienthomeusa.comGoDaddy.com, LLC4 Oct 20144 Oct 20144 Oct 2015
162energyepc.comGoDaddy.com, LLC18 Nov 201630 Sep 202218 Nov 2026
163energyendoca.comGoDaddy.com, LLC19 Nov 20147 Nov 201619 Nov 2017
164energyefficiencymanagement.comWebfusion Ltd.19 Nov 201419 Nov 201419 Nov 2015
165energyenia.comGoDaddy.com, LLC22 Jan 202119 Apr 202322 Jan 2024
166energyesl.netregister.com, Inc.22 Sep 201422 Sep 201422 Sep 2015
167energyequalswellness.comGoDaddy.com, LLC6 Oct 20146 Oct 20246 Oct 2026
168energyengineeringfiji.comGoDaddy.com, LLC7 Oct 20147 Oct 20147 Oct 2015
169energyexists.orgDomain.com, LLC23 Sep 2014-23 Sep 2015
170energyenvoy.comGoDaddy.com, LLC24 Sep 201425 Sep 202324 Sep 2025
171energyexpand.comGoDaddy.com, LLC19 Jun 202019 Jun 202019 Jun 2021
172energyefficiencystop.comGoDaddy.com, LLC21 Nov 201417 Oct 202321 Nov 2024
173energyexponent.orgGoDaddy.com, LLC29 Sep 201429 Sep 201429 Sep 2016
174energyexponent.comGoDaddy.com, LLC29 Sep 201429 Sep 201429 Sep 2016
175energyexponents.comGoDaddy.com, LLC29 Sep 201429 Sep 201429 Sep 2015
176energyefficiencytraining.com-24 Mar 202428 Jun 202424 Mar 2025
177energyefficientresearch.orgDynamic Network Services, Inc.11 Oct 201411 Oct 201411 Oct 2015
178energye8.comGoDaddy.com, LLC12 Oct 201412 Oct 201412 Oct 2016
179energyeatery.comNameCheap, Inc.19 Feb 202419 Feb 202419 Feb 2025
180energyexpertsau.comGoDaddy.com, LLC27 Jul 20227 Sep 202327 Jul 2023
181energyefficiencycons.comGoDaddy.com, LLC25 Sep 201428 Aug 202425 Sep 2025
182energyeconom-gr.comCJSC Registrar R0113 Oct 201413 Oct 201413 Oct 2015
183energyefficientglazing.orgeNom, Inc.13 Oct 201413 Oct 201413 Oct 2015
184energyeastaction.comNetwork Solutions, LLC17 Oct 201418 Aug 202117 Oct 2022
185energyefficiencycontinuousimprovement.comGoDaddy.com, LLC15 Oct 201415 Oct 201415 Oct 2016
186energyefficientinsulationnc.comregister.com, Inc.15 Oct 201415 Oct 201415 Oct 2015
187energyexellence.com1&1 Internet AG15 Oct 201416 Oct 201615 Oct 2018
188energyefficientsterilizers.comGoDaddy.com, LLC19 Oct 20147 Feb 201719 Oct 2017
189energyefficientsterilizer.comGoDaddy.com, LLC19 Oct 20147 Feb 201719 Oct 2017
190energyefficientautoclaves.comGoDaddy.com, LLC19 Oct 201419 Oct 201419 Oct 2016
191energyefficientautoclave.comGoDaddy.com, LLC19 Oct 20147 Feb 201719 Oct 2017
192energyefficiencycymru.comTucows Domains Inc.16 Oct 200820 Oct 201416 Oct 2015
193energyeffciencywales.comTucows Domains Inc.16 Oct 200820 Oct 201416 Oct 2015
194energyent.infoGMO Internet Inc.12 Feb 201612 Feb 201612 Feb 2017
195energyefficiencysummit.comGlobal Domain Name Trading Center Ltd26 Jan 202426 Jan 202426 Jan 2025
196energyexecmba.comName.com, Inc.1 Dec 20141 Dec 20141 Dec 2015
197energyeurope.infoCommuniGal Communication Ltd.28 Jun 202328 Jul 202428 Jun 2024
198energyexpansionisland.comGoDaddy.com, LLC2 Dec 201417 May 202310 May 2025
199energyexchangeexpansion.comGoDaddy.com, LLC2 Dec 201417 May 202310 May 2025
200energyefficiencyrules.comNameCheap, Inc.2 Dec 201425 Jan 20182 Dec 2018
201energyesthe.comNetowl, Inc.3 Dec 20145 Sep 20163 Dec 2017
202energyefficiententerprise.comCSL Computer Service Langenbach GmbH d/b/a joker.c…24 Mar 202024 Mar 202024 Mar 2021
203energyevolutionjournal.comKey-Systems GmbH14 Aug 20234 Jul 202414 Aug 2025
204energyeqt.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Dec 20149 Dec 20165 Dec 2017
205energyenterprisesllc.comTucows Domains Inc.2 Sep 201618 Aug 20172 Sep 2017
206energyefficientinsulation.orgGoDaddy.com, LLC4 Dec 20145 Dec 20164 Dec 2018
207energyefficientinsulation.netGoDaddy.com, LLC4 Dec 20144 Dec 20144 Dec 2016
208energyefficientinsulationky.comTucows Domains Inc.4 Dec 20128 Dec 20144 Dec 2015
209energyequality.comTurnCommerce, Inc. DBA NameBright.com9 Dec 201429 Nov 20239 Dec 2024
210energyefficientledlighting.comGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
211energyez.comGoDaddy.com, LLC1 Mar 20212 Mar 20241 Mar 2025
212energyeco.orgGoDaddy.com, LLC4 Nov 20174 Nov 20174 Nov 2018
213energyefficientblog.comTucows Domains Inc.10 Dec 200814 Dec 201410 Dec 2015
214energyedge.bizGoDaddy.com, LLC15 Dec 201414 Aug 201614 Dec 2018
215energyear.comDinahosting s.l.15 Dec 20147 Dec 202315 Dec 2024
216energyestate.comSquarespace Domains LLC15 Jan 201831 Dec 202315 Jan 2025
217energyefficientled.netEpik Inc.17 Dec 201417 Dec 201417 Dec 2015
218energyevapes.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
219energyefficient-house.comTucows Domains Inc.18 Dec 201122 Dec 201418 Dec 2015
220energyecigarettes.comGoDaddy.com, LLC22 Dec 201422 Dec 201622 Dec 2017
221energyecig.comTurnCommerce, Inc. DBA NameBright.com10 Mar 201827 Aug 202110 Mar 2025
222energyefficienthomeservices.com----
223energyecigs.netGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
224energyequalscash.comGoDaddy.com, LLC24 Dec 201424 Dec 201424 Dec 2015
225energyefficiencyandconservation.comNameStrategies LLC23 Dec 201424 Dec 201623 Dec 2017
226energyemergencyenergytransition.orgKey-Systems GmbH19 Dec 201417 Dec 201619 Dec 2017
227energyetf.infoGoDaddy.com, LLC24 Dec 201424 Dec 201424 Dec 2015
228energyelectricltd.comGoDaddy.com, LLC26 Dec 201417 Sep 202226 Dec 2024
229energyentrainment.comGoDaddy.com, LLC28 Dec 201428 Dec 201428 Dec 2015
230energyeasyservices.comGoDaddy.com, LLC30 Dec 201430 Dec 201430 Dec 2016
231energyessay.comTurnCommerce, Inc. DBA NameBright.com22 Mar 201716 Mar 202122 Mar 2025
232energyexperiment.comTurnCommerce, Inc. DBA NameBright.com4 Jan 201529 Dec 20204 Jan 2026
233energyexchanger.xyzNetwork Solutions, LLC25 Jul 201425 Jul 201425 Jul 2015
234energyedgeconsulting.xyzNetwork Solutions, LLC25 Jul 201425 Jul 201425 Jul 2015
235energyefficient.linkUniregistrar Corp6 Aug 20146 Aug 20146 Aug 2015
236energyefficiencysaves.xyzNetwork Solutions, LLC29 Jul 201430 Jul 201429 Jul 2015
237energyefficiency.nycNetwork Solutions, LLC3 Oct 20148 Aug 20182 Oct 2021
238energyefficiency.technologyName.com, Inc.7 Oct 201912 Oct 20197 Oct 2020
239energyefficiency.systemsGoogle, Inc.27 Mar 202111 May 202427 Mar 2025
240energyefficiency.managementPSI-USA, Inc. dba Domain Robot7 Feb 20187 Feb 20187 Feb 2019
241energyequipment.reviewsGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
242energyefficiency.xyzNameKing.com Inc.12 Jul 202417 Jul 202412 Jul 2025
243energyefficienthomes.constructionGoDaddy.com, LLC9 Dec 201423 Jan 20179 Dec 2017
244energyefficienthomes.buildGoDaddy.com, LLC9 Dec 201414 Dec 20149 Dec 2016
245energyefficient.solutionsGoDaddy.com, LLC10 Oct 202310 Oct 202410 Oct 2025
246energyexpo.moscow101domain, Inc.5 Dec 20145 Dec 20145 Dec 2015
247energyefficientsavings.lightingGoDaddy.com, LLC25 Jan 201520 Jun 201725 Jan 2018
248energyengine.globalMesh Digital Limited6 Feb 201519 Jun 20246 Feb 2025
249energyefficiency.worldWild West Domains, LLC9 Feb 20159 Feb 20159 Feb 2016
250energyefmr.xyzPDR Ltd. d/b/a PublicDomainRegistry.com18 Feb 201518 Feb 201518 Feb 2016
251energyefficiency.topNameCheap, Inc.28 Mar 201728 Mar 201728 Mar 2018
252energyesprit.photographyTucows Domains Inc.2 Mar 20146 Mar 20152 Mar 2016
253energyefficiency.energyGoDaddy.com, LLC16 Mar 201516 Mar 201516 Mar 2016
254energyefficient.energyeNom, Inc.21 Mar 201521 Mar 201521 Mar 2016
255energyeasy.solutionsGoDaddy.com, LLC3 Apr 201515 Apr 20163 Apr 2017
256energyefficientfinance.com-13 Aug 201513 Aug 201513 Aug 2017
257energyefficiencyaustintx.comTucows Domains Inc.5 Jan 20159 Jan 20185 Jan 2018
258energyedge.org1&1 Internet AG21 Jul 20234 Sep 202421 Jul 2025
259energyexpressnyct.comGoDaddy.com, LLC8 Jan 20159 Jan 20238 Jan 2025
260energyexpressny.comGoDaddy.com, LLC8 Jan 20159 Jan 20238 Jan 2025
261energyexpressct.comGoDaddy.com, LLC8 Jan 20159 Jan 20238 Jan 2025
262energyefficienthomesbuffalo.comeNom, Inc.8 Jan 20158 Jan 20158 Jan 2016
263energyelectric.org-11 Apr 202416 Apr 202411 Apr 2025
264energyencapsulated.comNet 4 India Limited13 Jan 201513 Jan 201513 Jan 2016
265energyexpertllc.comGoDaddy.com, LLC16 Jan 201516 Jan 201516 Jan 2016
266energyefficientwindowsgta.comGoDaddy.com, LLC15 Jan 201515 Jan 201515 Jan 2016
267energyefficientbaywindows.comGoDaddy.com, LLC15 Jan 201515 Jan 201515 Jan 2016
268energyelectricltd.netFastDomain Inc.14 Jan 201515 Aug 202314 Jan 2025
269energyefficiency-2014.comThreadwalker.com, Inc.16 Jan 201516 Jan 201516 Jan 2016
270energyefficient.designGandi SAS1 Jun 20151 Jun 20151 Jun 2016
271energyebusiness.solarGoDaddy.com, LLC22 Jun 201522 Jun 201522 Jun 2016
272energyebusiness.energyGoDaddy.com, LLC22 Jun 201522 Jun 201522 Jun 2016
273energyelectricity.partyAlpnames Limited20 Jul 201520 Jul 201519 Jul 2016
274energyefficiency.loanGoDaddy.com, LLC5 Aug 20156 Aug 20244 Aug 2025
275energyenergydrink.comGoDaddy.com, LLC18 Jan 201518 Jan 201518 Jan 2016
276energyessay.orgDomain.com, LLC16 Jan 201516 Jan 201516 Jan 2016
277energyessay.netDomain.com, LLC16 Jan 201516 Jan 201516 Jan 2016
278energyexplore.comFabulous.com Pty Ltd.16 Dec 20089 Sep 202416 Dec 2024
279energyexhibits.comGoDaddy.com, LLC11 Aug 202019 Sep 202411 Aug 2025
280energyefficientappliances.netDomainAdministration.com, LLC17 Jan 201517 Jan 201517 Jan 2016
281energyexchangeauction.com1&1 Internet AG22 Jan 201522 Jan 201522 Jan 2016
282energyefficiencyleasing.comNetwork Solutions, LLC22 Jan 20155 Mar 201722 Jan 2018
283energyexchangebuys.com1&1 Internet AG23 Jan 201523 Jan 201523 Jan 2016
284energyexchangebuyers.com1&1 Internet AG23 Jan 201523 Jan 201523 Jan 2016
285energyexchangebuyer.com1&1 Internet AG23 Jan 201523 Jan 201523 Jan 2016
286energyefficiencyleasing.orgNetwork Solutions, LLC22 Jan 201523 Mar 201522 Jan 2018
287energyefficiencyleasing.netNetwork Solutions, LLC22 Jan 20155 Mar 201722 Jan 2018
288energyefficientman.comGoDaddy.com, LLC24 Jan 201524 Jan 201524 Jan 2016
289energyefficientlife.comNameCheap, Inc.15 Mar 202327 May 202415 Mar 2024
290energyefficientboosterpumps.comTucows Domains Inc.21 Jan 201125 Jan 201521 Jan 2016
291energyefficiencyandrenewableenergy.comGoDaddy.com, LLC25 Jan 201525 Jan 201525 Jan 2016
292energyefficientfreezers.netTucows Domains Inc.21 Jan 201125 Jan 201521 Jan 2016
293energyefficientairconditioners.netTucows Domains Inc.21 Jan 201125 Jan 201521 Jan 2016
294energyefficientsolaroptions.comName.com, Inc.27 Jan 20154 May 201727 Jan 2018
295energyefficientsolaroptionnow.comName.com, Inc.27 Jan 20154 May 201727 Jan 2018
296energyefficientsolaroption.comName.com, Inc.27 Jan 20154 May 201727 Jan 2018
297energyefficientsolaroptions.netName.com, Inc.27 Jan 20154 May 201727 Jan 2018
298energyefficientsolaroptionnow.netName.com, Inc.27 Jan 20154 May 201727 Jan 2018
299energyefficientsolaroption.netName.com, Inc.27 Jan 20154 May 201727 Jan 2018
300energyeastforall.comNetwork Solutions, LLC29 Jan 201529 Jan 201529 Jan 2016
301energyeastforall.netNetwork Solutions, LLC29 Jan 201529 Jan 201529 Jan 2016
302energyevens.xyzSuper Registry Inc.7 May 20157 May 20157 May 2016
303energyexchangeexperiment.comGoDaddy.com, LLC1 Feb 20151 Feb 20151 Feb 2016
304energyexchangeexperience.comGoDaddy.com, LLC1 Feb 20151 Feb 20151 Feb 2016
305energyexchangechallenge.comGoDaddy.com, LLC1 Feb 20151 Feb 20151 Feb 2016
306energyenvironment.infoGoDaddy.com, LLC2 Feb 2015-2 Feb 2016
307energyeletronics.comTucows Domains Inc.5 Feb 20159 Feb 20165 Feb 2017
308energyeastforall.orgNetwork Solutions, LLC4 Feb 20154 Feb 20154 Feb 2016
309energyefficientwindowlocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
310energyengineering-llc.comCopper Domain Names LLC30 Apr 20243 May 202430 Apr 2025
311energyefficientenergy.comGoDaddy.com, LLC10 Feb 201510 Feb 201510 Feb 2016
312energyefficientcornwall.comBlacknight Internet Solutions Ltd.10 Feb 20154 Jun 201510 Feb 2018
313energyefficiency-vietnam.comSafeNames Ltd.11 Feb 201522 Nov 202311 Feb 2025
314energyefficiency-philippines.comSafeNames Ltd.11 Feb 201522 Nov 202311 Feb 2025
315energyefficientenergy.usGoDaddy.com, LLC10 Feb 201510 Feb 20179 Feb 2018
316energyefficientenergy.orgGoDaddy.com, LLC10 Feb 201510 Feb 201510 Feb 2016
317energyefficientenergy.netGoDaddy.com, LLC10 Feb 201510 Feb 201510 Feb 2016
318energyefficientenergy.infoGoDaddy.com, LLC10 Feb 2015-10 Feb 2016
319energyerc.comDNC Holdings, Inc.13 Feb 201529 Dec 201613 Feb 2018
320energyefficiencyscheduling.comAmazon Registrar, Inc.12 Feb 201527 Mar 202412 Feb 2024
321energyefficiencyindonesia.infoHosting Concepts B.V. dba Openprovider14 Jul 202214 Jul 202314 Jul 2024
322energyefficiencyscheduling.infoGoDaddy.com, LLC12 Feb 201513 Feb 201712 Feb 2018
323energyefficiencyanalytics.comGoDaddy.com, LLC13 Feb 201513 Feb 201513 Feb 2016
324energyexact.comNameKing.com Inc.21 Apr 20205 Jul 202321 Apr 2023
325energyefficiencyscheduling.netGoDaddy.com, LLC12 Feb 201512 Feb 201512 Feb 2016
326energyexpertsofohio.comGoDaddy.com, LLC15 Feb 201515 Feb 201515 Feb 2016
327energyexpertsofmichigan.comGoDaddy.com, LLC15 Feb 201515 Feb 201515 Feb 2016
328energyefficient.infoGoDaddy.com, LLC20 Jan 202120 Jan 202120 Jan 2022
329energyefficiencyexpertsrus.comGoDaddy.com, LLC21 Aug 201521 Aug 201521 Aug 2016
330energyeffiencytradecouncil.orgNetwork Solutions, LLC15 Feb 201515 Feb 201515 Feb 2016
331energyefficiencytradegroup.orgNetwork Solutions, LLC15 Feb 201515 Feb 201515 Feb 2016
332energyexpertwitnessaustintx.comeNom, Inc.17 Feb 201517 Feb 201517 Feb 2018
333energyexpertstoledo.comDynadot, LLC18 Feb 201518 Feb 201518 Feb 2016
334energyexchangerates.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
335energyefficientarizonahome.com1&1 Internet AG18 Feb 201518 Feb 201718 Feb 2018
336energyexcess.comBigRock Solutions Ltd.15 Feb 201017 Jan 202415 Feb 2025
337energyethic.comTurnCommerce, Inc. DBA NameBright.com18 Feb 201512 Feb 202118 Feb 2025
338energyefficienthome.info1&1 Internet AG18 Feb 201518 Feb 201718 Feb 2018
339energyestimating.comGoDaddy.com, LLC18 Jan 202418 Jan 202418 Jan 2027
340energyevaluation.netGoDaddy.com, LLC20 Feb 201522 Feb 201720 Feb 2018
341energyefficiencysolution.orgTucows Domains Inc.11 Feb 201014 Aug 202411 Feb 2025
342energyevaluations.comNetwork Solutions, LLC19 Feb 200421 Dec 202319 Feb 2025
343energyevm.comVitalwerks Internet Solutions, LLC DBA No-IP19 Feb 201320 Jan 202419 Feb 2025
344energyestates.comGoogle, Inc.26 Sep 202418 Oct 202426 Sep 2025
345energyevolutioninnovations.comGoDaddy.com, LLC25 Feb 201525 Feb 201525 Feb 2017
346energyenvision.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…29 Jul 202230 Jul 202329 Jul 2025
347energyerased.com1&1 Internet AG27 Feb 201527 Feb 201527 Feb 2016
348energyempiregroup.comGoDaddy.com, LLC27 Feb 201528 Feb 201527 Feb 2016
349energyeastwest.comNameCheap, Inc.14 Mar 202215 Feb 202414 Mar 2025
350energyelections.com----
351energyefficientenvironment.comGoDaddy.com, LLC3 Mar 20153 Mar 20153 Mar 2016
352energyefficiencyexpo2010.comNamesilo, LLC9 Dec 20169 Dec 20179 Dec 2017
353energyems.netGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2017
354energyerectors.comTurnCommerce, Inc. DBA NameBright.com9 May 20183 May 20219 May 2025
355energyendeavour.comOVH sas4 Mar 20151 Mar 20244 Mar 2025
356energyendeavour.bizOVH sas4 Mar 20156 Mar 20243 Mar 2025
357energyearlydot.comeNom, Inc.4 Mar 20154 Mar 20154 Mar 2016
358energyefficientenvironment.netGoDaddy.com, LLC3 Mar 20153 Mar 20153 Mar 2016
359energyendeavour.orgOVH sas4 Mar 20156 Mar 20244 Mar 2025
360energyendeavour.netOVH sas4 Mar 20151 Mar 20244 Mar 2025
361energyendeavour.infoOVH sas4 Mar 20156 Mar 20244 Mar 2025
362energyebay.comLaunchpad, Inc.5 Mar 20156 Mar 20155 Mar 2016
363energyenex.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Mar 20156 Mar 20156 Mar 2016
364energyefficinetbrands.comFabulous.com Pty Ltd.19 Feb 20097 Mar 201519 Feb 2016
365energyefficientbeing.comGoDaddy.com, LLC8 Mar 20158 Mar 20158 Mar 2016
366energyedit.comTucows Domains Inc.8 Mar 20138 Mar 20238 Mar 2025
367energyefficientbeing.orgGoDaddy.com, LLC8 Mar 20158 Mar 20158 Mar 2016
368energyevolves.orgGandi SAS11 Mar 201513 Feb 202411 Mar 2025
369energyefficientwindowguys.comGoDaddy.com, LLC15 Mar 201515 Mar 201515 Mar 2016
370energyefficientgenerator.comNameCheap, Inc.27 Aug 20216 Nov 202227 Aug 2026
371energyefficientroofs.comGoDaddy.com, LLC22 Nov 201623 Nov 202322 Nov 2024
372energyexorcist.comGoDaddy.com, LLC20 Mar 201520 Mar 201520 Mar 2016
373energyexorcism.comGoDaddy.com, LLC4 Oct 20233 Oct 20244 Oct 2025
374energyefficientgasboiler.comeNom, Inc.19 Mar 201519 Mar 201519 Mar 2016
375energyefficientlightbulbs.comDropCatch.com 383 LLC20 Mar 201521 Mar 201720 Mar 2018
376energyefficiencydays.comGandi SAS24 Mar 201520 Feb 202424 Mar 2025
377energyefficiencyacademy.orgTucows Domains Inc.19 Mar 200923 Mar 201519 Mar 2016
378energyexpertshvac.comGoDaddy.com, LLC27 Apr 20208 May 202427 Apr 2025
379energyefficiencyacademy.netTucows Domains Inc.19 Mar 200923 Mar 201519 Mar 2016
380energyetics.comFBS Inc.27 Aug 201528 Aug 201527 Aug 2016
381energyefficienthomeimprovements.net-27 Aug 201527 Aug 201527 Aug 2017
382energyefficientbusiness.comPorkbun, LLC29 Aug 202429 Aug 202429 Aug 2025
383energyetg.com-11 Jul 201311 Jul 201311 Jul 2017
384energyefficientbusiness.orgGoDaddy.com, LLC27 Mar 201527 Mar 201527 Mar 2016
385energyenius.comGoDaddy.com, LLC30 Mar 201530 Mar 201530 Mar 2016
386energyexchangegroup.comGoDaddy.com, LLC1 Apr 20151 Apr 20151 Apr 2016
387energyefficienttechnology.comNameCheap, Inc.21 Aug 201721 Aug 201721 Aug 2018
388energyecs.comDropCatch.com 1166 LLC21 May 202422 May 202421 May 2025
389energyessences.comTurnCommerce, Inc. DBA NameBright.com17 Jun 201611 Jun 202017 Jun 2025
390energyentertainmentofnwohio.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
391energyevaluation.orgGoDaddy.com, LLC2 Apr 201519 Apr 20172 Apr 2018
392energyefficientconstructiontn.comGoDaddy.com, LLC6 Apr 20156 Apr 20156 Apr 2016
393energyefficiencyevolution.comNetwork Solutions, LLC1 Sep 201530 Aug 20161 Sep 2017
394energyefficiencystudies.comGoDaddy.com, LLC31 Aug 201531 Aug 201531 Aug 2016
395energyefficientcooking.comregister.com, Inc.30 Aug 201530 Aug 201530 Aug 2020
396energyeon.comAmazon Registrar, Inc.5 Mar 20235 Mar 20235 Mar 2026
397energyexists.netDomain.com, LLC7 Apr 20157 Apr 20157 Apr 2016
398energyeht.comGoDaddy.com, LLC9 Apr 20159 Apr 20159 Apr 2016
399energyefficiencyupgrades.com1API GmbH23 Mar 20227 Apr 202423 Mar 2025
400energyevangelist.comDynadot, LLC21 Nov 202326 Sep 202421 Nov 2024
401energyefficientearth.comregister.com, Inc.3 Sep 201530 Aug 20243 Sep 2025
402energyefficiency.clubBeijing Lanhai Jiye Technology Co., Ltd15 Sep 202415 Sep 202415 Sep 2025
403energyeyes-eyewear.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
404energyelixirs.comGoDaddy.com, LLC13 Apr 201524 Apr 202413 Apr 2025
405energyefficienthydrogen.comWild West Domains, LLC16 Apr 201516 Apr 201516 Apr 2016
406energyefficiencycoatings.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…17 Apr 201515 Jul 201717 Apr 2018
407energyeventstaffing.comGoDaddy.com, LLC20 Apr 201520 Apr 201520 Apr 2017
408energyefficientwindowreplacement.comGoDaddy.com, LLC20 Apr 201521 Apr 202420 Apr 2025
409energyefficientwindowinstallation.comGoDaddy.com, LLC20 Apr 201521 Apr 202420 Apr 2025
410energyexchange-usa.comGoDaddy.com, LLC21 Apr 201521 Apr 201521 Apr 2017
411energyenvironmenteconomicsllc.com1&1 Internet AG22 Apr 201522 Apr 201522 Apr 2016
412energyenvironmenteconomicsllc.org1&1 Internet AG22 Apr 2015-22 Apr 2016
413energyenvironmenteconomicsllc.net1&1 Internet AG22 Apr 201522 Apr 201522 Apr 2016
414energyevo.comGoDaddy.com, LLC13 Nov 201629 Aug 202413 Nov 2025
415energyefficiencycincinnati.comTucows Domains Inc.24 Apr 201524 Apr 201524 Apr 2017
416energyefficiencyathensoh.comTucows Domains Inc.24 Apr 201524 Apr 201524 Apr 2017
417energyep.netHiChina Zhicheng Technology Limited1 Dec 201619 Dec 20171 Dec 2018
418energyefficientappliancesonline.comDynadot, LLC7 Sep 20157 Sep 20157 Sep 2016
419energyeaseandflow.comGoDaddy.com, LLC25 Apr 201525 Apr 201525 Apr 2017
420energyefficiencypros.comTurnCommerce, Inc. DBA NameBright.com27 Apr 201521 Apr 202127 Apr 2025
421energyexpertsheatingair.comTucows Domains Inc.25 Apr 201429 Apr 201525 Apr 2016
422energyeventos.comTurnCommerce, Inc. DBA NameBright.com2 Sep 201912 Oct 20242 Sep 2024
423energyexpertsusa.netTucows Domains Inc.9 Sep 201513 Sep 20219 Sep 2021
424energyespresso.comAnnulet LLC8 Sep 201526 Oct 20238 Sep 2024
425energyenvironmentpro.com----
426energyenginomics.comGoDaddy.com, LLC9 Sep 20159 Sep 20159 Sep 2017
427energyefficiencyhq.comSammamishdomains.com LLC10 Sep 202313 Sep 202410 Sep 2025
428energyefficiencymeter.comeNom, Inc.1 May 201530 Mar 20161 May 2018
429energyeb5.comGoDaddy.com, LLC22 Jul 20191 Jun 202322 Jul 2025
430energyefficienthomesfordummies.infoGoDaddy.com, LLC2 May 2015-2 May 2016
431energyeb5.infoGoDaddy.com, LLC1 May 20152 May 20171 May 2019
432energyefficiencymeter.usNameCheap, Inc.1 May 20151 Apr 201730 Apr 2018
433energyefficiencymeter.orgeNom, Inc.1 May 20151 Apr 20171 May 2018
434energyefficiencymeter.neteNom, Inc.1 May 201530 Mar 20161 May 2018
435energyeb5.orgGoDaddy.com, LLC1 May 20152 May 20171 May 2019
436energyeb5.netGoDaddy.com, LLC1 May 20151 May 20151 May 2017
437energyecoelements.comGKG.NET, INC.28 Apr 20113 May 201528 Apr 2016
438energyevolutione2.comGoDaddy.com, LLC4 May 20154 May 20154 May 2016
439energyefficiencysolution.comGoDaddy.com, LLC13 Nov 20176 Oct 202213 Nov 2024
440energyenvconf.netGoDaddy.com, LLC10 Sep 201510 Sep 201510 Sep 2016
441energyenhancementgroup.comTucows Domains Inc.6 Sep 200810 Sep 20156 Sep 2016
442energyefficientscooter.com1&1 Internet AG10 Sep 201516 Apr 201710 Sep 2017
443energyefficientlightinginlouisvilleky.comeNom, Inc.9 Sep 20159 Sep 20159 Sep 2016
444energyefficientmichigan.comGoDaddy.com, LLC5 May 20155 May 20155 May 2016
445energyexpertguys.comGoDaddy.com, LLC6 May 20156 May 20156 May 2016
446energyefficiencyasia.comBrandsight, Inc.10 Sep 202110 Aug 202410 Sep 2025
447energyexpedition.comAnnulet LLC25 Feb 201913 Apr 202425 Feb 2025
448energyeffortpassion.comTucows Domains Inc.7 May 201011 May 20157 May 2016
449energyefficienthousesuk.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Sep 201511 Sep 201511 Sep 2016
450energyefficientsips.comGoDaddy.com, LLC13 May 201513 May 201513 May 2017
451energyeventssw.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
452energyeventssouthwest.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
453energyeventssoutheast.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
454energyeventsse.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
455energyeventsrockymountains.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
456energyeventsrm.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
457energyeventsnw.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
458energyeventsnorthwest.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
459energyeventsnortheast.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
460energyeventsne.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
461energyeventsmw.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
462energyeventsmidwest.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
463energyeventsmidatlantic.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
464energyeventsma.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
465energyeventscanada.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
466energyeventscalifornia.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
467energyeventsca.orgGoDaddy.com, LLC13 May 20157 May 201713 May 2018
468energyenviron.comTurnCommerce, Inc. DBA NameBright.com31 Jul 201630 Aug 202431 Jul 2024
469energyefficientgrowlights.comFastDomain Inc.17 May 201517 May 201517 May 2016
470energyefficiencyconsultingfirm.comeNom, Inc.18 May 20152 Jun 201718 May 2018
471energyevents.infoTucows Domains Inc.10 Nov 201614 Nov 201710 Nov 2018
472energyefficiencyeurope.comMfro Inc.8 Nov 20238 Nov 20238 Nov 2024
473energyelevaters.comFastDomain Inc.21 May 201521 May 201521 May 2016
474energyequationexpert.comGoDaddy.com, LLC22 May 201522 May 201522 May 2016
475energyefficientwindowsltd.comWild West Domains, LLC22 May 201522 May 201522 May 2016
476energyefficientelectrician.comGoDaddy.com, LLC22 May 2015-22 May 2019
477energyenvcfp.netGoDaddy.com, LLC14 Sep 201514 Sep 201514 Sep 2016
478energyexpertadviser.comPDR Ltd. d/b/a PublicDomainRegistry.com27 May 20158 Jul 201727 May 2017
479energyefficientairconditionerguys.comGoDaddy.com, LLC27 May 201527 May 201527 May 2016
480energyefficiencyconstruction.comGoDaddy.com, LLC29 May 201529 May 201529 May 2016
481energyefficientgreenhomes.com----
482energyefficienciesgroup.comTucows Domains Inc.30 Aug 201710 Nov 202330 Aug 2023
483energyefficientdoubleglazing.comWebfusion Ltd.31 May 201531 May 201531 May 2019
484energyefficiencyconsulting.bizGoDaddy.com, LLC1 Jun 201510 Jan 201831 May 2018
485energyefficiencyprotect.comRegister.it SPA15 Sep 201518 Oct 201615 Sep 2017
486energyefficiencyconsulting.infoGoDaddy.com, LLC1 Jun 20157 May 20171 Jun 2018
487energyelectricrenovables.comOVH sas2 Jun 201517 May 20162 Jun 2017
488energyefficiencyconsulting.orgGoDaddy.com, LLC1 Jun 20157 May 20171 Jun 2018
489energyequipmentshops.comeNom, Inc.3 Jun 20153 Jun 20153 Jun 2016
490energyefficientwindowsma.com1&1 Internet AG4 Jun 20154 Jun 20154 Jun 2016
491energyevomobile.comTucows Domains Inc.5 Jun 20155 Jun 20155 Jun 2017
492energyefficientlighttubes.comCrazy Domains FZ-LLC6 Jun 201517 Jun 20226 Jun 2022
493energyefficientlightingaustralia.comCrazy Domains FZ-LLC6 Jun 201517 Jun 20226 Jun 2022
494energyefficientaustralia.comCrazy Domains FZ-LLC6 Jun 201517 Jun 20226 Jun 2022
495energyefficiencyusa.comTurnCommerce, Inc. DBA NameBright.com27 Dec 201510 Feb 202027 Dec 2025
496energyefficiencyadvice.comTucows Domains Inc.6 Jun 200810 Jun 20156 Jun 2016
497energyecosys.comGoDaddy.com, LLC5 Mar 20175 Mar 20175 Mar 2019
498energyexpediters.comTurnCommerce, Inc. DBA NameBright.com17 Sep 201511 Sep 202017 Sep 2024
499energyefficienthospitals.comeNom, Inc.17 Sep 201520 Sep 201617 Sep 2017
500energyefficienthomevalues.comLaunchpad, Inc.17 Sep 201517 Sep 201517 Sep 2017
501energyefficient-power.comNameCheap, Inc.9 Sep 202210 Sep 20249 Sep 2025
502energyelectricite.comGandi SAS5 Jun 201411 Jun 20155 Jun 2017
503energyelastics.comDreamHost, LLC7 Jun 201411 Jun 20157 Jun 2016
504energyencounters.comTucows Domains Inc.14 Jun 201515 May 202414 Jun 2025
505energyelectro.comGoogle, Inc.6 Feb 20244 Jun 20246 Feb 2025
506energyexchange.usGoDaddy.com, LLC12 Jun 201512 Jun 201711 Jun 2018
507energyeye3.comregister.com, Inc.15 Jun 201512 Jun 201715 Jun 2019
508energyetqilibre.comOVH sas15 Jun 201515 Jun 201515 Jun 2016
509energyencounters.netTucows Domains Inc.14 Jun 201515 May 202414 Jun 2025
510energyefficientworld.comGoDaddy.com, LLC16 Jun 201517 Jun 201516 Jun 2016
511energyefficienttrucks.comGoDaddy.com, LLC16 Jun 201517 Jun 201516 Jun 2016
512energyefficientfridge.comGoDaddy.com, LLC16 Jun 201516 Jun 201516 Jun 2016
513energyefficientbattery.comGoDaddy.com, LLC16 Jun 201521 Jun 202416 Jun 2025
514energyeye3.orgregister.com, Inc.15 Jun 201512 Jun 201715 Jun 2019
515energyeye3.netregister.com, Inc.15 Jun 201512 Jun 201715 Jun 2019
516energyefficiency.infoPSI-USA, Inc. dba Domain Robot16 Jun 201531 Jul 202416 Jun 2025
517energyemployeecompensation.comGoDaddy.com, LLC17 Jun 201517 Jun 201517 Jun 2020
518energyexportssummit.comGoDaddy.com, LLC18 Jun 201519 Jun 202418 Jun 2025
519energyexportsexecutivesummit.comGoDaddy.com, LLC18 Jun 201519 Jun 202418 Jun 2025
520energyerica.comTurnCommerce, Inc. DBA NameBright.com19 Jun 20156 Jun 202419 Jun 2025
521energyefficiencyguide.comGoDaddy.com, LLC20 Jun 201529 Jun 202420 Jun 2025
522energyequipment4u.comBeijing Innovative Linkage Technology Ltd. dba dns…17 Sep 201220 Sep 201517 Sep 2016
523energyecosolution.comGoDaddy.com, LLC21 Sep 201521 Sep 201521 Sep 2016
524energyempowermentsolutionsllc.comGoDaddy.com, LLC21 Sep 201521 Sep 201521 Sep 2017
525energyefficiencyworld.comDomainAdministration.com, LLC22 Jun 201522 Jun 201722 Jun 2017
526energyexteriors.comGoDaddy.com, LLC4 Jun 200515 May 20244 Jun 2025
527energyenrichment.comGoDaddy.com, LLC27 Jun 201528 Jun 202427 Jun 2025
528energyefficiencyforentertainment.orgTucows Domains Inc.22 Jun 201026 Jun 201522 Jun 2016
529energyefficiencyforprivateschools.orgTucows Domains Inc.23 Jun 201027 Jun 201523 Jun 2016
530energyefficientroof.comEpik Inc.18 Sep 202018 Oct 202118 Sep 2021
531energyexpo.bizTLD Registrar Solutions Ltd.11 Dec 201713 Dec 201711 Dec 2018
532energyefficiencyinfremontca.comeNom, Inc.23 Sep 201522 Aug 201623 Sep 2017
533energyenterprises.netTucows Domains Inc.27 Jun 200228 May 202427 Jun 2025
534energyefficientexperts.comeNom, Inc.2 Jul 20154 Jul 20242 Jul 2025
535energyefficientattics.comGoDaddy.com, LLC2 Jul 20152 Jul 20152 Jul 2016
536energyefficientizing.comTucows Domains Inc.30 Jun 20084 Jul 201930 Jun 2019
537energyer.comNameKing.com Inc.9 Sep 20238 Oct 20249 Sep 2025
538energyefficientdeals.useNom, Inc.6 Jul 20156 Jul 20155 Jul 2016
539energyexaminer.comAnnulet LLC15 Nov 20152 Jan 202415 Nov 2024
540energyequalslife.comAbove.com Pty Ltd.9 Jul 20159 Jul 20159 Jul 2016
541energyetic.comDynadot, LLC26 Oct 20234 Sep 202426 Oct 2030
542energyelectricllc.comGoogle, Inc.26 Sep 201511 Sep 202426 Sep 2025
543energyefficientbuilders.comTurnCommerce, Inc. DBA NameBright.com28 Sep 202026 Aug 202128 Sep 2024
544energyefficiencylabels.comeNom, Inc.14 Jul 201514 Jul 201514 Jul 2016
545energyefficiencyscore.com1&1 Internet AG25 Jun 201925 Jun 201925 Jun 2025
546energyeventsbcn.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Jul 201516 Jul 201516 Jul 2016
547energyexchangedepot.comGoDaddy.com, LLC18 Jul 201518 Jul 201518 Jul 2017
548energyenviroconsulting.comTucows Domains Inc.15 Jul 201319 Jul 201515 Jul 2016
549energyefficienthomeonline.comeNom, Inc.21 Jul 201520 Jun 201621 Jul 2018
550energyefficienthomeconnect.comeNom, Inc.21 Jul 201520 Jun 201621 Jul 2018
551energyefficientwestvirginia.orgPDR Ltd. d/b/a PublicDomainRegistry.com21 Jul 201521 Jul 201521 Jul 2016
552energyeastcorporation.comTucows Domains Inc.20 Jul 201424 Jul 201520 Jul 2016
553energyefficientproducts.usMisk.com, Inc.12 Jul 200822 Jul 202411 Jul 2025
554energyefficiencyteam.comGoDaddy.com, LLC8 Jul 202019 Sep 20238 Jul 2023
555energyexpertsleague.netGoDaddy.com, LLC29 Sep 201529 Sep 201529 Sep 2016
556energyexpertsleague.comGoDaddy.com, LLC29 Sep 201530 Sep 201629 Sep 2017
557energyexperts-ac.comBeijing Lanhai Jiye Technology Co., Ltd17 Dec 201914 Dec 202317 Dec 2024
558energyeurovince.helpUniregistrar Corp29 Sep 201513 Nov 201629 Sep 2017
559energyers.comDynadot9 LLC29 Jul 20228 Sep 202329 Jul 2023
560energyefficiencyandcarbonreductionawards.comWebfusion Ltd.25 Jul 201518 Jul 201625 Jul 2017
561energyefficiencyandcarbonreduction.comWebfusion Ltd.25 Jul 201518 Jul 201625 Jul 2017
562energyepidemiology.orgWild West Domains, LLC24 Jul 201528 Jun 202424 Jul 2025
563energyeconomics.orgGoDaddy.com, LLC10 Feb 202215 Aug 202410 Feb 2025
564energyequitycrowdfunding.comGoDaddy.com, LLC1 Oct 20151 Oct 20151 Oct 2017
565energyenigma.comFastDomain Inc.10 Oct 201727 Sep 202410 Oct 2025
566energyefficiencysp.comNetwork Solutions, LLC30 Sep 20151 Aug 202330 Sep 2025
567energyefficiency.market1&1 Internet AG30 Sep 201510 Jan 201730 Sep 2017
568energyemails.comAmazon Registrar, Inc.29 Jul 20155 Sep 202328 Jul 2025
569energyefficientbehavior.comGoDaddy.com, LLC24 Apr 201924 Apr 201924 Apr 2020
570energyefficiencyconsult.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
571energyefficiencybancorp.comGMO Internet Inc.2 Oct 20152 Oct 20152 Oct 2016
572energyexodus.netHosting Concepts B.V. dba Openprovider2 Aug 20152 Aug 20152 Aug 2016
573energyelectriccalifornia.comTucows Domains Inc.2 Aug 20116 Aug 20152 Aug 2016
574energyeffnews.comGoDaddy.com, LLC7 Aug 20157 Aug 20157 Aug 2017
575energyefficiencyunlimited.comGoDaddy.com, LLC8 Aug 20158 Aug 20158 Aug 2017
576energyefficiencyreport.comGoDaddy.com, LLC16 Jul 201924 Jul 202316 Jul 2025
577energyedgeinc.comTucows Domains Inc.4 Aug 20108 Aug 20154 Aug 2016
578energyedgecorp.comTucows Domains Inc.4 Aug 20108 Aug 20154 Aug 2016
579energyexxonmobil.comTucows Domains Inc.6 Aug 201410 Aug 20156 Aug 2016
580energyefficiencyexpertise.comTouchdown Domains LLC28 Oct 201928 Oct 201928 Oct 2020
581energyeast.comGoDaddy.com, LLC11 Sep 199716 Apr 202425 Oct 2025
582energyedc.usGoDaddy.com, LLC4 Oct 20154 Oct 20153 Oct 2017
583energyedc.orgGoDaddy.com, LLC4 Oct 201510 Oct 20244 Oct 2026
584energyedc.netGoDaddy.com, LLC4 Oct 20154 Oct 20154 Oct 2017
585energyedc.comGoDaddy.com, LLC4 Oct 20155 Oct 20234 Oct 2025
586energyedc.nycGoDaddy.com, LLC4 Oct 20154 Oct 20153 Oct 2017
587energyempoweredjewelry.comGoDaddy.com, LLC6 Oct 201519 Sep 20226 Oct 2025
588energyecobeet.comRegister.it SPA6 Oct 20156 Oct 20156 Oct 2016
589energyence.comOVH sas5 Oct 20111 Oct 20245 Oct 2025
590energyexpressband.comTucows Domains Inc.14 Nov 202323 Feb 202414 Nov 2024
591energyestandards.net----
592energyestandards.com----
593energyefficiencyawards.comWebfusion Ltd.8 Oct 20159 Oct 20248 Oct 2025
594energyefficiencyinfo.orgGoDaddy.com, LLC29 Sep 201729 Sep 201729 Sep 2018
595energyefficiencyinfo.netGoDaddy.com, LLC9 Oct 20159 Oct 20159 Oct 2016
596energyefficiencyinfo.infoGoDaddy.com, LLC29 Sep 201729 Sep 201729 Sep 2018
597energyevents.walesMesh Digital Limited12 Oct 201520 Sep 201612 Oct 2017
598energyefficiencycheck.comWebfusion Ltd.18 Jan 202220 Jan 202218 Jan 2023
599energyeasy.netTucows Domains Inc.31 Aug 20212 Aug 202431 Aug 2025
600energyeducationgroup.comeNom, Inc.13 Oct 201529 Sep 202013 Oct 2021
601energyefficient.xyzNameCheap, Inc.8 Dec 20219 Dec 20238 Dec 2024
602energyedits.comTurnCommerce, Inc. DBA NameBright.com2 Jan 201827 Dec 20202 Jan 2025
603energyengineerevolution.comTucows Domains Inc.15 Oct 201519 Oct 201715 Oct 2017
604energyesd.workOVH sas16 Oct 201516 Oct 201516 Oct 2016
605energyefficientga.orgWild West Domains, LLC16 Oct 201522 Aug 201616 Oct 2017
606energyexist.comAlantron BiliÅŸim Ltd Åžti.17 Oct 201518 Nov 201517 Oct 2017
607energyexchangeistanbul.comAtak Domain Hosting Internet d/b/a Atak Teknoloji26 Jan 202112 Jun 202326 Jan 2026
608energyenhancedhome.comGoDaddy.com, LLC18 Oct 201518 Oct 201518 Oct 2016
609energyenhanced.comGoDaddy.com, LLC18 Oct 201519 Oct 202318 Oct 2024
610energyevolution.orgGoogle, Inc.19 May 20233 Jul 202419 May 2025
611energyenvironmenttrade.comBeijing Lanhai Jiye Technology Co., Ltd8 Feb 202316 Feb 20248 Feb 2025
612energyelevated.comDynadot, LLC14 Apr 20199 May 202414 Apr 2025
613energyefficiencybank.comEvoPlus Ltd.20 Oct 201520 Oct 201520 Oct 2016
614energyeverything.comNameCheap, Inc.3 Sep 20204 Aug 20243 Sep 2025
615energyenvirorisk.comGoDaddy.com, LLC21 Oct 201521 Oct 201521 Oct 2017
616energyengineeringevolution.comTucows Domains Inc.11 Jan 202115 Jan 202311 Jan 2023
617energyefficientanswers.comTucows Domains Inc.23 Oct 201527 Oct 202023 Oct 2020
618energyexchenger.comTucows Domains Inc.25 Oct 201520 Jul 201725 Oct 2017
619energyexpressfreight.comTucows Domains Inc.25 Oct 201229 Oct 201725 Oct 2017
620energyefficienthottub.com1&1 Internet AG26 Oct 201527 Oct 201626 Oct 2017
621energyefficientbullfrogspas.com1&1 Internet AG26 Oct 201527 Oct 201626 Oct 2017
622energyevolutiondfw.comGoDaddy.com, LLC28 Oct 201528 Oct 202328 Oct 2024
623energyeternal.comGoDaddy.com, LLC29 Oct 201530 Aug 202429 Oct 2025
624energyequinetherapy.comGoDaddy.com, LLC29 Oct 201529 Oct 201529 Oct 2016
625energyearth.xyzGoDaddy.com, LLC14 Mar 201710 Jul 201714 Mar 2018
626energyefficiency.orgDreamHost, LLC3 May 20191 Apr 20243 May 2025
627energyeveryday.xyzHostinger, UAB2 Nov 201526 Apr 20162 Nov 2017
628energyequilibriumhealth.comeNom, Inc.3 Nov 20153 Nov 20153 Nov 2016
629energyenvironmentint.comSibername Internet and Software Technologies Inc.2 Nov 20152 Nov 20152 Nov 2016
630energyeastsj.comGoDaddy.com, LLC3 Nov 20153 Nov 20153 Nov 2016
631energyele.comHiChina Zhicheng Technology Limited4 Nov 201510 Oct 20204 Nov 2025
632energyefficiencyregistry.orgGoDaddy.com, LLC5 Nov 201511 Jul 20245 Nov 2024
633energyeastquebec.comNetwork Solutions, LLC5 Nov 20155 Mar 20175 Nov 2017
634energyefficientlightingsolutions.comGoDaddy.com, LLC6 Nov 20156 Nov 20156 Nov 2016
635energyentry.comGoDaddy.com, LLC6 Nov 201528 Aug 20246 Nov 2025
636energyeveryday.orgEvoPlus Ltd.8 Nov 20158 Nov 20158 Nov 2016
637energyenergyenegry.comGoDaddy.com, LLC9 Nov 20159 Nov 20159 Nov 2016
638energyeducationsummit2016.orgGoDaddy.com, LLC12 Nov 201512 Jan 201612 Nov 2018
639energyefficientgrp.comGoDaddy.com, LLC13 Nov 201513 Nov 201513 Nov 2016
640energyelevated.netLaunchpad, Inc.15 Nov 20157 Nov 201615 Nov 2019
641energyefficient.houseNetwork Solutions, LLC14 Nov 20155 Sep 202214 Nov 2025
642energyefficientwindows.miamiName.com, Inc.15 Nov 201515 Nov 201515 Nov 2016
643energyequalitycoalition.orgGoDaddy.com, LLC16 Nov 201511 Jul 202416 Nov 2024
644energyequalitycoalition.comGoDaddy.com, LLC16 Nov 201517 Nov 202316 Nov 2024
645energyevolutionbreath.comGoDaddy.com, LLC18 Nov 201518 Nov 201518 Nov 2017
646energyefficiencyelectric.comLaunchpad, Inc.17 Nov 201527 Oct 201617 Nov 2019
647energyefficientbatteries.comGoDaddy.com, LLC18 Nov 201529 Aug 202318 Nov 2024
648energyengineeringportal.bizGMO Internet Inc.18 Nov 2015-17 Nov 2016
649energyeficiencecertificate.comAcens Technologies, S.L.U.20 Nov 201520 Nov 201520 Nov 2016
650energyedge.useNom, Inc.21 Nov 201521 Nov 201520 Nov 2016
651energyeverywhere.xyzNameCheap, Inc.23 Nov 20159 Dec 201623 Nov 2017
652energyeverywhere.infoGoDaddy.com, LLC8 May 201724 Jul 20248 May 2027
653energyengineeringanalytics.comGoDaddy.com, LLC23 Nov 201524 Nov 202323 Nov 2024
654energyexpertsnj.comNamevolcano.com LLC20 Jun 202020 Jun 202020 Jun 2021
655energyedges.comGoDaddy.com, LLC24 Nov 201524 Nov 201524 Nov 2016
656energyequipmentstore.comCronon AG25 Nov 201525 Nov 201525 Nov 2017
657energyefficiencyscheme.org1&1 Internet AG25 Nov 2015-25 Nov 2016
658energyefficiencyscheme.comLCN.COM Ltd.25 Nov 201525 Nov 201525 Nov 2016
659energyefficiencyprovider.com1&1 Internet AG25 Nov 201525 Nov 201525 Nov 2016
660energyefficiencyinstaller.com1&1 Internet AG25 Nov 201525 Nov 201525 Nov 2016
661energyexpertsair.comFastDomain Inc.28 Nov 201513 Nov 202328 Nov 2024
662energyeternal.xyzChengdu West Dimension Digital Technology Co., Ltd…27 Nov 201524 Feb 201627 Nov 2017
663energyep.comGoDaddy.com, LLC28 Nov 201527 Dec 202328 Nov 2024
664energyentered.xyzChengdu West Dimension Digital Technology Co., Ltd…27 Nov 201524 Feb 201627 Nov 2017
665energyequationbook.comWebfusion Ltd.30 Nov 201523 Nov 201630 Nov 2017
666energyexpo2017.orgGoDaddy.com, LLC28 Nov 201528 Nov 201528 Nov 2016
667energyefficiency-ks.comGoDaddy.com, LLC27 Nov 201527 Nov 201527 Nov 2016
668energyefficient.techNameCheap, Inc.30 Jan 202331 Aug 202330 Jan 2025
669energyefficiencyhotwaterheaters.xyzNameCheap, Inc.30 Nov 20155 Jan 201630 Nov 2017
670energyeraco.comGoDaddy.com, LLC1 Dec 20151 Dec 20151 Dec 2020
671energyefficientsteel.orgGoDaddy.com, LLC26 Nov 201526 Nov 201526 Nov 2016
672energyevolutionep.comGoDaddy.com, LLC2 Dec 20152 Dec 20152 Dec 2017
673energyeden.comGoDaddy.com, LLC18 Jan 20182 Jan 202418 Jan 2025
674energyequationclub.comWild West Domains, LLC4 Dec 20154 Dec 20154 Dec 2016
675energyefficienthomepro.comeNom, Inc.4 Dec 20155 Nov 20164 Dec 2017
676energyexchangers.comFabulous.com Pty Ltd.23 Nov 201014 Dec 202323 Nov 2024
677energyelegant.comTurnCommerce, Inc. DBA NameBright.com7 Dec 20157 Dec 20157 Dec 2016
678energyequityguide.comGoDaddy.com, LLC8 Dec 20158 Dec 20158 Dec 2016
679energyequitybydesign.comGoDaddy.com, LLC8 Dec 20158 Dec 20158 Dec 2016
680energyefficienthouses.netGoDaddy.com, LLC9 Dec 20159 Dec 20159 Dec 2016
681energyelectives.comregister.com, Inc.1 Oct 20135 Oct 20201 Oct 2030
682energyenthuse.comGoDaddy.com, LLC11 Dec 201511 Dec 201511 Dec 2016
683energyefficientsensors.comGoDaddy.com, LLC13 Dec 201513 Dec 201513 Dec 2016
684energyenabled.comeNom, Inc.16 Dec 201516 Dec 201516 Dec 2016
685energyelements5.comLaunchpad, Inc.18 Dec 201517 Dec 201618 Dec 2017
686energyefficiencyutility.comBeijing Lanhai Jiye Technology Co., Ltd17 Apr 202310 Apr 202417 Apr 2025
687energyefficiencyinvestments.comTucows Domains Inc.20 Dec 201524 Dec 202020 Dec 2020
688energyefficiencycapital.comTucows Domains Inc.20 Dec 201524 Dec 202020 Dec 2020
689energyevolutionmastery.comWild West Domains, LLC22 Dec 201522 Dec 201522 Dec 2017
690energyessencealchemist.comNetwork Solutions, LLC24 Dec 201524 Dec 201524 Dec 2016
691energyegghead.comTurnCommerce, Inc. DBA NameBright.com2 Jun 20182 Jul 20242 Jun 2024
692energyessences.usTucows Domains Inc.26 Dec 201512 Dec 201625 Dec 2017
693energyessences.netTucows Domains Inc.26 Dec 201530 Dec 201826 Dec 2018
694energyelevatorservices.comGoDaddy.com, LLC28 Dec 20151 Mar 201728 Dec 2021
695energyefficiencyexpert.comTurnCommerce, Inc. DBA NameBright.com28 Dec 201522 Dec 202028 Dec 2024
696energyevaluations.netGoDaddy.com, LLC29 Dec 201529 Dec 201529 Dec 2016
697energyefficientsolutionsllc.orgTucows Domains Inc.29 Dec 201512 Dec 202329 Dec 2024
698energyefficientsolutionsllc.netTucows Domains Inc.29 Dec 20157 Dec 202329 Dec 2024
699energyefficientsolutionsllc.infoTucows Domains Inc.29 Dec 201512 Dec 202329 Dec 2024
700energyefficientsolutionsllc.comTucows Domains Inc.29 Dec 20157 Dec 202329 Dec 2024
701energyefficientglass.comUniregistrar Corp22 Nov 200415 May 202422 Nov 2024
702energyefficiencysolutionsllc.orgTucows Domains Inc.29 Dec 201512 Dec 202329 Dec 2024
703energyefficiencysolutionsllc.netTucows Domains Inc.29 Dec 20157 Dec 202329 Dec 2024
704energyefficiencysolutionsllc.infoTucows Domains Inc.29 Dec 201512 Dec 202329 Dec 2024
705energyefficiencysolutionsllc.comTucows Domains Inc.29 Dec 20157 Dec 202329 Dec 2024
706energyefficientmethods.comGoDaddy.com, LLC31 Dec 201531 Dec 201531 Dec 2016
707energyej.comTPP Wholesale Pty Ltd.4 Jan 201630 Dec 20164 Jan 2018
708energyendowment.comGoDaddy.com, LLC6 Jan 20166 Jan 20166 Jan 2017
709energyemag.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Jan 20167 Jan 20167 Jan 2017
710energyefficiencyexpo.comCSC Corporate Domains, Inc.7 Jan 20163 Jan 20247 Jan 2025
711energyedil.comTucows Domains Inc.10 Jan 201228 Dec 202310 Jan 2025
712energyexercise.comMegazone Corp., dba HOSTING.KR11 Dec 200822 Jan 202411 Dec 2024
713energyefficiencyrenewableenergy.orgGoDaddy.com, LLC10 Jan 201610 Jan 201610 Jan 2017
714energyefficiencyrenewableenergy.netGoDaddy.com, LLC10 Jan 201610 Jan 201610 Jan 2017
715energyefficiencyrenewableenergy.infoGoDaddy.com, LLC10 Jan 2016-10 Jan 2017
716energyefficiencyrenewableenergy.comGoDaddy.com, LLC10 Jan 201610 Jan 201610 Jan 2017
717energyefficiencyexpert.netGoDaddy.com, LLC10 Jan 201610 Jan 201610 Jan 2017
718energyefficienthomesofalaska.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2017
719energyeventsnz.comAscio Technologies, Inc. Danmark - Filial af Ascio…13 Jan 201613 Jan 201613 Jan 2017
720energyeffeicincy.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2017
721energyefficienthomesofalaska.orgGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2017
722energyefficienthomesofalaska.netGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2017
723energyefficienthomesofalaska.infoGoDaddy.com, LLC12 Jan 2016-12 Jan 2017
724energyefficiencies.neteNom, Inc.11 Jan 201612 Jan 201611 Jan 2017
725energyefficientservices.bizGoDaddy.com, LLC7 Jan 20167 Jan 20166 Jan 2017
726energyefficientlighting.infoGoDaddy.com, LLC7 Jan 2016-7 Jan 2017
727energyendowment.orgGoDaddy.com, LLC6 Jan 20166 Jan 20166 Jan 2017
728energyequityfinance.comeNom, Inc.13 Jan 201631 Jul 201713 Jan 2018
729energyefficienthomesofalaska.usGoDaddy.com, LLC12 Jan 201612 Jan 201611 Jan 2017
730energyes.netChengdu West Dimension Digital Technology Co., Ltd…15 Jan 201615 Jan 201615 Jan 2017
731energyenterprises.bizGMO Internet Inc.13 May 202018 May 202013 May 2021
732energyefficiencyspecialist.comTPP Wholesale Pty Ltd.19 Jan 201619 Jan 201619 Jan 2017
733energyefficiencyplus.comLaunchpad, Inc.19 Jan 201619 Jan 201619 Jan 2017
734energyefficienthome.solutionsGoDaddy.com, LLC21 Jan 201621 Jan 201621 Jan 2017
735energyemployees.comeNom, Inc.21 Jan 201622 Dec 202321 Jan 2025
736energyextended.comAscio Technologies, Inc. Danmark - Filial af Ascio…14 Jun 202114 Jun 202114 Jun 2022
737energyefficientsolutions.infoGoDaddy.com, LLC21 Jan 201621 Mar 201621 Jan 2018
738energyegypt.netWild West Domains, LLC22 Jan 201622 Dec 202322 Jan 2025
739energyengineeringshow.comGMO Internet Inc.25 Jan 201620 Jan 201724 Jan 2018
740energyelectricsolar.orgGoDaddy.com, LLC25 Jan 201626 Jan 201725 Jan 2018
741energyelectricsolar.netGoDaddy.com, LLC25 Jan 201625 Jan 201625 Jan 2017
742energyelectricsolar.infoGoDaddy.com, LLC25 Jan 201626 Jan 201725 Jan 2018
743energyelectricsolar.comGoDaddy.com, LLC25 Jan 201625 Jan 201625 Jan 2021
744energyelectricsd.orgGoDaddy.com, LLC25 Jan 201626 Mar 201625 Jan 2021
745energyelectricsd.netGoDaddy.com, LLC25 Jan 201625 Jan 201625 Jan 2021
746energyelectricsd.infoGoDaddy.com, LLC25 Jan 201626 Mar 201625 Jan 2021
747energyelectricsandiego.orgGoDaddy.com, LLC25 Jan 201626 Mar 201625 Jan 2021
748energyelectricsandiego.netGoDaddy.com, LLC25 Jan 201625 Jan 201625 Jan 2021
749energyefficientwindow.orgGoDaddy.com, LLC25 Jan 201612 Jul 202425 Jan 2025
750energyexchangeenablers.netKey-Systems GmbH26 Jan 201625 Jan 202426 Jan 2025
751energyelectricsolar.usGoDaddy.com, LLC25 Jan 201625 Jan 201624 Jan 2021
752energyelectricsd.usGoDaddy.com, LLC25 Jan 201625 Jan 201624 Jan 2021
753energyexchangeenablers.comKey-Systems GmbH26 Jan 201625 Jan 202426 Jan 2025
754energyefficientwallconstructionpittsburgh.comGoDaddy.com, LLC28 Jan 201628 Jan 201628 Jan 2017
755energyefficientfoundationwallspittsburgh.comGoDaddy.com, LLC28 Jan 201628 Jan 201628 Jan 2017
756energyefficientconcretewallspittsburgh.comGoDaddy.com, LLC28 Jan 201628 Jan 201628 Jan 2017
757energyefficientconcreteformwalls.comGoDaddy.com, LLC28 Jan 201628 Jan 201628 Jan 2017
758energyequality.orgGoogle, Inc.20 Jan 202318 Apr 202420 Jan 2025
759energyemployment.netGoDaddy.com, LLC12 Feb 202325 Mar 202412 Feb 2024
760energyenhancement.comNameKing.com Inc.15 Jan 201412 Feb 202415 Jan 2025
761energyefficiencyqs.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2017
762energyefficiencyfundingllc.comGoDaddy.com, LLC2 Feb 201620 Sep 20222 Feb 2026
763energyexperts.servicesPDR Ltd. d/b/a PublicDomainRegistry.com5 Feb 201622 Mar 20175 Feb 2018
764energyeyeserum.comNameCheap, Inc.10 Jul 201810 Jul 201810 Jul 2019
765energyefficientsprayfoam.comGoDaddy.com, LLC8 Mar 20238 Mar 20238 Mar 2025
766energyelectrician.comNameCheap, Inc.11 Feb 201625 Jan 202311 Feb 2025
767energyefficientwindow.comTurnCommerce, Inc. DBA NameBright.com22 Aug 201816 Aug 202022 Aug 2025
768energyefficientupgrades.comGoDaddy.com, LLC13 Sep 201913 Sep 201913 Sep 2020
769energyefficientshipping.comAscio Technologies, Inc. Danmark - Filial af Ascio…14 Feb 201613 Mar 201714 Feb 2018
770energyevolves.comDropCatch.com 867 LLC6 May 201715 Jul 20176 May 2018
771energyenforcer.comGMO Internet Inc.15 Feb 201615 Feb 201615 Feb 2017
772energyefficiency.expertCSL Computer Service Langenbach GmbH d/b/a joker.c…17 Feb 201619 Feb 201717 Feb 2018
773energyefficientshow.comTucows Domains Inc.15 Feb 201219 Feb 201615 Feb 2017
774energyefficienthomeshow.comTucows Domains Inc.15 Feb 201219 Feb 201615 Feb 2017
775energyefficientmodularhomes.comDropCatch.com 494 LLC10 May 201710 May 201710 May 2018
776energyenergyenergyenergyenergyenergyenergyenergyenergyenergy.com101domain, Inc.22 Feb 201624 Dec 201622 Feb 2017
777energyequityfund.xyzNameCheap, Inc.22 Feb 201614 Mar 201622 Feb 2017
778energyelectricalengineering.comGoDaddy.com, LLC23 Jul 20214 Oct 202323 Jul 2023
779energyest.comDropCatch.com 516 LLC3 Aug 20244 Aug 20243 Aug 2025
780energyexpertsusa.comNameCheap, Inc.3 Jul 20133 Jun 20243 Jul 2025
781energyessence.infoNameCheap, Inc.16 May 201715 Jul 201716 May 2018
782energyehs.comGoDaddy.com, LLC27 Oct 20211 Nov 202327 Oct 2024
783energyefficiencyroup.comTucows Domains Inc.26 Feb 20162 Mar 201726 Feb 2017
784energyefficiency.onlineeNom, Inc.4 May 202016 Jul 20244 May 2024
785energyefficientlightingservices.netGoDaddy.com, LLC1 Mar 20161 Mar 20161 Mar 2017
786energyefficient.proAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…24 Jun 202124 Jun 202124 Jun 2022
787energyemployee.comTurnCommerce, Inc. DBA NameBright.com2 Mar 201620 Aug 20212 Mar 2025
788energyecowindows.comGoDaddy.com, LLC1 Mar 20161 Mar 20161 Mar 2018
789energyenergyenergyenergyenergyenergyenergyenergyenergyenergy.energyTucows Domains Inc.18 Feb 201623 Feb 201618 Feb 2017
790energyesprit.comTucows Domains Inc.2 Mar 20146 Feb 20242 Mar 2026
791energyefficiency.siteeNom, Inc.5 Mar 201613 Mar 20175 Mar 2018
792energyexpertscy.comGoDaddy.com, LLC7 Mar 20167 Mar 20167 Mar 2018
793energyediting.comTucows Domains Inc.5 Nov 201921 Oct 20235 Nov 2024
794energyevent.netOnlineNIC, Inc.11 Mar 201611 Mar 201611 Mar 2025
795energyefficientsystemsllc.comTucows Domains Inc.7 Mar 200911 Mar 20167 Mar 2017
796energyemetals.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Mar 201613 Mar 201613 Mar 2017
797energyeditables.comGoDaddy.com, LLC13 Mar 201613 Mar 201613 Mar 2017
798energyexchange.mobiGoDaddy.com, LLC14 Mar 201614 Mar 201614 Mar 2017
799energyecables.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Jun 201826 Jun 201826 Jun 2019
800energyefficiencytesting.comNetistrar Limited17 Jan 202230 Mar 202417 Jan 2024
801energyessentialsforempaths.comLaunchpad, Inc.16 Mar 201622 Feb 202416 Mar 2025
802energyefficientnetwork.comCosmotown, Inc.17 Mar 201617 Mar 201617 Mar 2017
803energyeclecticshealing.comNetwork Solutions, LLC18 Mar 201628 May 202418 Mar 2026
804energyexpertsaz.comregister.com, Inc.19 Mar 201619 Mar 201619 Mar 2017
805energyefi.comGoDaddy.com, LLC22 Mar 201622 Mar 201622 Mar 2018
806energyentirehosme.comeNom, Inc.23 Mar 201623 Mar 201623 Mar 2017
807energyefficiencypartners.comGoDaddy.com, LLC25 Mar 201626 Mar 202425 Mar 2026
808energyefficiencyfinancing.netTucows Domains Inc.23 Mar 201223 Mar 201223 Mar 2017
809energyefficiencyfinance.netTucows Domains Inc.23 Mar 201223 Mar 201223 Mar 2017
810energyefficiencyfinancing.org-23 Mar 201223 Mar 201223 Mar 2017
811energyefficiencyfinance.org-23 Mar 201223 Mar 201223 Mar 2017
812energyexchangeusa.comGoDaddy.com, LLC28 Mar 201629 Mar 202428 Mar 2025
813energyeastontario.comSibername Internet and Software Technologies Inc.28 Mar 201627 Mar 201728 Mar 2018
814energyexchange.istanbul-24 Mar 201624 Mar 201624 Mar 2018
815energyexperts.solarGoDaddy.com, LLC29 Mar 201615 Jul 202429 Mar 2025
816energyexpert.solarGoDaddy.com, LLC29 Mar 201615 Jul 202429 Mar 2025
817energyepact.comGoDaddy.com, LLC31 Mar 201631 Mar 201631 Mar 2017
818energyenergy.orgNameCheap, Inc.15 Apr 202211 Apr 202415 Apr 2025
819energyenergy.netOnlineNIC, Inc.2 Apr 20163 Apr 20172 Apr 2018
820energyefficiency4u.solutionsGoDaddy.com, LLC4 Apr 201619 May 20174 Apr 2018
821energyefficiency4u.infoGoDaddy.com, LLC4 Apr 20165 Apr 20174 Apr 2018
822energyefficiencytoday.netGoDaddy.com, LLC16 Nov 201816 Nov 201816 Nov 2019
823energyefficiency4u.orgGoDaddy.com, LLC4 Apr 20165 Apr 20174 Apr 2018
824energyeco101.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Apr 20165 Apr 20165 Apr 2017
825energyexsperts.comGoDaddy.com, LLC5 Apr 20165 Apr 20165 Apr 2017
826energyevlauation.comGoDaddy.com, LLC9 Apr 20169 Apr 20169 Apr 2017
827energyenterprise.comAnnulet LLC28 Jun 202215 Aug 202428 Jun 2025
828energyengagedok.infoGoDaddy.com, LLC11 Apr 201616 Jul 202411 Apr 2025
829energyengagedok.orgGoDaddy.com, LLC11 Apr 201613 Jul 202411 Apr 2025
830energyengagedok.netGoDaddy.com, LLC11 Apr 201612 Apr 202311 Apr 2025
831energyengagedok.comGoDaddy.com, LLC11 Apr 201621 Sep 202211 Apr 2026
832energyefficientsolution.comCosmotown, Inc.12 Apr 201613 Apr 202412 Apr 2025
833energyexportour.infoRegister.it SPA14 Apr 201614 Apr 201614 Apr 2017
834energyexportour.comRegister.it SPA14 Apr 201616 Feb 202414 Apr 2025
835energyethics.netGoogle, Inc.12 Jan 202113 Jan 202412 Jan 2025
836energyefficiencyscotland.comTucows Domains Inc.11 Apr 201411 Apr 201411 Apr 2017
837energyexpotour.infoRegister.it SPA15 Apr 201621 Feb 202415 Apr 2025
838energyexpotour.comRegister.it SPA15 Apr 201616 Feb 202415 Apr 2025
839energyecowas.comGoDaddy.com, LLC16 Apr 201616 Apr 201616 Apr 2017
840energyefficient.solarGoDaddy.com, LLC17 Apr 201616 Jul 202417 Apr 2025
841energyefficient.expertGoDaddy.com, LLC17 Apr 201616 Jul 202417 Apr 2025
842energyefficientexperts.usGoDaddy.com, LLC17 Apr 201617 Apr 201716 Apr 2018
843energyefficientexperts.orgGoDaddy.com, LLC17 Apr 201614 Jul 202417 Apr 2025
844energyefficientexperts.netGoDaddy.com, LLC17 Apr 201618 Apr 202417 Apr 2025
845energyefficientexperts.infoGoDaddy.com, LLC17 Apr 201616 Jul 202417 Apr 2025
846energyefficiencysolution.netNetwork Solutions, LLC10 Apr 201810 Apr 201810 Apr 2019
847energyefficientupgrades.usGoDaddy.com, LLC20 Apr 201620 Apr 201719 Apr 2018
848energyeighths.comDynadot, LLC20 Apr 201622 Mar 201720 Apr 2018
849energyedition.comInternet Domain Services BS Corp16 Feb 202228 Mar 202416 Feb 2024
850energyexperiment.orgWild West Domains, LLC23 Apr 201623 Apr 202423 Apr 2025
851energyexperiment.infoWild West Domains, LLC23 Apr 201624 Apr 201723 Apr 2018
852energyequine.ca-29 Dec 20093 Jan 202429 Dec 2025
853energyefficienthomeremodeling.netTucows Domains Inc.26 Apr 201630 Apr 202026 Apr 2020
854energyefficienthomeremodelers.netTucows Domains Inc.26 Apr 201630 Apr 202026 Apr 2020
855energyefficienthomeremodelers.infoTucows Domains Inc.26 Apr 201630 Apr 202026 Apr 2021
856energyefficientequity.infoNetwork Solutions, LLC26 Apr 201626 Apr 201626 Apr 2017
857energyefficienthomeremodeling.comTucows Domains Inc.26 Apr 201630 Apr 202026 Apr 2020
858energyefficienthomeremodelers.comTucows Domains Inc.26 Apr 201630 Apr 202126 Apr 2021
859energyefficiencypv.comNetwork Solutions, LLC26 Apr 201614 Apr 201726 Apr 2018
860energyexpediters.bizTucows Domains Inc.27 Apr 200927 Apr 200926 Apr 2016
861energyedgeplatform.com-2 May 20162 May 20162 May 2017
862energyequilibrium.orgKey-Systems GmbH4 May 20164 Jul 20164 May 2017
863energyeconomizer.netCronon AG4 May 201623 Jun 20244 May 2025
864energyefficientinsulation.comTurnCommerce, Inc. DBA NameBright.com7 May 20161 May 20207 May 2025
865energyefficiencytools.comGoDaddy.com, LLC16 Feb 202216 Feb 202416 Feb 2026
866energyeconomicsninja.comName.com, Inc.8 May 20168 May 20168 May 2017
867energyefficientlighting.comTierraNet Inc. d/b/a DomainDiscover29 May 200129 May 202429 May 2029
868energyexcel.net-11 May 201611 May 201611 May 2017
869energyefficientbuildings.us-12 May 201612 May 201611 May 2017
870energyepcsolutions.comGoogle, Inc.13 May 201615 May 202413 May 2025
871energyefficiencyindia.comGoDaddy.com, LLC12 May 201612 May 201612 May 2017
872energyefficientpropertyinspection.comFastDomain Inc.13 May 201613 May 201713 May 2018
873energyefficienthomeinspections.comFastDomain Inc.13 May 201613 May 201713 May 2018
874energyefficientbuildinginspection.comFastDomain Inc.13 May 201613 May 201713 May 2018
875energyefficiencyinspection.comFastDomain Inc.13 May 201613 May 201713 May 2018
876energyeconometrics.comBlue Angel Domains LLC13 May 201613 May 201613 May 2017
877energyexpensesolutions.com1&1 Internet AG16 May 201616 May 201616 May 2018
878energyefficiencyalberta.comNameCheap, Inc.14 Jun 202226 Jul 202314 Jun 2023
879energyefficiency-hq.comeNom, Inc.17 May 201618 Apr 201717 May 2018
880energyeconomicsrn.comSafeNames Ltd.20 May 20161 Jun 201720 May 2019
881energyeconomicsresearchnetwork.comSafeNames Ltd.20 May 20161 Jun 201720 May 2019
882energyeconomicsresearchnet.comSafeNames Ltd.20 May 20161 Jun 201720 May 2019
883energyeconomicsrn.netSafeNames Ltd.20 May 20161 Jun 201720 May 2019
884energyeconomicsresearchnetwork.netSafeNames Ltd.20 May 20161 Jun 201720 May 2019
885energyeconomicsresearchnet.netSafeNames Ltd.20 May 20161 Jun 201720 May 2019
886energyexpo2018.comDesert Sand Domains, LLC6 Aug 20196 Aug 20196 Aug 2020
887energyeg.comTurnCommerce, Inc. DBA NameBright.com20 May 201614 May 202120 May 2025
888energyexpertsuk.comNameCheap, Inc.18 Mar 202229 May 202418 Mar 2024
889energyexemplar.comAmazon Registrar, Inc.6 May 20066 Jan 20236 May 2028
890energyefficienthomeforsale.comGoDaddy.com, LLC25 May 201625 May 201625 May 2018
891energyefficientcannabis.comGoDaddy.com, LLC24 May 201624 May 201624 May 2017
892energyefficiencybharat.comGoDaddy.com, LLC24 May 201624 May 201624 May 2017
893energyengineeringforum.infoGoDaddy.com, LLC27 May 201626 Jul 201627 May 2021
894energyengineeringforum.orgGoDaddy.com, LLC27 May 201627 Jul 201627 May 2021
895energyengineeringforum.netGoDaddy.com, LLC27 May 201627 May 201627 May 2021
896energyengineeringforum.comGoDaddy.com, LLC27 May 201627 May 201627 May 2021
897energyee.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…27 May 202427 May 202427 May 2025
898energyeconomy.infoeNom, Inc.30 May 201615 May 201730 May 2018
899energyefficientshop.comNetwork Solutions, LLC8 Jan 202413 Feb 20248 Jan 2025
900energyemrooz.comTucows Domains Inc.5 Jun 20161 May 20175 Jun 2018
901energyedgeconsulting.comNetwork Solutions, LLC19 Nov 200820 Sep 202419 Nov 2025
902energyexperts.emailGoogle, Inc.3 Jun 20163 Jun 20163 Jun 2017
903energyewitchguarantee.com-26 Jul 201626 Jul 201626 Jul 2017
904energyefficienthomeuk.comeNom, Inc.13 Jun 201613 Jun 201613 Jun 2017
905energyefficiencyaspirin.comeNom, Inc.13 Jun 201613 Jun 201613 Jun 2017
906energyefficientmortgageprogram.comGoDaddy.com, LLC14 Jun 201614 Jun 201614 Jun 2017
907energyentrepot.comUniregistrar Corp15 Jun 201615 Jun 201615 Jun 2017
908energyembroidery.comTucows Domains Inc.12 Jun 201412 Jun 201412 Jun 2017
909energyedger.comWild West Domains, LLC21 Jun 201622 May 202421 Jun 2026
910energyemployeeservices.comeNom, Inc.21 Jun 201622 May 202421 Jun 2025
911energyefficient.downloadAlpnames Limited23 Jun 201623 Jun 201622 Jun 2017
912energyeva.com-24 Jun 201624 Jun 201624 Jun 2017
913energyenvironmentblog.comWeb Werks India Pvt. Ltd d/b/a ZenRegistry.com24 Jun 201624 Jun 201624 Jun 2017
914energyequipmentco.comFastDomain Inc.2 Jan 200418 Dec 20232 Jan 2025
915energyefficieint.comGoDaddy.com, LLC25 Jun 201625 Jun 201625 Jun 2017
916energyefficencyrebates.comNamesilo, LLC1 Nov 20164 Dec 20171 Nov 2017
917energyelementsusa.comFastDomain Inc.29 Jun 20161 Aug 201729 Jun 2017
918energyestimated.bidChengdu West Dimension Digital Technology Co., Ltd…30 Jun 201630 Jun 201629 Jun 2017
919energyelectricsd.comWix.com Ltd.23 Aug 200721 Dec 202323 Aug 2027
920energyelectricsandiego.comGoDaddy.com, LLC23 Aug 200724 Aug 202423 Aug 2025
921energyelders.orgName.com, Inc.4 Jul 201612 Jun 20174 Jul 2018
922energyemp.comGoDaddy.com, LLC31 Dec 200831 Dec 202331 Dec 2025
923energyeconresource.comGoDaddy.com, LLC5 Jul 20165 Jul 20165 Jul 2017
924energyeurasia.comTurnCommerce, Inc. DBA NameBright.com26 Jul 202120 Jul 202226 Jul 2025
925energyenergetics.comTucows Domains Inc.25 Sep 202425 Sep 202425 Sep 2025
926energyesplugues.comArsys Internet, S.L. dba NICLINE.COM8 Jul 201629 Jun 20238 Jul 2025
927energyequity.xyzDNC Holdings, Inc.9 Jun 201614 Jun 20169 Jun 2017
928energyexpects.siteChengdu West Dimension Digital Technology Co., Ltd…8 Jul 20168 Jul 20168 Jul 2017
929energyenhancingtherapy.comGoDaddy.com, LLC9 Jul 20169 Jul 20169 Jul 2017
930energyefficienthomedesign.comGoDaddy.com, LLC7 Nov 20227 Nov 20227 Nov 2023
931energyefficientlights.in-17 Jan 200917 Jan 201817 Jan 2019
932energyefficient.lightingGoDaddy.com, LLC23 Sep 202423 Sep 202423 Sep 2025
933energyefficiency.guruGoDaddy.com, LLC3 Feb 201420 Mar 20193 Feb 2021
934energyefficient.constructioneNom, Inc.19 Feb 201412 Mar 201719 Feb 2018
935energyefficient.contractorseNom, Inc.19 Feb 201412 Mar 201719 Feb 2018
936energyefficiency.dateAlpnames Limited12 Jul 201612 Jul 201711 Jul 2017
937energyefficientmortgage.houseGoDaddy.com, LLC26 Apr 20142 Jul 202426 Apr 2025
938energyefficiency.educationGo Montenegro Domains, LLC2 Apr 20143 Apr 20202 Apr 2021
939energyefficiency.tipsCSC Corporate Domains, Inc.26 Feb 201419 Feb 202426 Feb 2025
940energyefficiency.solutionsGoDaddy.com, LLC24 Apr 20141 Jul 202424 Apr 2025
941energyefficient.technologyeNom, Inc.19 Feb 201412 Mar 201719 Feb 2018
942energyefficiencyadvisers.comGoDaddy.com, LLC15 Jul 201616 Jul 202415 Jul 2026
943energyefficienthomeplan.comNameCheap, Inc.6 Jul 202217 Sep 20236 Jul 2023
944energyefficienthouseplan.comNameCheap, Inc.6 Jul 20227 Jul 20246 Jul 2025
945energyevolved.linkUniregistrar Corp22 May 201411 May 201622 May 2017
946energyexpansion.bizGoDaddy.com, LLC6 Dec 20126 Dec 20145 Dec 2016
947energyefficiencymeter.bizNameCheap, Inc.1 May 201530 Dec 201730 Apr 2018
948energyequation.bizGoDaddy.com, LLC19 Feb 201419 Feb 201718 Feb 2018
949energyexplorer.bizCSC Corporate Domains, Inc.18 Mar 201011 Jul 201717 Mar 2018
950energyebusiness.bizGoDaddy.com, LLC21 Dec 201230 Jun 201720 Dec 2019
951energyelettrica.bizRegister.it SPA31 Oct 201215 Dec 201530 Oct 2016
952energyelements.bizGoDaddy.com, LLC15 Dec 201120 Jun 202414 Dec 2024
953energyeffciencymatters.bizTucows Domains Inc.24 Jun 201127 Jun 202123 Jun 2021
954energyevolution.bizGoDaddy.com, LLC9 Jul 20139 Jul 20178 Jul 2018
955energyebooks.bizGoDaddy.com, LLC16 Oct 200716 Oct 201615 Oct 2017
956energyefficient.bizBlue Razor Domains, LLC22 Jan 201022 Jan 201821 Jan 2019
957energyefficiencyconsultants.bizGoDaddy.com, LLC28 Nov 201013 Aug 201627 Nov 2019
958energyeducation.bizGMO Internet Inc.4 Dec 20158 Dec 20153 Dec 2016
959energyexperts.bizPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 202025 Dec 202326 Jan 2025
960energyeconomy.bizNetwork Solutions, LLC26 Feb 200518 Jul 202425 Feb 2025
961energyefficientbuilding.bizGoDaddy.com, LLC25 May 200612 Aug 201624 May 2018
962energyelectric.bizregister.com, Inc.14 Sep 200413 Sep 202313 Sep 2024
963energyefficienthomes.bizGoDaddy.com, LLC19 May 202024 May 202019 May 2021
964energyefficiency.bizPSI-USA, Inc. dba Domain Robot19 Oct 20103 Dec 202318 Oct 2024
965energyevents.bizMesh Digital Limited14 Jun 200919 Jun 202413 Jun 2025
966energyefficientstructures.bizDomain.com, LLC22 Dec 200511 Dec 201721 Dec 2018
967energyefficiencyproducts.bizTucows Domains Inc.30 Nov 20084 Dec 201729 Nov 2017
968energyequalsmasstimesthespeedoflightsquared.bizTucows Domains Inc.11 Jan 200731 Dec 201710 Jan 2019
969energyeast.bizGoDaddy.com, LLC8 Nov 200113 Jun 20247 Nov 2025
970energyexplosion.bizGoDaddy.com, LLC26 Aug 20235 Feb 202426 Aug 2024
971energyefficiencyindex.bizTucows Domains Inc.28 Jun 20087 Aug 202327 Jun 2023
972energyexchange.bizNetwork Solutions, LLC14 Jun 202419 Jun 202414 Jun 2027
973energyenhancement.bizGMO Internet Inc.20 Apr 201420 Mar 201719 Apr 2018
974energyengineers.bizGoDaddy.com, LLC5 Dec 200814 Dec 20174 Dec 2018
975energyescrow.comTurnCommerce, Inc. DBA NameBright.com4 Oct 201928 Sep 20204 Oct 2025
976energyefficiencymissouri.com1&1 Internet AG10 Mar 201410 Mar 201710 Mar 2018
977energyexecutives.netregister.com, Inc.6 Oct 20176 Oct 20176 Oct 2018
978energyenvigroup.com-20 Jul 201620 Jul 201620 Jul 2017
979energyera.netGoogle, Inc.9 Aug 202326 Jul 20249 Aug 2025
980energyelementals.com-22 Jul 201622 Jul 201622 Jul 2017
981energyenterprisesid.comTucows Domains Inc.23 Jul 201627 Jul 201723 Jul 2017
982energyenterprisesidaho.comTucows Domains Inc.23 Jul 201627 Jul 201723 Jul 2017
983energyelectricia.comeNom, Inc.22 Jul 201623 Jun 201722 Jul 2018
984energyexecutives.energyGoDaddy.com, LLC20 Jul 201631 Aug 201720 Jul 2017
985energyeducationbike.com-23 Jul 201623 Jul 201623 Jul 2017
986energyenjoy.com-23 Jul 201623 Jul 201623 Jul 2017
987energyengineeringservices.com-24 Jul 201624 Jul 201624 Jul 2017
988energyexpert.bizGoDaddy.com, LLC26 Jul 201616 Jul 201725 Jul 2018
989energyefficiencyca.com-26 Jul 201626 Jul 201626 Jul 2017
990energyexcerpts.comGoDaddy.com, LLC26 Jul 201628 Sep 202226 Jul 2025
991energyexpert.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…25 May 20232 Jul 202425 May 2024
992energyefficienthomesforsale.netGoDaddy.com, LLC27 Jul 20166 Sep 202427 Jul 2024
993energyexpertacademy.com-27 Jul 201627 Jul 201627 Jul 2017
994energyembassy.orgGoogle, Inc.27 Jul 201626 Aug 201727 Jul 2018
995energyefficientidaho.comDomain.com, LLC29 Jul 20165 Jun 201729 Jul 2018
996energyenabler.com-29 Jul 201629 Jul 201629 Jul 2018
997energyefficientidaho.orgDomain.com, LLC29 Jul 20165 Jun 201729 Jul 2018
998energyexperts-me.comeNom, Inc.2 Aug 201623 Jul 20172 Aug 2018
999energyefficiencynj.comGoDaddy.com, LLC4 Aug 20164 Aug 20164 Aug 2018
1000energyefficiencyaustin.com-4 Aug 20164 Aug 20164 Aug 2018

Displaying 1,000 out of 5,469 domains starting with the keyword "ENERGYE". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=energye

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now