With support for 
Keyword: FAREWELL
Reverse Whois » KEYWORD [farewell ] { 2,244 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | farewell.info | Dynadot, LLC | 28 Nov 2023 | 8 Jul 2024 | 28 Nov 2024 |
| 2 | farewell.nyc | GoDaddy.com, LLC | 3 Oct 2014 | 8 Oct 2023 | 2 Oct 2024 |
| 3 | farewell.today | - | 2 Jan 2024 | 6 Feb 2024 | 2 Jan 2025 |
| 4 | farewell.party | Porkbun, LLC | 17 Feb 2015 | 29 Mar 2023 | 16 Feb 2023 |
| 5 | farewell.international | 1&1 Internet AG | 12 Jun 2015 | 12 Jun 2017 | 12 Jun 2018 |
| 6 | farewell.work | Minds + Machines Registrar Limited | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 7 | farewell.photography | Network Solutions, LLC | 18 Jun 2015 | 21 Jun 2018 | 18 Jun 2021 |
| 8 | farewell.love | Google, Inc. | 14 Oct 2021 | 21 May 2024 | 14 Oct 2024 |
| 9 | farewell.news | Name.com, Inc. | 3 Oct 2020 | 16 Sep 2023 | 3 Oct 2024 |
| 10 | farewell.photo | Key-Systems, LLC | 12 Oct 2015 | 26 Jul 2017 | 12 Oct 2017 |
| 11 | farewell.club | - | 18 Feb 2021 | 10 Mar 2024 | 18 Feb 2025 |
| 12 | farewell.london | Mesh Digital Limited | 21 Feb 2016 | 21 Feb 2016 | 21 Feb 2017 |
| 13 | farewell.site | Name.com, Inc. | 18 Feb 2016 | 18 Feb 2016 | 18 Feb 2017 |
| 14 | farewell.pet | GoDaddy.com, LLC | 7 Mar 2016 | 15 Jul 2024 | 7 Mar 2027 |
| 15 | farewell.com | GoDaddy.com, LLC | 9 Jul 1998 | 28 Jun 2024 | 8 Jul 2025 |
| 16 | farewell.mom | CloudFlare, Inc. | 1 Jun 2023 | 25 Jul 2024 | 1 Jun 2026 |
| 17 | farewell.website | Network Solutions, LLC | 5 Dec 2023 | 10 Dec 2023 | 5 Dec 2024 |
| 18 | farewell.tech | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 4 Sep 2024 | 4 Sep 2024 | 4 Sep 2025 |
| 19 | farewell.space | - | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 20 | farewell.press | Domain.com, LLC | 13 Oct 2020 | 13 Oct 2020 | 13 Oct 2021 |
| 21 | farewell.online | West263 International Limited | 28 Sep 2017 | - | 28 Sep 2018 |
| 22 | farewell.host | - | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 23 | farewell.email | 1&1 Internet AG | 10 Jul 2022 | 10 Jul 2023 | 10 Jul 2024 |
| 24 | farewell.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 2 May 2015 | 6 Jun 2016 | 2 May 2025 |
| 25 | farewell.gift | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 26 | farewell.biz | OVH sas | 18 Nov 2010 | 28 Nov 2020 | 17 Nov 2020 |
| 27 | farewell.store | GoDaddy.com, LLC | 30 Oct 2021 | 13 Jun 2024 | 30 Oct 2024 |
| 28 | farewell.live | Porkbun, LLC | 1 Dec 2023 | 6 Dec 2023 | 1 Dec 2024 |
| 29 | farewell.net | Key-Systems GmbH | 12 Apr 2002 | 13 Apr 2024 | 12 Apr 2025 |
| 30 | farewell.org | eNom, Inc. | 20 Dec 2003 | 20 Dec 2023 | 20 Dec 2024 |
| 31 | farewell.xyz | TLD Registrar Solutions Ltd. | 22 Oct 2014 | 7 Dec 2023 | 22 Oct 2024 |
| 32 | farewell.world | GoDaddy.com, LLC | 10 Sep 2024 | 10 Sep 2024 | 10 Sep 2025 |
| 33 | farewell.dk | - | 29 Jan 2014 | - | 31 Jan 2018 |
| 34 | farewell.io | 1API GmbH | 21 Apr 2015 | 3 Aug 2024 | 21 Apr 2025 |
| 35 | farewell.mobi | GoDaddy.com, LLC | 10 Jul 2017 | 15 Jul 2020 | 10 Jul 2021 |
| 36 | farewell.pics | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Nov 2017 | 21 Nov 2017 | 21 Nov 2018 |
| 37 | farewell.video | Name.com, Inc. | 18 Dec 2017 | 18 Dec 2017 | 18 Dec 2018 |
| 38 | farewell.co.uk | - | 28 Oct 1998 | 29 Sep 2023 | 28 Oct 2024 |
| 39 | farewell.org.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 17 Sep 2014 | 10 Sep 2017 | 17 Sep 2018 |
| 40 | farewell.tips | Name.com, Inc. | 9 Mar 2018 | 5 May 2018 | 9 Mar 2019 |
| 41 | farewell.co | 1API GmbH | 26 Sep 2014 | 6 Sep 2024 | 25 Sep 2025 |
| 42 | farewell.solutions | RegistryGate GmbH | 2 Dec 2018 | 2 Dec 2018 | 2 Dec 2019 |
| 43 | farewell.business | Google, Inc. | 29 Dec 2018 | 29 Dec 2018 | 29 Dec 2019 |
| 44 | farewell.dev | OVH sas | 13 Jan 2021 | 1 Feb 2024 | 13 Jan 2025 |
| 45 | farewell.life | Porkbun, LLC | 27 Aug 2023 | 8 Sep 2024 | 27 Aug 2025 |
| 46 | farewell.pro | NameCheap, Inc. | 15 Mar 2023 | 21 Aug 2024 | 15 Mar 2025 |
| 47 | farewell.cloud | NameCheap, Inc. | 1 Dec 2019 | 1 Dec 2019 | 1 Dec 2020 |
| 48 | farewell.care | GoDaddy.com, LLC | 27 Mar 2020 | 18 Aug 2024 | 27 Mar 2025 |
| 49 | farewell.guru | Dynadot, LLC | 19 Apr 2020 | 19 Apr 2020 | 19 Apr 2021 |
| 50 | farewell.photos | NameCheap, Inc. | 19 Jul 2020 | 19 Jul 2020 | 19 Jul 2021 |
| 51 | farewell.digital | 10dencehispahard, S.L. | 20 Apr 2022 | 4 Jul 2023 | 20 Apr 2023 |
| 52 | farewell.media | GoDaddy.com, LLC | 7 Jan 2021 | 29 Aug 2024 | 7 Jan 2025 |
| 53 | farewell.icu | DNSPod, Inc. | 29 Mar 2021 | 31 Aug 2023 | 29 Mar 2028 |
| 54 | farewell.clothing | Tucows Domains Inc. | 29 May 2021 | 30 May 2024 | 29 May 2025 |
| 55 | farewell.ltd | GoDaddy.com, LLC | 31 Dec 2023 | 5 Jan 2024 | 31 Dec 2024 |
| 56 | farewell.legal | Regional Network Information Center, JSC dba RU-CE… | 22 Jun 2023 | 25 Aug 2024 | 22 Jun 2024 |
| 57 | farewell.beauty | Namesilo, LLC | 23 Nov 2022 | 23 Nov 2022 | 23 Nov 2023 |
| 58 | farewell.one | - | 3 Jul 2024 | 8 Jul 2024 | 3 Jul 2025 |
| 59 | farewell.memorial | NameCheap, Inc. | 15 Jan 2023 | 29 Feb 2024 | 15 Jan 2025 |
| 60 | farewell.app | GoDaddy.com, LLC | 16 May 2018 | 30 Jun 2024 | 16 May 2025 |
| 61 | farewell.be | OVH sas | 5 Sep 2016 | - | - |
| 62 | farewell.blog | Automattic Inc. | 24 May 2017 | 13 Jun 2024 | 24 May 2025 |
| 63 | farewell.rip | - | 22 Sep 2024 | 22 Sep 2024 | 22 Sep 2025 |
| 64 | farewell.community | CSC Corporate Domains, Inc. | 8 Mar 2023 | 1 Mar 2024 | 8 Mar 2025 |
| 65 | farewell.company | CSC Corporate Domains, Inc. | 8 Mar 2023 | 1 Mar 2024 | 8 Mar 2025 |
| 66 | farewell.llc | GoDaddy.com, LLC | 21 Jun 2021 | 21 Jun 2023 | 21 Jun 2024 |
| 67 | farewell.consulting | Amazon Registrar, Inc. | 7 Mar 2021 | 8 Mar 2023 | 7 Mar 2024 |
| 68 | farewell.cyou | Porkbun, LLC | 30 Sep 2021 | 15 Jun 2024 | 30 Sep 2025 |
| 69 | farewell.earth | Google, Inc. | 5 Sep 2020 | 26 Aug 2024 | 5 Sep 2025 |
| 70 | farewell.fun | DNSPod, Inc. | 14 Oct 2021 | 31 Aug 2023 | 14 Oct 2031 |
| 71 | farewell.link | Tucows Domains Inc. | 8 Jan 2021 | 12 Jan 2024 | 8 Jan 2025 |
| 72 | farewell.page | 1API GmbH | 21 May 2020 | 4 Jul 2024 | 21 May 2024 |
| 73 | farewell.uk | - | 2 Jul 2019 | 30 Jun 2024 | 2 Jul 2025 |
| 74 | farewell.vip | Xiamen ChinaSource Internet Service Co., Ltd. | 15 Aug 2022 | 15 Aug 2023 | 15 Aug 2023 |
| 75 | farewell.dad | CloudFlare, Inc. | 1 Jun 2023 | 24 Jun 2024 | 1 Jun 2025 |
| 76 | farewell.agency | GoDaddy.com, LLC | 16 Jul 2023 | 11 Sep 2024 | 16 Jul 2025 |
| 77 | farewell.cc | NameCheap, Inc. | 26 Jul 2021 | 30 Jun 2022 | 26 Jul 2023 |
| 78 | farewell.lol | Porkbun, LLC | 23 Sep 2023 | 17 Oct 2023 | 23 Sep 2024 |
| 79 | farewell.day | NameCheap, Inc. | 8 Oct 2023 | 13 Oct 2023 | 8 Oct 2024 |
| 80 | farewell.cards | Name.com, Inc. | 28 Nov 2023 | 25 Jun 2024 | 28 Nov 2024 |
| 81 | farewell.guide | NameCheap, Inc. | 22 Dec 2023 | 27 Dec 2023 | 22 Dec 2024 |
| 82 | farewell.help | NameCheap, Inc. | 22 Dec 2023 | 9 Jan 2024 | 22 Dec 2024 |
| 83 | farewell.ing | Porkbun, LLC | 31 Dec 2023 | 5 Jan 2024 | 31 Dec 2024 |
| 84 | farewell.chat | DNSPod, Inc. | 10 Mar 2024 | 15 Mar 2024 | 10 Mar 2025 |
| 85 | farewell.flowers | Network Solutions, LLC | 24 Mar 2024 | 29 Mar 2024 | 24 Mar 2025 |
| 86 | farewell.buzz | Namesilo, LLC | 26 Mar 2024 | 25 Apr 2024 | 26 Mar 2025 |
| 87 | farewell.vet | Google, Inc. | 27 Mar 2024 | 6 Jun 2024 | 27 Mar 2025 |
| 88 | farewell.studio | Tucows Domains Inc. | 9 Jul 2019 | 30 Jun 2024 | 9 Jul 2025 |
| 89 | farewell.ru | - | 28 Jun 2005 | - | 28 Jun 2025 |
| 90 | farewell.de | - | - | 9 Sep 2018 | - |
| 91 | farewell.eu | Realtime Register B.V. | - | - | - |
| 92 | farewell.bond | Dynadot, LLC | 27 May 2024 | 20 Jun 2024 | 27 May 2034 |
| 93 | farewell.africa | NameCheap, Inc. | 28 Jul 2024 | 9 Aug 2024 | 28 Jul 2025 |
| 94 | farewelltrailers.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 95 | farewellprotocol.com | Tucows Domains Inc. | 10 Sep 2015 | 16 Sep 2024 | 10 Sep 2025 |
| 96 | farewelltotexasstadium.com | GMO Internet Inc. | 15 Aug 2015 | 31 Aug 2016 | 14 Aug 2017 |
| 97 | farewellpaper.com | GoDaddy.com, LLC | 16 Jun 2007 | 17 Jun 2024 | 16 Jun 2026 |
| 98 | farewelllove.com | GoDaddy.com, LLC | 19 Jan 2010 | 17 Jan 2024 | 19 Jan 2025 |
| 99 | farewellgifts.com | GoDaddy.com, LLC | 4 Sep 2004 | 15 Aug 2024 | 4 Sep 2025 |
| 100 | farewellz.com | GoDaddy.com, LLC | 29 Feb 2008 | 27 Jan 2024 | 1 Mar 2025 |
| 101 | farewellveins-ny.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 102 | farewell-veins-ny.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 103 | farewelljimmy.com | GMO Internet Inc. | 2 Nov 2014 | 17 Feb 2017 | 1 Nov 2017 |
| 104 | farewells.biz | GoDaddy.com, LLC | 24 Nov 2018 | 24 Nov 2018 | 24 Nov 2019 |
| 105 | farewelltooakst.com | GoDaddy.com, LLC | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 106 | farewelldiamond.com | GoDaddy.com, LLC | 9 Feb 2014 | 10 Feb 2024 | 9 Feb 2025 |
| 107 | farewelltokings.com | GoDaddy.com, LLC | 17 Jun 2009 | 18 May 2024 | 17 Jun 2025 |
| 108 | farewelltributes.com | GoDaddy.com, LLC | 26 Oct 2011 | 28 Oct 2022 | 26 Oct 2024 |
| 109 | farewelltoreagan.com | GoDaddy.com, LLC | 15 Jun 2004 | 16 Jun 2015 | 15 Jun 2016 |
| 110 | farewellcheil.com | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 111 | farewelltraveling.com | Google, Inc. | 6 Dec 2020 | 7 Dec 2023 | 6 Dec 2024 |
| 112 | farewellkisses.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 113 | farewellmia.com | FastDomain Inc. | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 114 | farewellconcierge.com | Tucows Domains Inc. | 28 Feb 2015 | 4 Mar 2018 | 28 Feb 2018 |
| 115 | farewellbook.net | Tucows Domains Inc. | 11 Apr 2012 | 15 Apr 2015 | 11 Apr 2016 |
| 116 | farewelltodominic.com | Wild West Domains, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 117 | farewellharbor.com | TurnCommerce, Inc. DBA NameBright.com | 30 Oct 2015 | 24 Oct 2020 | 30 Oct 2024 |
| 118 | farewellthreads.com | DropCatch.com 650 LLC | 25 Jan 2017 | 26 Jan 2017 | 25 Jan 2018 |
| 119 | farewellassociates.com | Google, Inc. | 30 Sep 2022 | 1 Jun 2024 | 30 Sep 2024 |
| 120 | farewelltotheloft.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 121 | farewell-hook.net | GMO Internet Inc. | 27 Aug 2014 | 28 Aug 2014 | 27 Aug 2015 |
| 122 | farewellfatigue.com | GoDaddy.com, LLC | 28 Aug 2014 | 29 Aug 2024 | 28 Aug 2029 |
| 123 | farewelltattoo.com | NameCheap, Inc. | 8 Nov 2017 | 8 Nov 2017 | 8 Nov 2018 |
| 124 | farewellfalsies.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2016 |
| 125 | farewelleverything.com | NameCheap, Inc. | 15 Nov 2014 | 24 Sep 2023 | 15 Nov 2024 |
| 126 | farewellcartel.com | NetRegistry Pty Ltd. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 127 | farewellobesity.com | Nobel Networks | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 128 | farewellsugar.com | GoDaddy.com, LLC | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 129 | farewellangelinamusic.com | NameCheap, Inc. | 17 Sep 2014 | 13 Aug 2024 | 17 Sep 2025 |
| 130 | farewelloverweight.com | Nobel Networks | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 131 | farewellfuneralservice.com | GoDaddy.com, LLC | 7 Dec 2020 | 7 Dec 2020 | 7 Dec 2021 |
| 132 | farewellfuneralservicekansascity.com | Tucows Domains Inc. | 15 Sep 2013 | 19 Sep 2014 | 15 Sep 2015 |
| 133 | farewelltotheflesh.com | GoDaddy.com, LLC | 4 Oct 2022 | 16 Dec 2023 | 4 Oct 2023 |
| 134 | farewelltocarbs.com | eNom, Inc. | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 135 | farewellhell.com | GoDaddy.com, LLC | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 136 | farewellbend.com | TurnCommerce, Inc. DBA NameBright.com | 17 Jul 2014 | 19 Aug 2024 | 17 Jul 2024 |
| 137 | farewellcable.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 138 | farewellfleas.com | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 139 | farewelljune.com | Chengdu West Dimension Digital Technology Co., Ltd… | 19 Dec 2019 | 19 Dec 2019 | 19 Dec 2020 |
| 140 | farewellangelinaband.com | - | 6 Oct 2014 | 6 Oct 2014 | 6 Oct 2017 |
| 141 | farewellbyklee.com | Network Solutions, LLC | 24 Sep 2014 | 26 Jul 2024 | 24 Sep 2025 |
| 142 | farewellbyklee.net | Network Solutions, LLC | 24 Sep 2014 | 26 Jul 2024 | 24 Sep 2025 |
| 143 | farewellfilm.com | TurnCommerce, Inc. DBA NameBright.com | 2 Apr 2022 | 14 May 2024 | 2 Apr 2024 |
| 144 | farewellcomm.com | Tucows Domains Inc. | 6 Jan 2014 | 10 Jan 2016 | 6 Jan 2017 |
| 145 | farewell4u.org | SiteName Ltd. | 27 Dec 2017 | 27 Dec 2017 | 27 Dec 2018 |
| 146 | farewellspecialist.com | TPP Wholesale Pty Ltd. | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 147 | farewelltoasts.com | GoDaddy.com, LLC | 30 Nov 2014 | 1 Dec 2023 | 30 Nov 2024 |
| 148 | farewelltoast.com | GoDaddy.com, LLC | 30 Nov 2014 | 1 Dec 2023 | 30 Nov 2024 |
| 149 | farewellinsurance.com | GoDaddy.com, LLC | 30 Nov 2014 | 1 Dec 2023 | 30 Nov 2024 |
| 150 | farewellfund.com | GoDaddy.com, LLC | 30 Nov 2014 | 1 Dec 2023 | 30 Nov 2024 |
| 151 | farewellrelationships.com | Wild West Domains, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 152 | farewelltofreeway.com | NameCheap, Inc. | 25 May 2019 | 25 May 2019 | 25 May 2020 |
| 153 | farewellherrschwarz.com | register.com, Inc. | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2019 |
| 154 | farewellnick.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 155 | farewellmoty.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 156 | farewellbolt.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2016 |
| 157 | farewellfamiliartheband.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2016 |
| 158 | farewellspace.com | EPAG Domainservices GmbH | 15 Dec 2014 | 16 Dec 2016 | 15 Dec 2017 |
| 159 | farewellferentz.com | GoDaddy.com, LLC | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 160 | farewellfairladies.com | Tucows Domains Inc. | 20 Dec 2014 | 24 Dec 2016 | 20 Dec 2016 |
| 161 | farewellclutter.com | Webfusion Ltd. | 4 Jun 2023 | 16 Aug 2024 | 4 Jun 2024 |
| 162 | farewellinnocence.com | GoDaddy.com, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2019 |
| 163 | farewell925.com | NameCheap, Inc. | 29 Dec 2019 | - | 29 Dec 2020 |
| 164 | farewellproductions.com | NameCheap, Inc. | 20 Dec 2019 | 20 Nov 2023 | 20 Dec 2024 |
| 165 | farewellfireworks.com | 1&1 Internet AG | 3 Jan 2015 | 10 Mar 2018 | 3 Jan 2025 |
| 166 | farewell-architects.xyz | Network Solutions, LLC | 19 Jul 2014 | 21 Jul 2014 | 19 Jul 2015 |
| 167 | farewell55665.xyz | GMO Internet Inc. | 8 Aug 2014 | 10 Aug 2014 | 8 Aug 2015 |
| 168 | farewell-amnesty.red | GMO Internet Inc. | 30 Dec 2014 | - | 30 Dec 2015 |
| 169 | farewellfix.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Apr 2015 | 8 Apr 2015 | 7 Apr 2016 |
| 170 | farewellrock.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 171 | farewellfatmarsha.com | Wild West Domains, LLC | 14 Aug 2015 | 15 Jul 2024 | 14 Aug 2025 |
| 172 | farewellsouth.science | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Apr 2015 | 22 Apr 2015 | 21 Apr 2016 |
| 173 | farewelltowigs.com | eNom, Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 174 | farewelltotechnology.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 175 | farewelltonsils.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 176 | farewellanalog.net | - | 5 Aug 2023 | 6 Aug 2024 | 5 Aug 2025 |
| 177 | farewellfurniture.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2017 |
| 178 | farewelldesigns.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2017 |
| 179 | farewellpartymovie.com | GoDaddy.com, LLC | 14 Jan 2015 | 15 Jan 2017 | 14 Jan 2019 |
| 180 | farewellfeel.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 18 Jun 2015 | - | 18 Jun 2016 |
| 181 | farewellto.work | Minds + Machines Registrar Limited | 14 Jun 2015 | 14 Jun 2015 | 14 Jun 2016 |
| 182 | farewellmoment.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Jun 2015 | - | 26 Jun 2016 |
| 183 | farewelltaxes.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Jun 2015 | - | 25 Jun 2016 |
| 184 | farewellidea.club | eNom, Inc. | 5 Jul 2015 | 5 Jul 2015 | 4 Jul 2016 |
| 185 | farewellwithout.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Jul 2015 | - | 31 Jul 2016 |
| 186 | farewellphoto.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Aug 2015 | - | 4 Aug 2016 |
| 187 | farewellxo.com | CloudFlare, Inc. | 8 Apr 2023 | 5 Jun 2024 | 8 Apr 2025 |
| 188 | farewellfarwell.com | GoDaddy.com, LLC | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 189 | farewellsupersizedme.com | eNom, Inc. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 190 | farewellsicklecell.org | GoDaddy.com, LLC | 26 Jan 2015 | 27 Jan 2017 | 26 Jan 2018 |
| 191 | farewellfest.party | Alpnames Limited | 6 May 2015 | - | 5 May 2016 |
| 192 | farewellmydear.com | Xiamen ChinaSource Internet Service Co., Ltd. | 17 Sep 2022 | 18 Sep 2023 | 17 Sep 2024 |
| 193 | farewellvideos.com | Realtime Register B.V. | 24 Nov 2022 | 7 Jan 2024 | 24 Nov 2023 |
| 194 | farewellpix.com | Key-Systems GmbH | 5 Feb 2015 | 2 Feb 2017 | 5 Feb 2018 |
| 195 | farewelldearfriend.com | Cloud Yuqu LLC | 25 Mar 2021 | 25 Mar 2021 | 25 Mar 2022 |
| 196 | farewelltothepast.com | HiChina Zhicheng Technology Limited | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 197 | farewell2past.com | HiChina Zhicheng Technology Limited | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 198 | farewelltopaws.com | GoDaddy.com, LLC | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2017 |
| 199 | farewellfathellohealthy.com | eNom, Inc. | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 200 | farewelltowrinkles.com | eNom, Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 201 | farewellnyc.com | Tucows Domains Inc. | 15 Sep 2024 | 15 Sep 2024 | 15 Sep 2025 |
| 202 | farewellfeingold.com | GoDaddy.com, LLC | 21 Feb 2015 | 21 Feb 2015 | 21 Feb 2017 |
| 203 | farewellnote.net | Webfusion Ltd. | 23 Feb 2015 | 27 Jan 2017 | 23 Feb 2018 |
| 204 | farewellmandela.com | Cosmotown, Inc. | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 205 | farewellfootpain.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 206 | farewellado.com | GoDaddy.com, LLC | 27 Feb 2015 | 28 Feb 2023 | 27 Feb 2025 |
| 207 | farewellcablebill.info | GoDaddy.com, LLC | 23 Aug 2015 | - | 23 Aug 2016 |
| 208 | farewellsale.com | - | - | - | - |
| 209 | farewellroxanne.com | GoDaddy.com, LLC | 6 Mar 2015 | 7 Mar 2024 | 6 Mar 2025 |
| 210 | farewellpowers.com | DreamHost, LLC | 6 Mar 2015 | 6 Mar 2015 | 6 Mar 2016 |
| 211 | farewellgames.com | Google, Inc. | 7 Feb 2023 | 6 Jun 2024 | 7 Feb 2025 |
| 212 | farewellpage.com | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Jun 2019 | 2 Jun 2019 | 2 Jun 2020 |
| 213 | farewellbendappraisal.com | FastDomain Inc. | 11 Mar 2015 | 26 Feb 2024 | 11 Mar 2025 |
| 214 | farewell-ecriture.com | GMO Internet Inc. | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2017 |
| 215 | farewellfiancee.com | NetRegistry Pty Ltd. | 16 Mar 2015 | 10 Mar 2017 | 16 Mar 2018 |
| 216 | farewellfiance.com | Melbourne IT, Ltd | 16 Mar 2015 | 7 Mar 2024 | 16 Mar 2026 |
| 217 | farewelltohairloss.com | eNom, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 218 | farewelltohairfall.com | eNom, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 219 | farewellfornow.us | Domain.com, LLC | 17 Mar 2015 | 28 Feb 2017 | 16 Mar 2018 |
| 220 | farewelllovers.com | GoDaddy.com, LLC | 22 Mar 2015 | 22 Mar 2015 | 22 Mar 2016 |
| 221 | farewellhelenandshaik.com | FastDomain Inc. | 23 Mar 2015 | 23 Mar 2015 | 23 Mar 2016 |
| 222 | farewellfighter.com | TurnCommerce, Inc. DBA NameBright.com | 12 Jun 2017 | 6 Jun 2020 | 12 Jun 2024 |
| 223 | farewelldomain.com | Tucows Domains Inc. | 22 Mar 2012 | 26 Mar 2015 | 22 Mar 2016 |
| 224 | farewellbadluck.com | HiChina Zhicheng Technology Limited | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 225 | farewellzayn.com | Webfusion Ltd. | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 226 | farewellsibo.com | Wild West Domains, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 227 | farewellbanners.com | GoDaddy.com, LLC | 16 Jun 2019 | 16 Jun 2019 | 16 Jun 2020 |
| 228 | farewelltofools.com | GoDaddy.com, LLC | 2 Apr 2022 | 14 Apr 2023 | 2 Apr 2024 |
| 229 | farewellgentlefriend.com | Network Solutions, LLC | 29 Mar 2015 | 29 Jan 2024 | 29 Mar 2025 |
| 230 | farewellhairfall.com | eNom, Inc. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 231 | farewelllky.com | Network Solutions, LLC | 3 Apr 2015 | 4 Jun 2015 | 3 Apr 2018 |
| 232 | farewell-guide.com | Tucows Domains Inc. | 30 Mar 2011 | 3 Apr 2015 | 30 Mar 2016 |
| 233 | farewellobama.com | GoDaddy.com, LLC | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2018 |
| 234 | farewellflynn.com | HiChina Zhicheng Technology Limited | 10 Aug 2018 | 10 Aug 2018 | 10 Aug 2019 |
| 235 | farewelltexting.win | Chengdu West Dimension Digital Technology Co., Ltd… | 31 Aug 2015 | - | 30 Aug 2016 |
| 236 | farewellunclecharlie.com | Google, Inc. | 2 Sep 2015 | 2 Sep 2016 | 2 Sep 2017 |
| 237 | farewelltodarkcircles.com | - | - | - | - |
| 238 | farewellhairloss.com | eNom, Inc. | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 239 | farewell-anna-chu.net | HiChina Zhicheng Technology Limited | 12 Apr 2015 | 12 Apr 2015 | 12 Apr 2016 |
| 240 | farewellbook.info | Tucows Domains Inc. | 11 Apr 2012 | 15 Apr 2015 | 11 Apr 2016 |
| 241 | farewellhk.com | GoDaddy.com, LLC | 19 Apr 2015 | 19 Apr 2015 | 19 Apr 2016 |
| 242 | farewelltofrank.com | GoDaddy.com, LLC | 22 Apr 2015 | 22 Apr 2015 | 22 Apr 2016 |
| 243 | farewellninetofive.net | GoDaddy.com, LLC | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 244 | farewellninetofive.com | FastDomain Inc. | 15 Aug 2022 | 17 Aug 2024 | 15 Aug 2025 |
| 245 | farewellfarm.com | TurnCommerce, Inc. DBA NameBright.com | 14 Jul 2016 | 8 Jul 2020 | 14 Jul 2024 |
| 246 | farewell-quotes.com | Ad Valorem Domains, LLC | 3 Oct 2023 | 3 Oct 2023 | 3 Oct 2024 |
| 247 | farewelltokilos.com | eNom, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 248 | farewell-to-kilos.com | eNom, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 249 | farewell-kilos.com | eNom, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 250 | farewelltohearthandhome.com | Tucows Domains Inc. | 29 Apr 2015 | 3 May 2017 | 29 Apr 2017 |
| 251 | farewellstan.com | GoDaddy.com, LLC | 3 May 2015 | 4 May 2015 | 3 May 2016 |
| 252 | farewelltollbooths.com | GoDaddy.com, LLC | 9 Sep 2015 | 10 Sep 2024 | 9 Sep 2025 |
| 253 | farewellbra.com | GoDaddy.com, LLC | 10 Sep 2015 | 10 Sep 2015 | 10 Sep 2017 |
| 254 | farewellwhanau.com | - | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2017 |
| 255 | farewell-japan.com | GMO Internet Inc. | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 256 | farewelltosalonica.com | GoDaddy.com, LLC | 14 May 2015 | 18 Sep 2022 | 14 May 2025 |
| 257 | farewellsangelprogram.org | GoDaddy.com, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2016 |
| 258 | farewellsangelprogram.com | GoDaddy.com, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2016 |
| 259 | farewellfuneralplanning.com | eNom, Inc. | 20 May 2015 | 2 Jul 2017 | 20 May 2017 |
| 260 | farewellmyfriend.info | Gransy s.r.o. d/b/a subreg.cz | 21 May 2015 | - | 21 May 2016 |
| 261 | farewell-note.com | NamePal.com #8023 | 10 Nov 2020 | 10 Nov 2020 | 10 Nov 2021 |
| 262 | farewellrent.com | GoDaddy.com, LLC | 14 Oct 2023 | 14 Oct 2023 | 14 Oct 2024 |
| 263 | farewellredemption.com | Annulet LLC | 29 May 2015 | 14 Jul 2017 | 29 May 2018 |
| 264 | farewellsoldier.com | NameCheap, Inc. | 31 May 2015 | 29 May 2024 | 31 May 2025 |
| 265 | farewelltothesky.com | Webfusion Ltd. | 1 Jun 2015 | 1 Jun 2015 | 1 Jun 2016 |
| 266 | farewellfollowers.com | Google, Inc. | 1 Jun 2015 | 18 May 2024 | 1 Jun 2025 |
| 267 | farewellfelicia.com | GoDaddy.com, LLC | 1 Jun 2015 | 2 Jun 2024 | 1 Jun 2025 |
| 268 | farewellcoach.com | Tucows Domains Inc. | 30 May 2013 | 3 Jun 2015 | 30 May 2016 |
| 269 | farewellfollowers.org | Google, Inc. | 1 Jun 2015 | 23 May 2024 | 1 Jun 2025 |
| 270 | farewellfollowers.net | Google, Inc. | 1 Jun 2015 | 11 Jun 2024 | 1 Jun 2025 |
| 271 | farewellmyfriendhearseservices.com | Network Solutions, LLC | 3 Jun 2015 | 16 Aug 2024 | 3 Jun 2024 |
| 272 | farewellridemusic.com | Tucows Domains Inc. | 6 Jun 2015 | 26 May 2017 | 6 Jun 2018 |
| 273 | farewelltofermi.com | GoDaddy.com, LLC | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 274 | farewellsystem.com | 1&1 Internet AG | 9 Jun 2015 | 10 Jun 2016 | 9 Jun 2018 |
| 275 | farewellpackers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Sep 2024 | 6 Sep 2024 | 4 Sep 2025 |
| 276 | farewellmyfriend.org | GoDaddy.com, LLC | 25 Jul 2022 | 25 Jul 2023 | 25 Jul 2024 |
| 277 | farewellrepatriations.com | 1&1 Internet AG | 12 Jun 2015 | 13 Jun 2016 | 12 Jun 2018 |
| 278 | farewellinternationalrepatriation.com | 1&1 Internet AG | 12 Jun 2015 | 13 Jun 2016 | 12 Jun 2018 |
| 279 | farewellinternational.com | 1&1 Internet AG | 12 Jun 2015 | 13 Jun 2016 | 12 Jun 2018 |
| 280 | farewellalbatross.net | GoDaddy.com, LLC | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 281 | farewellhappyfields.com | eNom, Inc. | 18 Jun 2015 | 17 Jun 2015 | 18 Jun 2019 |
| 282 | farewellboleyn.com | GoDaddy.com, LLC | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 283 | farewelltotheworld.com | Wix.com Ltd. | 27 Dec 2021 | 29 May 2024 | 27 Dec 2024 |
| 284 | farewellrealty.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 285 | farewellhomes.com | Network Solutions, LLC | 17 Jan 2024 | 17 Jan 2024 | 17 Jan 2025 |
| 286 | farewelltoautumn.com | Hongkong Domain Name Information Management Co., L… | 4 Nov 2021 | 7 Nov 2022 | 4 Nov 2022 |
| 287 | farewellgarden.com | Tucows Domains Inc. | 18 Jun 2013 | 22 Jun 2015 | 18 Jun 2016 |
| 288 | farewellhillary.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 289 | farewellboxes.com | Paragon Internet Group Ltd t/a Paragon Names | 27 Nov 2017 | 27 Nov 2017 | 27 Nov 2018 |
| 290 | farewellhzpweixin.com | Shanghai Best Oray Information S&T Co., Ltd | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 291 | farewellbrewing.com | register.com, Inc. | 1 Jul 2015 | 1 Jul 2017 | 1 Jul 2019 |
| 292 | farewellbox.com | GoDaddy.com, LLC | 19 Mar 2024 | 19 Mar 2024 | 19 Mar 2025 |
| 293 | farewellidea.com | eNom, Inc. | 6 Jul 2015 | 6 Jul 2015 | 6 Jul 2016 |
| 294 | farewellsherri.win | Chengdu West Dimension Digital Technology Co., Ltd… | 26 Sep 2015 | - | 25 Sep 2016 |
| 295 | farewellfacade.com | GoDaddy.com, LLC | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2017 |
| 296 | farewell43.com | Key-Systems GmbH | 9 Jul 2021 | 9 Jul 2021 | 9 Jul 2022 |
| 297 | farewell-messages.com | Tucows Domains Inc. | 13 Jul 2011 | 17 Jul 2015 | 13 Jul 2016 |
| 298 | farewell-film.com | - | 21 Jul 2015 | 21 Jul 2015 | 21 Jul 2017 |
| 299 | farewellsuburbia.com | GoDaddy.com, LLC | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 300 | farewellmankind.com | GoDaddy.com, LLC | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 301 | farewell-cs.com | Namesilo, LLC | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 302 | farewellfb.org | eNom, Inc. | 23 Jul 2015 | 30 Jun 2017 | 23 Jul 2018 |
| 303 | farewellfiancemedia.com | NetRegistry Pty Ltd. | 1 Oct 2015 | 31 Aug 2016 | 1 Oct 2017 |
| 304 | farewelljob.com | Name.com, Inc. | 29 Sep 2023 | 20 Oct 2023 | 29 Sep 2024 |
| 305 | farewellbroadcast.com | Tucows Domains Inc. | 2 Aug 2015 | 18 Jul 2024 | 2 Aug 2025 |
| 306 | farewellfunerals.com | TurnCommerce, Inc. DBA NameBright.com | 20 Oct 2016 | 14 Oct 2020 | 20 Oct 2025 |
| 307 | farewellalbatross.com | GMO Internet Inc. | 16 Jun 2014 | 9 May 2017 | 16 Jun 2018 |
| 308 | farewellinterview.com | DropCatch.com 994 LLC | 23 Oct 2018 | 23 Oct 2018 | 23 Oct 2019 |
| 309 | farewell360.com | Key-Systems GmbH | 7 Aug 2015 | 6 Aug 2016 | 7 Aug 2017 |
| 310 | farewell-image.com | Key-Systems GmbH | 7 Aug 2015 | 6 Aug 2016 | 7 Aug 2017 |
| 311 | farewelltoarmsofficial.com | Nordreg AB | 15 Mar 2018 | 15 Feb 2024 | 15 Mar 2025 |
| 312 | farewellart.com | GMO Internet Inc. | 5 Oct 2015 | 27 Jan 2017 | 4 Oct 2017 |
| 313 | farewellrenga.xyz | GMO Internet Inc. | 5 Oct 2015 | - | 5 Oct 2016 |
| 314 | farewellpossession.review | Chengdu West Dimension Digital Technology Co., Ltd… | 5 Oct 2015 | - | 4 Oct 2016 |
| 315 | farewellfrumpy.review | Alpnames Limited | 6 Oct 2015 | 6 Oct 2015 | 5 Oct 2016 |
| 316 | farewellreducing.faith | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Oct 2015 | - | 11 Oct 2016 |
| 317 | farewellwithgrace.com | NetRegistry Pty Ltd. | 14 Oct 2015 | 9 Feb 2017 | 14 Oct 2017 |
| 318 | farewelltoalms.org | Domain.com, LLC | 14 Oct 2015 | 29 Sep 2016 | 14 Oct 2017 |
| 319 | farewelltoalms.com | Domain.com, LLC | 14 Oct 2015 | 29 Sep 2016 | 14 Oct 2017 |
| 320 | farewell2anxiety.com | GoDaddy.com, LLC | 11 Jul 2022 | 11 Jul 2024 | 11 Jul 2025 |
| 321 | farewellmarija.com | GoDaddy.com, LLC | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 322 | farewellheadaches.com | GoDaddy.com, LLC | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2017 |
| 323 | farewellandnest.com | Network Solutions, LLC | 6 Apr 2017 | 6 Apr 2017 | 6 Apr 2018 |
| 324 | farewellphil.com | Google, Inc. | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2016 |
| 325 | farewellparties.com | FastDomain Inc. | 24 Oct 2015 | 3 Dec 2020 | 24 Oct 2021 |
| 326 | farewellcelebration.com | FastDomain Inc. | 24 Oct 2015 | 24 Oct 2016 | 24 Oct 2017 |
| 327 | farewellboswell.com | GoDaddy.com, LLC | 25 Oct 2015 | 25 Oct 2015 | 25 Oct 2017 |
| 328 | farewell9to5.com | Dynadot, LLC | 30 Oct 2015 | 30 Oct 2023 | 30 Oct 2024 |
| 329 | farewellblackheads.com | GoDaddy.com, LLC | 30 Oct 2020 | 30 Oct 2020 | 30 Oct 2021 |
| 330 | farewellhello.com | GMO Internet Inc. | 2 Nov 2015 | 30 Nov 2016 | 1 Nov 2017 |
| 331 | farewellhampers.com | Crazy Domains FZ-LLC | 1 Nov 2015 | 12 Nov 2021 | 1 Nov 2021 |
| 332 | farewell-with-dignity.com | World4You Internet Services GmbH | 4 Nov 2015 | 27 Jan 2019 | 4 Nov 2019 |
| 333 | farewelljetlag.com | Dynadot11 LLC | 24 Jan 2021 | 25 Jan 2021 | 24 Jan 2022 |
| 334 | farewelljustinstangry.com | Tucows Domains Inc. | 6 Nov 2015 | 10 Nov 2018 | 6 Nov 2018 |
| 335 | farewellstanleys.com | eNom, Inc. | 10 Nov 2015 | 5 Nov 2023 | 10 Nov 2024 |
| 336 | farewellcome.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 9 Nov 2015 | 25 Oct 2022 | 9 Nov 2024 |
| 337 | farewellmoments.com | Metaregistrar BV Applications | 11 Nov 2015 | 13 Nov 2023 | 11 Nov 2024 |
| 338 | farewellbackpain.com | NameCheap, Inc. | 13 Nov 2015 | 14 Oct 2023 | 13 Nov 2024 |
| 339 | farewelldiabetes.com | Google, Inc. | 21 Jun 2017 | 21 Jun 2017 | 21 Jun 2018 |
| 340 | farewelltograins.com | GoDaddy.com, LLC | 20 Nov 2015 | 20 Nov 2015 | 20 Nov 2017 |
| 341 | farewell-art.com | OVH sas | 19 Nov 2015 | 31 Oct 2016 | 19 Nov 2017 |
| 342 | farewelltwenties.com | eNom, Inc. | 20 Nov 2015 | 15 Nov 2016 | 20 Nov 2017 |
| 343 | farewell20s.com | eNom, Inc. | 20 Nov 2015 | 15 Nov 2016 | 20 Nov 2017 |
| 344 | farewellfelicia.biz | GoDaddy.com, LLC | 24 Nov 2015 | 24 Nov 2015 | 23 Nov 2016 |
| 345 | farewellpick.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 25 Nov 2015 | 24 Feb 2016 | 25 Nov 2017 |
| 346 | farewellmedia.com | GoDaddy.com, LLC | 25 Nov 2015 | 2 Oct 2023 | 25 Nov 2025 |
| 347 | farewellshares.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Nov 2015 | 24 Feb 2016 | 27 Nov 2017 |
| 348 | farewellscorching.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Nov 2015 | 24 Feb 2016 | 27 Nov 2017 |
| 349 | farewellpharmaceutical.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Nov 2015 | 24 Feb 2016 | 28 Nov 2017 |
| 350 | farewellhearing.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Nov 2015 | 24 Feb 2016 | 27 Nov 2017 |
| 351 | farewellgot.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 29 Nov 2015 | 24 Feb 2016 | 29 Nov 2017 |
| 352 | farewell-shadows.com | GoDaddy.com, LLC | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 353 | farewellrdio.com | GoDaddy.com, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2017 |
| 354 | farewellholidays.com | 1&1 Internet AG | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 355 | farewellblack.com | GoDaddy.com, LLC | 11 Dec 2015 | 11 Dec 2015 | 11 Dec 2017 |
| 356 | farewellme.com | GoDaddy.com, LLC | 16 Apr 2023 | 28 May 2024 | 16 Apr 2024 |
| 357 | farewellkobe.com | Hongkong Domain Name Information Management Co., L… | 4 Jul 2021 | 4 Jul 2021 | 4 Jul 2022 |
| 358 | farewelltoprohibition.com | GoDaddy.com, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 359 | farewellplanetearth.com | Key-Systems GmbH | 21 Dec 2015 | 25 Jan 2017 | 21 Dec 2017 |
| 360 | farewellceremonies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2019 | 10 Nov 2023 | 9 Dec 2024 |
| 361 | farewell-party.com | OVH sas | 25 Dec 2015 | 25 Dec 2015 | 25 Dec 2016 |
| 362 | farewelllemmy.com | GoDaddy.com, LLC | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 363 | farewellvacations.com | DropCatch.com 684 LLC | 16 Jun 2018 | 16 Jun 2018 | 16 Jun 2019 |
| 364 | farewellforever.com | Azdomainz LLC | 31 Dec 2015 | 15 Feb 2024 | 31 Dec 2024 |
| 365 | farewellstress.org | 1&1 Internet AG | 2 Jan 2016 | 3 Jan 2017 | 2 Jan 2018 |
| 366 | farewell2015.com | GoDaddy.com, LLC | 2 Jan 2016 | 2 Jan 2016 | 2 Jan 2017 |
| 367 | farewelltothecubicle.com | GoDaddy.com, LLC | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 368 | farewellhxc.com | GMO Internet Inc. | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 369 | farewellblog.com | GoDaddy.com, LLC | 4 Jan 2016 | 5 Jan 2024 | 4 Jan 2025 |
| 370 | farewellphotoworkshops.com | 1API GmbH | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 371 | farewellfinancial.com | GoDaddy.com, LLC | 7 Jan 2016 | 7 Jan 2023 | 7 Jan 2025 |
| 372 | farewelltotinkerbell.com | GMO Internet Inc. | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 373 | farewellshop.us | GoDaddy.com, LLC | 6 Jan 2016 | 6 Jan 2016 | 5 Jan 2017 |
| 374 | farewellobstical.com | GoDaddy.com, LLC | 15 Jan 2016 | 15 Jan 2016 | 15 Jan 2017 |
| 375 | farewellpartyband.com | Domain.com, LLC | 9 Apr 2018 | 9 Apr 2018 | 9 Apr 2019 |
| 376 | farewell-speech.com | enom469, Incorporated | 7 Apr 2017 | 8 Apr 2017 | 7 Apr 2018 |
| 377 | farewell2wrinkles.com | Wild West Domains, LLC | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2018 |
| 378 | farewelltoarms.trade | Megazone Corp., dba HOSTING.KR | 21 Jan 2016 | 21 Jan 2016 | 20 Jan 2017 |
| 379 | farewell-male.xyz | GMO Internet Inc. | 22 Jan 2016 | 18 Feb 2016 | 22 Jan 2017 |
| 380 | farewell-haunt.xyz | GMO Internet Inc. | 22 Jan 2016 | 18 Feb 2016 | 22 Jan 2017 |
| 381 | farewell-bankrupt.xyz | GMO Internet Inc. | 22 Jan 2016 | 18 Feb 2016 | 22 Jan 2017 |
| 382 | farewell-abate.xyz | GMO Internet Inc. | 22 Jan 2016 | 18 Feb 2016 | 22 Jan 2017 |
| 383 | farewellmyfriends.com | Domain.com, LLC | 24 Jan 2016 | 24 Jan 2016 | 24 Jan 2018 |
| 384 | farewellmrbowman.com | Cronon AG | 24 Jan 2016 | 24 Jan 2016 | 24 Jan 2018 |
| 385 | farewelldreams.com | GoDaddy.com, LLC | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2017 |
| 386 | farewellanalog.com | DropCatch.com 874 LLC | 25 Jan 2016 | 26 Jan 2017 | 25 Jan 2018 |
| 387 | farewellschapman.com | eNom, Inc. | 26 Jan 2016 | 26 Jan 2016 | 26 Jan 2017 |
| 388 | farewellvacation.top | Alpnames Limited | 28 Jan 2016 | 29 Jan 2016 | 28 Jan 2017 |
| 389 | farewell-vacation.top | Alpnames Limited | 28 Jan 2016 | 29 Jan 2016 | 28 Jan 2017 |
| 390 | farewellandflourish.info | GoDaddy.com, LLC | 29 Jan 2016 | - | 29 Jan 2017 |
| 391 | farewellangels.com | FastDomain Inc. | 30 Jan 2016 | 30 Jan 2016 | 30 Jan 2017 |
| 392 | farewellandflourish.org | GoDaddy.com, LLC | 29 Jan 2016 | 29 Jan 2016 | 29 Jan 2017 |
| 393 | farewellandflourish.net | GoDaddy.com, LLC | 29 Jan 2016 | 29 Jan 2016 | 29 Jan 2017 |
| 394 | farewellflag.com | GoDaddy.com, LLC | 30 Jan 2016 | 4 Feb 2023 | 30 Jan 2023 |
| 395 | farewell-game.com | Key-Systems GmbH | 1 Feb 2016 | 21 Jan 2017 | 1 Feb 2018 |
| 396 | farewellsalenevertheless.org | GMO Internet Inc. | 1 Feb 2016 | - | 1 Feb 2017 |
| 397 | farewellfunding.com | DropCatch.com 1542 LLC | 24 Apr 2017 | 24 Apr 2017 | 24 Apr 2018 |
| 398 | farewellcars.com | GoDaddy.com, LLC | 4 Feb 2016 | 4 Feb 2016 | 4 Feb 2017 |
| 399 | farewellfire.com | Name.com, Inc. | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2017 |
| 400 | farewelltofreedom.com | DropCatch.com 1488 LLC | 3 May 2023 | 4 May 2023 | 3 May 2024 |
| 401 | farewellsallykern.com | Google, Inc. | 14 Feb 2016 | 14 Feb 2016 | 14 Feb 2017 |
| 402 | farewellsfunerals.com | Webfusion Ltd. | 27 Jun 2023 | 27 Jun 2023 | 27 Jun 2025 |
| 403 | farewellmourning.com | GoDaddy.com, LLC | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2018 |
| 404 | farewellfling.com | GoDaddy.com, LLC | 15 Feb 2016 | 15 Feb 2016 | 15 Feb 2017 |
| 405 | farewelldryeye.com | GoDaddy.com, LLC | 18 Feb 2016 | 19 Feb 2024 | 18 Feb 2026 |
| 406 | farewellmichelle.com | TurnCommerce, Inc. DBA NameBright.com | 8 May 2020 | 2 May 2021 | 8 May 2024 |
| 407 | farewellobama.net | GoDaddy.com, LLC | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2017 |
| 408 | farewellmichelle.net | GoDaddy.com, LLC | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2017 |
| 409 | farewellobama.org | GoDaddy.com, LLC | 19 Feb 2016 | 20 Feb 2017 | 19 Feb 2018 |
| 410 | farewellobama.info | GoDaddy.com, LLC | 19 Feb 2016 | 20 Feb 2017 | 19 Feb 2018 |
| 411 | farewellmichelle.org | GoDaddy.com, LLC | 19 Feb 2016 | 20 Feb 2017 | 19 Feb 2018 |
| 412 | farewellmichelle.info | GoDaddy.com, LLC | 19 Feb 2016 | 20 Feb 2017 | 19 Feb 2018 |
| 413 | farewell-temple.xyz | GMO Internet Inc. | 22 Feb 2016 | 27 Feb 2016 | 22 Feb 2017 |
| 414 | farewell-tell.xyz | GMO Internet Inc. | 22 Feb 2016 | 27 Feb 2016 | 22 Feb 2017 |
| 415 | farewell-sacrifice.xyz | GMO Internet Inc. | 22 Feb 2016 | 27 Feb 2016 | 22 Feb 2017 |
| 416 | farewell-occupy.xyz | GMO Internet Inc. | 22 Feb 2016 | 27 Feb 2016 | 22 Feb 2017 |
| 417 | farewell-illness.xyz | GMO Internet Inc. | 22 Feb 2016 | 27 Feb 2016 | 22 Feb 2017 |
| 418 | farewell-ex.com | Japan Registry Services Co., Ltd. | 22 Feb 2016 | 21 Dec 2016 | 22 Feb 2018 |
| 419 | farewelltothefamiliar.com | FastDomain Inc. | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 420 | farewell-lars.com | Tucows Domains Inc. | 23 Feb 2016 | 8 Feb 2017 | 23 Feb 2018 |
| 421 | farewell-quail.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 422 | farewell-pacifist.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 423 | farewell-maintenance.xyz | GMO Internet Inc. | 23 Feb 2016 | 28 Feb 2016 | 23 Feb 2017 |
| 424 | farewell-jolly.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 425 | farewell-identification.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 426 | farewell-habitant.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 427 | farewell-geologist.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 428 | farewell-fame.xyz | GMO Internet Inc. | 23 Feb 2016 | 1 Mar 2016 | 23 Feb 2017 |
| 429 | farewellwishessecured.com | NetRegistry Pty Ltd. | 26 Feb 2016 | 26 Feb 2016 | 26 Feb 2017 |
| 430 | farewellpresidentobama.com | GoDaddy.com, LLC | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 431 | farewelluptonpark.com | Gandi SAS | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 432 | farewellvoyage.com | Tucows Domains Inc. | 3 Mar 2011 | 7 Mar 2016 | 3 Mar 2017 |
| 433 | farewellcellulites.website | GoDaddy.com, LLC | 6 Mar 2016 | 6 Sep 2017 | 6 Mar 2018 |
| 434 | farewell-abuse.xyz | GMO Internet Inc. | 12 Mar 2016 | 17 Mar 2016 | 12 Mar 2017 |
| 435 | farewellings.com | Tucows Domains Inc. | 13 Mar 2016 | 17 Mar 2018 | 13 Mar 2018 |
| 436 | farewell-scare.xyz | GMO Internet Inc. | 14 Mar 2016 | 19 Mar 2016 | 14 Mar 2017 |
| 437 | farewellohio.com | GoDaddy.com, LLC | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 438 | farewellfilms.org | GoDaddy.com, LLC | 17 Mar 2016 | 18 Mar 2017 | 17 Mar 2018 |
| 439 | farewellfat.org | GoDaddy.com, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 440 | farewellcar.com | eNom, Inc. | 17 Mar 2016 | 3 Mar 2017 | 17 Mar 2018 |
| 441 | farewell-tender.xyz | GMO Internet Inc. | 18 Mar 2016 | 23 Mar 2016 | 18 Mar 2017 |
| 442 | farewell-satisfaction.xyz | GMO Internet Inc. | 18 Mar 2016 | 23 Mar 2016 | 18 Mar 2017 |
| 443 | farewell-justification.xyz | GMO Internet Inc. | 18 Mar 2016 | 23 Mar 2016 | 18 Mar 2017 |
| 444 | farewell-baggage.xyz | GMO Internet Inc. | 18 Mar 2016 | 23 Mar 2016 | 18 Mar 2017 |
| 445 | farewell-genial.xyz | GMO Internet Inc. | 19 Mar 2016 | 24 Mar 2016 | 19 Mar 2017 |
| 446 | farewells.com | Megazone Corp., dba HOSTING.KR | 18 Jul 2001 | 8 Jul 2024 | 18 Jul 2025 |
| 447 | farewelled.com | Dynadot, LLC | 5 Feb 2020 | 28 May 2024 | 5 Feb 2025 |
| 448 | farewell-satellite.xyz | GMO Internet Inc. | 22 Mar 2016 | 27 Mar 2016 | 22 Mar 2017 |
| 449 | farewell-careful.xyz | GMO Internet Inc. | 22 Mar 2016 | 27 Mar 2016 | 22 Mar 2017 |
| 450 | farewell-barn.xyz | GMO Internet Inc. | 22 Mar 2016 | 27 Mar 2016 | 22 Mar 2017 |
| 451 | farewell-abdicate.xyz | GMO Internet Inc. | 22 Mar 2016 | 27 Mar 2016 | 22 Mar 2017 |
| 452 | farewellalkion.com | Xin Net Technology Corporation | 22 Mar 2016 | 22 Mar 2019 | 22 Mar 2021 |
| 453 | farewell-scary.xyz | GMO Internet Inc. | 23 Mar 2016 | 28 Mar 2016 | 23 Mar 2017 |
| 454 | farewell-scarce.xyz | GMO Internet Inc. | 23 Mar 2016 | 28 Mar 2016 | 23 Mar 2017 |
| 455 | farewell-reach.xyz | GMO Internet Inc. | 23 Mar 2016 | 28 Mar 2016 | 23 Mar 2017 |
| 456 | farewell-pass.xyz | GMO Internet Inc. | 23 Mar 2016 | 28 Mar 2016 | 23 Mar 2017 |
| 457 | farewelltoanangel.com | GoDaddy.com, LLC | 24 Mar 2016 | 25 Mar 2024 | 24 Mar 2026 |
| 458 | farewelljezebel.com | eNom, Inc. | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 459 | farewell-objectivity.xyz | GMO Internet Inc. | 25 Mar 2016 | 30 Mar 2016 | 25 Mar 2017 |
| 460 | farewell-either.xyz | GMO Internet Inc. | 25 Mar 2016 | 30 Mar 2016 | 25 Mar 2017 |
| 461 | farewelldesignfactory.com | GoDaddy.com, LLC | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2017 |
| 462 | farewellstudentloans.com | Media Elite Holdings Limited | 2 Nov 2020 | 2 Nov 2020 | 2 Nov 2021 |
| 463 | farewellkiss.com | - | - | - | - |
| 464 | farewell-tall.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 465 | farewell-railroad.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 466 | farewell-quest.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 467 | farewell-pale.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 468 | farewell-negotiate.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 469 | farewell-decision.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 470 | farewell-accrue.xyz | GMO Internet Inc. | 30 Mar 2016 | 4 Apr 2016 | 30 Mar 2017 |
| 471 | farewell-sad.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 472 | farewell-quicken.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 473 | farewell-qualify.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 474 | farewell-negotiation.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 475 | farewell-narrow.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 476 | farewell-fast.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 477 | farewell-fantasy.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 478 | farewell-capitalism.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 479 | farewell-cactus.xyz | GMO Internet Inc. | 1 Apr 2016 | 6 Apr 2016 | 1 Apr 2017 |
| 480 | farewellstranger.com | TurnCommerce, Inc. DBA NameBright.com | 3 May 2018 | 20 Aug 2021 | 3 May 2024 |
| 481 | farewell-paramount.xyz | GMO Internet Inc. | 4 Apr 2016 | 9 Apr 2016 | 4 Apr 2017 |
| 482 | farewellfantasy.net | GMO Internet Inc. | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 483 | farewelltothefuture.com | 1&1 Internet AG | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2017 |
| 484 | farewellstretchmarks.com | GoDaddy.com, LLC | 5 Apr 2016 | 5 Apr 2016 | 5 Apr 2018 |
| 485 | farewellcellulite.space | GoDaddy.com, LLC | 11 Feb 2016 | 6 Sep 2017 | 11 Feb 2018 |
| 486 | farewelltobingeeating.com | RegistryGate GmbH | 9 Apr 2016 | 10 Apr 2024 | 9 Apr 2025 |
| 487 | farewellbingeeating.com | RegistryGate GmbH | 9 Apr 2016 | 10 Apr 2024 | 9 Apr 2025 |
| 488 | farewelltoaddiction.com | TurnCommerce, Inc. DBA NameBright.com | 13 Apr 2016 | 8 Apr 2024 | 13 Apr 2025 |
| 489 | farewellobamagala.com | GoDaddy.com, LLC | 13 Apr 2016 | 13 Apr 2016 | 13 Apr 2017 |
| 490 | farewellobamatx.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 491 | farewellobamany.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 492 | farewellobamanj.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 493 | farewellobamanc.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 494 | farewellobamami.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 495 | farewellobamaga.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 496 | farewellobamafl.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 497 | farewellobamadc.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 498 | farewellobamaca.com | GoDaddy.com, LLC | 18 Apr 2016 | 18 Apr 2016 | 18 Apr 2017 |
| 499 | farewellcellulite.net | eNom, Inc. | 20 Apr 2016 | 20 Apr 2016 | 20 Apr 2017 |
| 500 | farewellprince.com | GoDaddy.com, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 501 | farewellcubicle.com | FastDomain Inc. | 22 Apr 2016 | 7 Apr 2024 | 22 Apr 2025 |
| 502 | farewelling.com | Crazy Domains FZ-LLC | 24 Apr 2016 | 17 Jul 2024 | 24 Apr 2029 |
| 503 | farewellflowers.ru | - | - | - | - |
| 504 | farewellmyindiansoldier.com | Wild West Domains, LLC | 3 May 2016 | 3 Apr 2024 | 3 May 2025 |
| 505 | farewelldata.com | Wild West Domains, LLC | 3 May 2016 | 3 May 2016 | 3 May 2017 |
| 506 | farewellrisk.com | - | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 507 | farewellshillary.com | GoDaddy.com, LLC | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 508 | farewellmylove.org | GoDaddy.com, LLC | 6 May 2016 | 6 May 2016 | 6 May 2017 |
| 509 | farewelltogoodbye.net | 1&1 Internet AG | 13 May 2016 | 23 Nov 2017 | 13 May 2025 |
| 510 | farewelltogoodbye.com | 1&1 Internet AG | 13 May 2016 | 10 Mar 2018 | 13 May 2025 |
| 511 | farewellmosquitos.com | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 512 | farewellrunaways.com | - | 17 May 2016 | 17 May 2016 | 17 May 2017 |
| 513 | farewelltosolace.com | GoDaddy.com, LLC | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 514 | farewellstation.com | Aegean Domains LLC | 27 Jul 2019 | 28 Jul 2019 | 27 Jul 2020 |
| 515 | farewellemail.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Oct 2023 | 16 Nov 2023 | 29 Oct 2024 |
| 516 | farewellgift.com | Dynadot, LLC | 14 Aug 2024 | 14 Aug 2024 | 14 Aug 2025 |
| 517 | farewelledproliferously.online | - | 26 May 2016 | 26 May 2016 | 26 May 2017 |
| 518 | farewelltribute.com | TurnCommerce, Inc. DBA NameBright.com | 23 Aug 2021 | 17 Aug 2022 | 23 Aug 2024 |
| 519 | farewelljun.xyz | GMO Internet Inc. | 1 Jun 2016 | 6 Jun 2016 | 1 Jun 2017 |
| 520 | farewellstarlite.org | Tucows Domains Inc. | 11 Jun 2016 | 15 Jun 2024 | 11 Jun 2025 |
| 521 | farewellstarlite.net | Tucows Domains Inc. | 11 Jun 2016 | 10 Jun 2024 | 11 Jun 2025 |
| 522 | farewellstarlite.com | Tucows Domains Inc. | 11 Jun 2016 | 10 Jun 2024 | 11 Jun 2025 |
| 523 | farewell-immerse.top | - | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 524 | farewell-gall.top | - | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 525 | farewell-dailect.top | - | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 526 | farewellflights.com | GoDaddy.com, LLC | 18 Jun 2016 | 18 Jun 2016 | 18 Jun 2017 |
| 527 | farewellfairground.com | Network Solutions, LLC | 20 Jun 2016 | 29 May 2024 | 20 Jun 2025 |
| 528 | farewelltostandrew.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 529 | farewelltoearthportrait.org | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 530 | farewelltoearthpainting.org | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 531 | farewelltoearthmovie.org | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 532 | farewelltoearth.org | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 533 | farewelltoearthportrait.net | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 534 | farewelltoearthpainting.net | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 535 | farewelltoearthmovie.net | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 536 | farewelltoearth.net | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 537 | farewelltoearthportrait.info | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 538 | farewelltoearthpainting.info | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 539 | farewelltoearthmovie.info | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 540 | farewelltoearth.info | GoDaddy.com, LLC | 23 Jun 2016 | 23 Aug 2016 | 23 Jun 2018 |
| 541 | farewelltoearthportrait.com | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 542 | farewelltoearthpainting.com | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 543 | farewelltoearthmovie.com | GoDaddy.com, LLC | 23 Jun 2016 | 23 Jun 2016 | 23 Jun 2018 |
| 544 | farewelltoearth.com | TurnCommerce, Inc. DBA NameBright.com | 10 Sep 2018 | 4 Sep 2020 | 10 Sep 2025 |
| 545 | farewellflirt.xyz | NameCheap, Inc. | 23 Jun 2016 | 29 Jun 2016 | 23 Jun 2017 |
| 546 | farewellfurbaby.com | DROPCATCH.COM 786 LLC | 25 Jun 2016 | 26 Jun 2017 | 25 Jun 2018 |
| 547 | farewellspacecadet.com | GoDaddy.com, LLC | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 548 | farewell-christine.com | DropCatch.com 728 LLC | 20 Mar 2018 | 20 Mar 2018 | 20 Mar 2019 |
| 549 | farewellwedding.bid | Chengdu West Dimension Digital Technology Co., Ltd… | 30 Jun 2016 | 30 Jun 2016 | 29 Jun 2017 |
| 550 | farewell-neat.top | - | 1 Jul 2016 | 1 Jul 2016 | 1 Jul 2017 |
| 551 | farewellveins.com | Moniker Online Services LLC | 23 Aug 2011 | 21 Aug 2024 | 23 Aug 2025 |
| 552 | farewellaccused.xyz | GMO Internet Inc. | 7 Jun 2016 | 29 Jul 2016 | 7 Jun 2017 |
| 553 | farewelled.xyz | Uniregistrar Corp | 2 Jun 2016 | 30 Nov 2016 | 2 Jun 2017 |
| 554 | farewellneon.xyz | GMO Internet Inc. | 6 Jun 2016 | 29 Jul 2016 | 6 Jun 2017 |
| 555 | farewellsfolksiestcourse111.xyz | NameCheap, Inc. | 20 Jun 2016 | 27 Jun 2016 | 20 Jun 2017 |
| 556 | farewellgeneva.win | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Jul 2016 | 9 Jul 2016 | 8 Jul 2017 |
| 557 | farewelljournalist.site | Chengdu West Dimension Digital Technology Co., Ltd… | 8 Jul 2016 | 8 Jul 2016 | 8 Jul 2017 |
| 558 | farewelldonald.com | GoDaddy.com, LLC | 9 Jul 2016 | 10 Jul 2024 | 9 Jul 2025 |
| 559 | farewellcollection.com | Tucows Domains Inc. | 10 Feb 2021 | 12 Sep 2023 | 10 Feb 2025 |
| 560 | farewellstarlight.com | GoDaddy.com, LLC | 11 Jul 2016 | 11 Jul 2016 | 11 Jul 2017 |
| 561 | farewelltoronan.com | eNom, Inc. | 14 Jul 2016 | 25 Aug 2017 | 14 Jul 2017 |
| 562 | farewellfuneralservices.com | - | 15 Jul 2016 | 15 Jul 2016 | 15 Jul 2017 |
| 563 | farewell-humankindness.biz | Network Solutions, LLC | 14 Feb 2013 | 20 Dec 2021 | 13 Feb 2025 |
| 564 | farewellloans.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 565 | farewellpartyfilm.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 566 | farewellbigpapi.com | - | 25 Jul 2016 | 25 Jul 2016 | 25 Jul 2017 |
| 567 | farewellusa.com | Blisternet, Inc. | 16 Oct 2018 | 16 Oct 2018 | 16 Oct 2019 |
| 568 | farewellreytino.com | eNom, Inc. | 28 Jul 2016 | 8 Sep 2017 | 28 Jul 2017 |
| 569 | farewellface.com | - | 31 Jul 2016 | 31 Jul 2016 | 31 Jul 2017 |
| 570 | farewelltoremember.com | - | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 571 | farewell-films.com | Wix.com Ltd. | 21 Nov 2023 | 21 Nov 2023 | 21 Nov 2024 |
| 572 | farewellharbourlodge.com | GoDaddy.com, LLC | 6 Aug 2016 | 28 Sep 2022 | 6 Aug 2026 |
| 573 | farewelldearfriends.com | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2017 |
| 574 | farewellharbourlodge.info | GoDaddy.com, LLC | 6 Aug 2016 | 5 Oct 2016 | 6 Aug 2021 |
| 575 | farewellharbourlodge.net | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2021 |
| 576 | farewellharbourlodge.org | GoDaddy.com, LLC | 6 Aug 2016 | 6 Oct 2016 | 6 Aug 2021 |
| 577 | farewelldvideos.site | NameCheap, Inc. | 10 Aug 2016 | 15 Sep 2017 | 10 Aug 2017 |
| 578 | farewell-innovators.com | Tucows Domains Inc. | 12 Aug 2016 | 16 Aug 2022 | 12 Aug 2022 |
| 579 | farewellbetty.com | Tucows Domains Inc. | 16 Aug 2016 | 1 Aug 2024 | 16 Aug 2025 |
| 580 | farewellcorporateworld.com | NameCheap, Inc. | 21 Apr 2021 | 3 Jul 2024 | 21 Apr 2024 |
| 581 | farewelltothesea.com | Megazone Corp., dba HOSTING.KR | 28 Nov 2016 | 1 Dec 2017 | 28 Nov 2017 |
| 582 | farewellrexallplace.com | NameScout Corp. | 8 Apr 2016 | 9 Apr 2024 | 8 Apr 2025 |
| 583 | farewell2fat.com | Moniker Online Services LLC | 12 Feb 2010 | 20 Mar 2024 | 12 Feb 2025 |
| 584 | farewellutopia.com | Gandi SAS | 4 Oct 2005 | 5 Aug 2024 | 4 Oct 2024 |
| 585 | farewellcasket.com | GoDaddy.com, LLC | 17 May 2011 | 17 May 2016 | 17 May 2017 |
| 586 | farewellconcepts.com | GoDaddy.com, LLC | 25 Jun 2012 | 9 Jan 2024 | 7 Jan 2034 |
| 587 | farewelltowashington.com | GoDaddy.com, LLC | 26 Jul 2010 | 27 Jul 2014 | 26 Jul 2017 |
| 588 | farewellsymphony.com | GoDaddy.com, LLC | 8 Jul 2013 | 21 Jun 2015 | 8 Jul 2017 |
| 589 | farewellberlin.com | Tucows Domains Inc. | 1 May 2018 | 30 Apr 2024 | 1 May 2025 |
| 590 | farewelltosanity.com | - | 17 Jan 2024 | 4 Apr 2024 | 17 Jan 2025 |
| 591 | farewellchannel.com | GoDaddy.com, LLC | 23 Oct 2013 | 23 Oct 2023 | 23 Oct 2024 |
| 592 | farewellfromthefatherland.com | GoDaddy.com, LLC | 1 Feb 2012 | 2 Feb 2024 | 1 Feb 2025 |
| 593 | farewelleva.com | DreamHost, LLC | 3 Aug 2009 | 15 Sep 2017 | 3 Aug 2017 |
| 594 | farewelldavidson.com | Megazone Corp., dba HOSTING.KR | 21 Jul 2017 | 21 Jul 2017 | 21 Jul 2018 |
| 595 | farewellplanning.com | GoDaddy.com, LLC | 4 Jul 2013 | 5 Jul 2023 | 4 Jul 2026 |
| 596 | farewellbeijing.com | GoDaddy.com, LLC | 2 Jun 2011 | 26 May 2016 | 2 Jun 2017 |
| 597 | farewelltours.com | Annulet LLC | 8 Dec 2009 | 6 Nov 2023 | 8 Dec 2024 |
| 598 | farewelladdiction.com | Realtime Register B.V. | 27 Aug 2010 | 28 Jul 2017 | 27 Aug 2018 |
| 599 | farewellvideo.com | Key-Systems GmbH | 19 Apr 2009 | 18 Apr 2024 | 19 Apr 2025 |
| 600 | farewelladdresses.com | Fabulous.com Pty Ltd. | 18 Nov 2004 | 26 Dec 2015 | 18 Nov 2016 |
| 601 | farewellmyconcubine.com | GoDaddy.com, LLC | 30 Nov 2006 | 10 Nov 2023 | 30 Nov 2024 |
| 602 | farewell-gutmann.com | GMO Internet Inc. | 6 Apr 2010 | 18 Jun 2024 | 6 Apr 2024 |
| 603 | farewellaustralia.com | GoDaddy.com, LLC | 17 May 2013 | 18 May 2016 | 17 May 2017 |
| 604 | farewellthoughts.com | GoDaddy.com, LLC | 1 Apr 2023 | 2 Apr 2024 | 1 Apr 2025 |
| 605 | farewellmyson.com | Webfusion Ltd. | 26 Sep 2010 | 20 Mar 2015 | 26 Sep 2016 |
| 606 | farewellisrael.com | GoDaddy.com, LLC | 15 Jun 2007 | 15 Jun 2024 | 15 Jun 2026 |
| 607 | farewellmylonely.com | GMO Internet Inc. | 29 Mar 2013 | 10 May 2024 | 29 Mar 2024 |
| 608 | farewellspeech.com | NameCheap, Inc. | 19 Feb 2024 | 19 Feb 2024 | 19 Feb 2025 |
| 609 | farewelloldstringy.com | register.com, Inc. | 29 Jul 2014 | 31 Jul 2016 | 29 Jul 2017 |
| 610 | farewellharbour.com | GoDaddy.com, LLC | 20 Mar 2000 | 28 Sep 2022 | 20 Mar 2027 |
| 611 | farewell-funerals.com | 1&1 Internet AG | 26 Feb 2014 | 27 Feb 2017 | 26 Feb 2018 |
| 612 | farewellletter.com | GoDaddy.com, LLC | 18 Dec 2020 | 19 Dec 2022 | 18 Dec 2024 |
| 613 | farewelltypewriter.com | NameCheap, Inc. | 11 Jul 2006 | 11 Jun 2024 | 11 Jul 2025 |
| 614 | farewell-cards.com | eNom, Inc. | 8 Aug 2008 | 11 Aug 2016 | 8 Aug 2016 |
| 615 | farewellatlantis.com | MarkMonitor Inc. | 3 Apr 2008 | 2 Aug 2024 | 3 Apr 2025 |
| 616 | farewell-mail.com | united-domains AG | 26 Apr 2008 | 2 Aug 2024 | 26 Apr 2025 |
| 617 | farewellfuneraldirectors.com | GoDaddy.com, LLC | 18 Jun 2021 | 30 Aug 2023 | 18 Jun 2023 |
| 618 | farewellness.com | GoDaddy.com, LLC | 10 Oct 2017 | 9 May 2024 | 10 Oct 2024 |
| 619 | farewellhoward.com | GoDaddy.com, LLC | 1 Jul 2009 | 1 Jul 2024 | 1 Jul 2025 |
| 620 | farewelltodaylight.com | Wild West Domains, LLC | 11 Aug 2014 | 22 Jul 2024 | 11 Aug 2025 |
| 621 | farewellbendconstruction.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 3 May 2006 | 3 May 2024 | 3 May 2025 |
| 622 | farewell-ceremony.com | GMO Internet Inc. | 26 Nov 2009 | 30 Jul 2015 | 26 Nov 2018 |
| 623 | farewellpackage.com | GoDaddy.com, LLC | 21 Jul 2004 | 1 Jul 2024 | 21 Jul 2025 |
| 624 | farewellapparel.com | FastDomain Inc. | 2 Dec 2009 | 17 Nov 2023 | 2 Dec 2024 |
| 625 | farewellgeorgebush.com | GoDaddy.com, LLC | 31 Oct 2008 | 24 Oct 2015 | 31 Oct 2016 |
| 626 | farewellfilms.com | Squarespace Domains LLC | 14 May 2017 | 29 Apr 2024 | 14 May 2025 |
| 627 | farewellcolette.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 26 Jul 2021 | 26 Jul 2023 | 26 Jul 2024 |
| 628 | farewellhowardstern.com | GoDaddy.com, LLC | 1 Jul 2009 | 1 Jul 2024 | 1 Jul 2025 |
| 629 | farewellmold.com | GoDaddy.com, LLC | 29 Jul 2008 | 2 Aug 2016 | 29 Jul 2016 |
| 630 | farewellembrace.com | Realtime Register B.V. | 30 May 2021 | 30 May 2021 | 30 May 2022 |
| 631 | farewellcruelworld.com | Webfusion Ltd. | 27 May 2014 | 25 May 2016 | 27 May 2018 |
| 632 | farewellparty.com | GoDaddy.com, LLC | 26 Apr 2002 | 6 Apr 2024 | 26 Apr 2025 |
| 633 | farewellmylove.com | Dynadot6 LLC | 13 Apr 2024 | 13 Apr 2024 | 13 Apr 2025 |
| 634 | farewellcontinental.com | Network Solutions, LLC | 23 Dec 2010 | 24 Oct 2020 | 23 Dec 2025 |
| 635 | farewelltoalchemy.com | Webfusion Ltd. | 11 Dec 2011 | 4 Dec 2016 | 11 Dec 2017 |
| 636 | farewellcenter.com | Network Solutions, LLC | 21 Oct 2013 | 5 Mar 2017 | 21 Oct 2018 |
| 637 | farewellcellulite.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jun 2014 | 19 Jun 2020 | 25 Jun 2024 |
| 638 | farewellfat.com | GoDaddy.com, LLC | 13 Sep 2011 | 30 Aug 2024 | 13 Sep 2025 |
| 639 | farewelltolust.com | GoDaddy.com, LLC | 29 Mar 2002 | 30 Mar 2024 | 29 Mar 2025 |
| 640 | farewellperformance.com | GoDaddy.com, LLC | 5 Feb 2014 | 6 Feb 2024 | 5 Feb 2025 |
| 641 | farewellacne.com | GoDaddy.com, LLC | 7 Sep 2020 | 7 Sep 2020 | 7 Sep 2021 |
| 642 | farewellsongs.com | - | 6 Jul 2022 | 19 Aug 2024 | 6 Jul 2024 |
| 643 | farewellcandlestick.com | Wild West Domains, LLC | 2 Nov 2012 | 3 Nov 2023 | 2 Nov 2024 |
| 644 | farewelltravels.com | Wild West Domains, LLC | 11 Apr 2009 | 12 Apr 2024 | 11 Apr 2025 |
| 645 | farewell-humankindness.com | Network Solutions, LLC | 14 Feb 2013 | 15 Dec 2021 | 14 Feb 2025 |
| 646 | farewelldirectory.com | GoDaddy.com, LLC | 16 Feb 2010 | 17 Feb 2016 | 16 Feb 2018 |
| 647 | farewellspeeches.com | GoDaddy.com, LLC | 8 Nov 2003 | 19 Oct 2023 | 8 Nov 2024 |
| 648 | farewellbookstore.com | DropCatch.com 677 LLC | 18 Apr 2021 | 29 Feb 2024 | 18 Apr 2025 |
| 649 | farewellpoem.com | Realtime Register B.V. | 4 Dec 2022 | 18 Dec 2023 | 4 Dec 2023 |
| 650 | farewellhope.com | GoDaddy.com, LLC | 27 Oct 2003 | 7 Oct 2023 | 27 Oct 2024 |
| 651 | farewellwords.com | TurnCommerce, Inc. DBA NameBright.com | 29 Mar 2012 | 23 Mar 2021 | 29 Mar 2024 |
| 652 | farewellcomrades.com | Gandi SAS | 11 Dec 2009 | 18 Dec 2023 | 11 Dec 2025 |
| 653 | farewelldressed.com | Network Solutions, LLC | 23 Feb 2013 | 7 Jan 2020 | 23 Feb 2025 |
| 654 | farewellcolleague.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Nov 2023 | 25 Mar 2024 | 21 Nov 2024 |
| 655 | farewellquotes.com | NameCheap, Inc. | 19 Mar 2024 | 2 May 2024 | 19 Mar 2025 |
| 656 | farewellthewinterline.com | NameCheap, Inc. | 16 Nov 2001 | 18 Nov 2023 | 16 Nov 2024 |
| 657 | farewellpartythemovie.com | eNom, Inc. | 30 Oct 2013 | 29 Oct 2013 | 30 Oct 2016 |
| 658 | farewellbendhouseofdogs.com | Tucows Domains Inc. | 20 Jun 2017 | 24 Jun 2019 | 20 Jun 2019 |
| 659 | farewellmusicswitzerland.com | 1API GmbH | 2 Jul 2008 | 8 Jan 2017 | 2 Jul 2018 |
| 660 | farewellticket.com | register.com, Inc. | 5 Apr 2007 | 5 Apr 2007 | 5 Apr 2017 |
| 661 | farewell-friends.com | RegistryGate GmbH | 15 Mar 2007 | 15 Mar 2024 | 15 Mar 2025 |
| 662 | farewellandgoodnight.com | Squarespace Domains LLC | 28 Mar 2023 | 27 May 2024 | 28 Mar 2024 |
| 663 | farewellhavana.com | Easyspace LTD | 9 Nov 2011 | 11 Nov 2015 | 9 Nov 2016 |
| 664 | farewelltophilosophy.com | TierraNet Inc. d/b/a DomainDiscover | 20 Apr 2003 | 8 Apr 2024 | 20 Apr 2025 |
| 665 | farewelltour.com | Tucows Domains Inc. | 8 Mar 2000 | 8 Feb 2024 | 8 Mar 2025 |
| 666 | farewellmrpresident.com | GMO Internet Inc. | 19 Oct 2016 | 30 Nov 2017 | 19 Oct 2017 |
| 667 | farewellfamily.com | GoDaddy.com, LLC | 28 Jun 2022 | 4 Jul 2024 | 28 Jun 2025 |
| 668 | farewellmyfriend.com | GoDaddy.com, LLC | 6 Aug 2001 | 6 Aug 2024 | 6 Aug 2025 |
| 669 | farewellrecords.com | united-domains AG | 2 Apr 2013 | 4 Aug 2024 | 2 Apr 2025 |
| 670 | farewellclipart.com | Fabulous.com Pty Ltd. | 3 Feb 2005 | 3 Feb 2016 | 3 Feb 2017 |
| 671 | farewellfind.com | GoDaddy.com, LLC | 31 Jul 2011 | 25 Jul 2016 | 31 Jul 2017 |
| 672 | farewelltofat.com | GoDaddy.com, LLC | 28 Apr 2024 | 28 Apr 2024 | 28 Apr 2025 |
| 673 | farewellstudio.com | Wild West Domains, LLC | 2 Oct 2012 | 3 Oct 2023 | 2 Oct 2024 |
| 674 | farewell-my-friend.com | 1&1 Internet AG | 11 Nov 2011 | 12 Nov 2016 | 11 Nov 2017 |
| 675 | farewell-dontforgetme.com | GoDaddy.com, LLC | 22 Dec 2011 | 3 Jan 2016 | 22 Dec 2016 |
| 676 | farewelldarkness.com | DropCatch.com 1187 LLC | 4 Jul 2018 | 2 Aug 2024 | 4 Jul 2025 |
| 677 | farewellfear.com | OnlineNIC, Inc. | 20 Mar 2019 | 20 Mar 2019 | 20 Mar 2020 |
| 678 | farewellday.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Aug 2008 | 29 Dec 2011 | 25 Aug 2018 |
| 679 | farewelltransmission.com | NameCheap, Inc. | 10 Jan 2011 | 11 Dec 2023 | 10 Jan 2025 |
| 680 | farewell-letter.com | InterNetworX Ltd. & Co. KG | 11 Jul 2014 | 11 Jul 2024 | 11 Jul 2025 |
| 681 | farewelltoanxiety.com | Crazy Domains FZ-LLC | 19 Sep 2010 | 30 Sep 2018 | 19 Sep 2018 |
| 682 | farewellbracelets.com | GoDaddy.com, LLC | 12 Sep 2008 | 12 Sep 2024 | 12 Sep 2025 |
| 683 | farewelltospring.com | GoDaddy.com, LLC | 8 Mar 2020 | 9 Mar 2024 | 8 Mar 2026 |
| 684 | farewellguide.com | GoDaddy.com, LLC | 13 Feb 2019 | 14 Feb 2023 | 13 Feb 2025 |
| 685 | farewellfibromyalgia.com | GoDaddy.com, LLC | 21 May 2014 | 2 Jul 2024 | 21 May 2024 |
| 686 | farewellphotography.com | GoDaddy.com, LLC | 8 Sep 2008 | 9 Sep 2024 | 8 Sep 2025 |
| 687 | farewelltothemoon.com | Key-Systems GmbH | 6 Jan 2014 | 7 Jan 2016 | 6 Jan 2017 |
| 688 | farewellsbydiane.com | Tucows Domains Inc. | 7 Jul 2007 | 11 Jul 2020 | 7 Jul 2020 |
| 689 | farewell-print.com | 1&1 Internet AG | 11 Mar 2008 | 10 Mar 2018 | 11 Mar 2025 |
| 690 | farewelltonormal.com | GoDaddy.com, LLC | 6 Jun 2011 | 6 Jun 2016 | 6 Jun 2017 |
| 691 | farewellanxiety.com | 1&1 Internet AG | 16 Aug 2023 | 17 Aug 2024 | 16 Aug 2025 |
| 692 | farewellroxane.com | GoDaddy.com, LLC | 30 Dec 2012 | 31 Dec 2023 | 30 Dec 2024 |
| 693 | farewellrocketship.com | Domaindrop LLC | 26 Feb 2016 | 4 Jul 2016 | 26 Feb 2017 |
| 694 | farewelltofactorytowns.com | GMO Internet Inc. | 1 Apr 2017 | 2 May 2017 | 31 Mar 2018 |
| 695 | farewelllittlemessa.com | GoDaddy.com, LLC | 2 May 2012 | 2 May 2016 | 2 May 2017 |
| 696 | farewellbuddy.com | Vautron Rechenzentrum AG | 7 Apr 2009 | 9 Apr 2017 | 7 Apr 2018 |
| 697 | farewellmymanicure.com | register.com, Inc. | 17 Apr 2023 | 30 May 2024 | 17 Apr 2024 |
| 698 | farewellearth.com | Google, Inc. | 14 Jun 2021 | 30 May 2024 | 14 Jun 2025 |
| 699 | farewelltoafriend.com | Dynadot, LLC | 15 Aug 2005 | 16 Aug 2024 | 15 Aug 2025 |
| 700 | farewelldiamonds.com | GoDaddy.com, LLC | 9 Feb 2014 | 10 Feb 2016 | 9 Feb 2017 |
| 701 | farewellbook.com | TurnCommerce, Inc. DBA NameBright.com | 4 May 2022 | 23 Aug 2022 | 4 May 2024 |
| 702 | farewellmilwaukee.com | GoDaddy.com, LLC | 18 Apr 2008 | 19 Apr 2024 | 18 Apr 2025 |
| 703 | farewellmosquito.com | CSC Corporate Domains, Inc. | 2 Nov 2007 | 4 Dec 2016 | 2 Nov 2018 |
| 704 | farewelltoarmstee.com | Key-Systems GmbH | 13 Jul 2021 | 13 Jul 2021 | 13 Jul 2022 |
| 705 | farewellprint.com | 1&1 Internet AG | 3 Apr 2008 | 10 Mar 2018 | 3 Apr 2025 |
| 706 | farewellfoods.com | FastDomain Inc. | 28 Mar 2014 | 7 Apr 2017 | 28 Mar 2018 |
| 707 | farewell-petworries.com | GoDaddy.com, LLC | 5 Jul 2012 | 10 Jul 2022 | 5 Jul 2022 |
| 708 | farewellstofilm.com | GoDaddy.com, LLC | 22 Mar 2013 | 23 Mar 2024 | 22 Mar 2025 |
| 709 | farewellaleppo.com | Tucows Domains Inc. | 11 Mar 2014 | 15 Mar 2022 | 11 Mar 2022 |
| 710 | farewellrealestate.com | Network Solutions, LLC | 19 May 2007 | 3 Oct 2017 | 19 May 2018 |
| 711 | farewelltuesdays.com | GoDaddy.com, LLC | 30 Aug 2011 | 31 Aug 2014 | 30 Aug 2016 |
| 712 | farewellthemovie.com | Wild West Domains, LLC | 2 Jun 2010 | 3 Jun 2024 | 2 Jun 2025 |
| 713 | farewellfootwear.com | Tucows Domains Inc. | 13 May 2013 | 6 May 2024 | 13 May 2025 |
| 714 | farewellflight.com | Domain ala Carte, LLC | 12 Oct 2020 | 13 Aug 2023 | 12 Oct 2024 |
| 715 | farewellfamiliar.com | GoDaddy.com, LLC | 21 Sep 2009 | 6 Sep 2022 | 21 Sep 2024 |
| 716 | farewellbracelet.com | GoDaddy.com, LLC | 12 Sep 2008 | 29 Jul 2016 | 12 Sep 2017 |
| 717 | farewellconcert.com | Uniregistrar Corp | - | - | - |
| 718 | farewellplanner.com | CSC Corporate Domains, Inc. | 17 Feb 2023 | 13 Feb 2024 | 17 Feb 2025 |
| 719 | farewellmessages.com | GoDaddy.com, LLC | 6 Jul 2003 | 16 Jun 2024 | 6 Jul 2025 |
| 720 | farewellmypet.com | Tucows Domains Inc. | 17 Nov 2006 | 21 Nov 2022 | 17 Nov 2022 |
| 721 | farewellspit.com | 1API GmbH | 26 Jan 2001 | 3 Apr 2023 | 26 Jan 2025 |
| 722 | farewellmysubaru.com | GoDaddy.com, LLC | 5 Apr 2007 | 20 Mar 2024 | 5 Apr 2025 |
| 723 | farewelldepression.com | DropCatch.com 694 LLC | 6 Dec 2018 | 6 Dec 2018 | 6 Dec 2019 |
| 724 | farewellcrew.com | GoDaddy.com, LLC | 16 Sep 2020 | 16 Sep 2020 | 16 Sep 2021 |
| 725 | farewellcheese.com | GoDaddy.com, LLC | 18 Jul 2012 | 19 Jul 2014 | 18 Jul 2016 |
| 726 | farewellcard.com | Google, Inc. | 15 Sep 2020 | 31 Aug 2024 | 15 Sep 2025 |
| 727 | farewellphotos.com | Wild West Domains, LLC | 24 May 2009 | 25 May 2024 | 24 May 2025 |
| 728 | farewellftp.com | Wild West Domains, LLC | 22 Mar 2011 | 23 Mar 2024 | 22 Mar 2025 |
| 729 | farewellmysanity.com | NameCheap, Inc. | 27 Jun 2013 | 23 Jun 2024 | 27 Jun 2025 |
| 730 | farewellnewyork.com | Wild West Domains, LLC | 2 Jan 2013 | 3 Jan 2024 | 2 Jan 2025 |
| 731 | farewellnovember.com | Tucows Domains Inc. | 12 Jul 2005 | 11 Jul 2024 | 12 Jul 2025 |
| 732 | farewellgejack.com | CSC Corporate Domains, Inc. | 15 Nov 1999 | 21 Dec 2016 | 15 Nov 2017 |
| 733 | farewellhero.com | GoDaddy.com, LLC | 21 Jul 2013 | 29 Jul 2016 | 21 Jul 2017 |
| 734 | farewellsmells.com | GoDaddy.com, LLC | 26 Mar 2014 | 27 Mar 2016 | 26 Mar 2017 |
| 735 | farewellcookie.com | GoDaddy.com, LLC | 10 Aug 2014 | 10 Aug 2014 | 10 Aug 2016 |
| 736 | farewellmemories.com | 1&1 Internet AG | 16 Jan 2006 | 17 Jan 2017 | 16 Jan 2018 |
| 737 | farewelltoarms.com | GoDaddy.com, LLC | 21 Mar 2002 | 1 Mar 2024 | 21 Mar 2025 |
| 738 | farewellmagazine.com | Mesh Digital Limited | 8 Nov 2018 | 8 Nov 2018 | 8 Nov 2019 |
| 739 | farewellcolumbia.com | GoDaddy.com, LLC | 29 Jun 2007 | 4 Sep 2022 | 29 Jun 2027 |
| 740 | farewellfatty.com | GoDaddy.com, LLC | 1 Aug 2014 | 1 Aug 2014 | 1 Aug 2016 |
| 741 | farewellmosquitoes.com | - | 22 Feb 2024 | 25 Feb 2024 | 22 Feb 2025 |
| 742 | farewellangelina.com | 1API GmbH | 25 Mar 2013 | 3 Apr 2023 | 25 Mar 2025 |
| 743 | farewellave.com | Domain Original, LLC | 20 Oct 2021 | 20 Oct 2021 | 20 Oct 2022 |
| 744 | farewellcelebrations.com | GoDaddy.com, LLC | 3 Aug 2013 | 4 Aug 2016 | 3 Aug 2017 |
| 745 | farewellflightservice.com | Network Solutions, LLC | 1 Apr 2013 | 31 Jan 2024 | 1 Apr 2025 |
| 746 | farewellfornow.com | GoDaddy.com, LLC | 22 Nov 2008 | 19 Nov 2023 | 22 Nov 2025 |
| 747 | farewellforum.com | Wild West Domains, LLC | 19 Dec 2011 | 20 Dec 2015 | 19 Dec 2016 |
| 748 | farewellgerms.com | GoDaddy.com, LLC | 29 Jan 2010 | 29 Jan 2024 | 29 Jan 2025 |
| 749 | farewellplan.com | Webfusion Ltd. | 10 Jun 2020 | 11 Jun 2024 | 10 Jun 2026 |
| 750 | farewelljack.com | CSC Corporate Domains, Inc. | 15 Nov 1999 | 21 Dec 2016 | 15 Nov 2017 |
| 751 | farewelladventurer.com | GoDaddy.com, LLC | 23 Nov 2009 | 26 Nov 2014 | 23 Nov 2016 |
| 752 | farewelltenney.com | NameCheap, Inc. | 22 Nov 2013 | 23 Oct 2023 | 22 Nov 2024 |
| 753 | farewellexperience.com | GoDaddy.com, LLC | 26 Mar 2022 | 27 Mar 2024 | 26 Mar 2026 |
| 754 | farewellsummerfestival.com | Launchpad, Inc. | 23 Oct 2013 | 8 Oct 2023 | 23 Oct 2026 |
| 755 | farewell-architects.com | Network Solutions, LLC | 4 Mar 2011 | 2 Mar 2022 | 4 Mar 2025 |
| 756 | farewellfantasyland.com | GoDaddy.com, LLC | 1 Jan 2009 | 7 May 2024 | 1 Jan 2025 |
| 757 | farewellrobbell.com | GoDaddy.com, LLC | 2 Mar 2011 | 2 Mar 2016 | 2 Mar 2017 |
| 758 | farewellgoods.com | Cronon AG | 9 Jun 2014 | 9 Jun 2014 | 9 Jun 2017 |
| 759 | farewellsayings.com | Fabulous.com Pty Ltd. | 15 Jan 2008 | 16 Jan 2016 | 15 Jan 2017 |
| 760 | farewelltoeden.com | register.com, Inc. | 20 Sep 2023 | 21 Sep 2024 | 20 Sep 2025 |
| 761 | farewellcruise.com | GoDaddy.com, LLC | 31 Jan 2013 | 31 Jan 2015 | 31 Jan 2017 |
| 762 | farewellcards.com | GoDaddy.com, LLC | 20 Dec 2001 | 30 Nov 2023 | 20 Dec 2024 |
| 763 | farewellcolon.com | NameCheap, Inc. | 17 Sep 2013 | 7 Nov 2023 | 17 Sep 2025 |
| 764 | farewellnadine.com | Wild West Domains, LLC | 26 Jan 2011 | 26 Jan 2011 | 26 Jan 2021 |
| 765 | farewellatsea.com | GoDaddy.com, LLC | 30 Dec 2009 | 4 Oct 2014 | 30 Dec 2016 |
| 766 | farewelltowords.com | Mesh Digital Limited | 4 Nov 2005 | 3 Nov 2023 | 4 Nov 2024 |
| 767 | farewelladdress.com | GoDaddy.com, LLC | 20 Oct 2021 | 6 Oct 2022 | 20 Oct 2024 |
| 768 | farewellgreen.com | GoDaddy.com, LLC | 15 Jul 2011 | 28 Jun 2024 | 15 Jul 2025 |
| 769 | farewelljr.com | DropCatch.com 1486 LLC | 10 Apr 2020 | 10 Apr 2020 | 10 Apr 2021 |
| 770 | farewellcancer.com | TurnCommerce, Inc. DBA NameBright.com | 26 Nov 2018 | 20 Nov 2020 | 26 Nov 2024 |
| 771 | farewell2fear.com | GoDaddy.com, LLC | 18 Jun 2010 | 19 Jun 2024 | 18 Jun 2026 |
| 772 | farewellcell.com | GoDaddy.com, LLC | 2 Nov 2012 | 1 Jan 2024 | 2 Nov 2024 |
| 773 | farewellpoetry.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Jul 2022 | 12 Sep 2024 | 11 Jul 2024 |
| 774 | farewellfido.com | GoDaddy.com, LLC | 7 May 2013 | 8 May 2023 | 7 May 2028 |
| 775 | farewelltomorrow.com | NameCheap, Inc. | 18 Jul 2005 | 19 Jul 2024 | 18 Jul 2025 |
| 776 | farewellstudios.com | Tucows Domains Inc. | 6 Dec 2000 | 5 Dec 2023 | 6 Dec 2024 |
| 777 | farewellfuneral.com | NameCheap, Inc. | 25 Jan 2024 | 25 Jan 2024 | 25 Jan 2025 |
| 778 | farewells-with-flair.com | Namezero, LLC | 13 Apr 2007 | 5 Apr 2023 | 14 Apr 2025 |
| 779 | farewelltothee.com | Namesilo, LLC | 21 Feb 2006 | 21 Feb 2024 | 21 Feb 2025 |
| 780 | farewellbysea.com | GoDaddy.com, LLC | 8 Nov 2011 | 9 Nov 2023 | 8 Nov 2024 |
| 781 | farewell2925.com | NameCheap, Inc. | 11 Apr 2019 | 11 Apr 2019 | 11 Apr 2020 |
| 782 | farewellcarousel.com | - | 15 Mar 2023 | 16 Apr 2024 | 15 Mar 2024 |
| 783 | farewellpaperie.com | NameCheap, Inc. | 9 Feb 2009 | 22 Jan 2024 | 9 Feb 2025 |
| 784 | farewelldesign.com | Wild West Domains, LLC | 2 Jan 2013 | 3 Jan 2024 | 2 Jan 2025 |
| 785 | farewelltravel.com | Google, Inc. | 11 Nov 2018 | 20 Apr 2024 | 11 Nov 2025 |
| 786 | farewellmessage.com | Moniker Online Services LLC | 28 Apr 2004 | 29 Apr 2024 | 28 Apr 2025 |
| 787 | farewell-book.com | FastDomain Inc. | 9 Feb 2014 | 20 Jan 2015 | 9 Feb 2017 |
| 788 | farewellmyrepublic.com | Network Solutions, LLC | 26 May 2010 | 24 May 2016 | 26 May 2017 |
| 789 | farewellislam.com | GoDaddy.com, LLC | 31 Dec 2005 | 31 Dec 2023 | 31 Dec 2024 |
| 790 | farewelldearghost.com | Tucows Domains Inc. | 20 Jan 2013 | 6 Jan 2024 | 20 Jan 2025 |
| 791 | farewellcd.com | DropFall.com, Inc. | 2 Apr 2022 | 12 Apr 2023 | 2 Apr 2024 |
| 792 | farewellstress.com | Annulet LLC | 29 Mar 2005 | 16 May 2024 | 29 Mar 2025 |
| 793 | farewellcake.com | Udamain.com LLC | 16 May 2024 | 16 May 2024 | 16 May 2025 |
| 794 | farewellfriend.com | GoDaddy.com, LLC | 30 Sep 2000 | 10 Sep 2023 | 30 Sep 2024 |
| 795 | farewelltree.com | GoDaddy.com, LLC | 6 Nov 2013 | 7 Nov 2023 | 6 Nov 2024 |
| 796 | farewellsong.com | GoDaddy.com, LLC | 3 Jan 2020 | 1 Nov 2022 | 3 Jan 2025 |
| 797 | farewelloffice.com | NameCheap, Inc. | 8 Jul 2022 | 19 Aug 2023 | 8 Jul 2023 |
| 798 | farewellwelch.com | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2020 | 15 Nov 2021 |
| 799 | farewellratrace.com | GoDaddy.com, LLC | 2 Nov 2018 | 5 Oct 2023 | 2 Nov 2024 |
| 800 | farewellclovis.com | GoDaddy.com, LLC | 22 Feb 2012 | 31 Jan 2024 | 22 Feb 2025 |
| 801 | farewellferriswheel.com | DropCatch.com 1058 LLC | 13 Feb 2023 | 25 Apr 2024 | 13 Feb 2024 |
| 802 | farewellpets.com | TurnCommerce, Inc. DBA NameBright.com | 19 Nov 2021 | 24 Aug 2022 | 19 Nov 2023 |
| 803 | farewellfactory.com | Hosting Concepts B.V. dba Openprovider | 3 Mar 2023 | 3 Mar 2024 | 3 Mar 2025 |
| 804 | farewellfriends.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jun 2012 | 5 Jun 2021 | 11 Jun 2024 |
| 805 | farewellnote.com | TurnCommerce, Inc. DBA NameBright.com | 23 Jan 2017 | 17 Jan 2021 | 23 Jan 2026 |
| 806 | farewellvenues.com | Key-Systems GmbH | 14 Nov 2013 | 19 Dec 2015 | 14 Nov 2016 |
| 807 | farewellnormal.com | Domain.com, LLC | 11 Aug 2014 | 27 Jul 2017 | 11 Aug 2018 |
| 808 | farewellpartyrecords.com | GoDaddy.com, LLC | 6 May 2008 | 7 May 2024 | 6 May 2025 |
| 809 | farewellonline.com | Wild West Domains, LLC | 30 Mar 2020 | 30 Mar 2020 | 30 Mar 2021 |
| 810 | farewellweight.com | Register.it SPA | 13 May 2021 | 13 May 2021 | 13 May 2022 |
| 811 | farewelltoliberty.com | GoDaddy.com, LLC | 5 Apr 2013 | 2 Jan 2024 | 1 May 2025 |
| 812 | farewellfarmtulsa.com | GoDaddy.com, LLC | 30 Nov 2018 | 30 Nov 2018 | 30 Nov 2019 |
| 813 | farewellplans.com | GoDaddy.com, LLC | 13 Feb 2024 | 29 Mar 2024 | 13 Feb 2025 |
| 814 | farewelldrifters.com | eNom, Inc. | 2 Aug 2005 | 3 Aug 2013 | 2 Aug 2018 |
| 815 | farewelltopets.com | GoDaddy.com, LLC | 8 Oct 2004 | 9 Oct 2023 | 8 Oct 2024 |
| 816 | farewellhair.com | Beijing Lanhai Jiye Technology Co., Ltd | 16 Feb 2012 | 19 Mar 2024 | 16 Feb 2024 |
| 817 | farewellpetkit.com | - | 24 Feb 2023 | 27 Apr 2024 | 24 Feb 2024 |
| 818 | farewellsummer.com | Launchpad, Inc. | 23 Oct 2013 | 8 Oct 2023 | 23 Oct 2026 |
| 819 | farewelltoadream.com | GoDaddy.com, LLC | 18 Oct 2007 | 21 Oct 2015 | 18 Oct 2016 |
| 820 | farewellbobbycox.com | GoDaddy.com, LLC | 12 Oct 2010 | 13 Oct 2022 | 12 Oct 2024 |
| 821 | farewell-poetry.com | NameKing.com Inc. | 12 Sep 2020 | 13 Sep 2024 | 12 Sep 2024 |
| 822 | farewellny.com | Wild West Domains, LLC | 2 Oct 2012 | 3 Oct 2023 | 2 Oct 2024 |
| 823 | farewell-familiar.com | GoDaddy.com, LLC | 21 Sep 2009 | 6 Sep 2022 | 21 Sep 2024 |
| 824 | farewelltofear.com | Webfusion Ltd. | 10 Oct 2005 | 3 Oct 2023 | 10 Oct 2024 |
| 825 | farewell-travel.com | Namesilo, LLC | 28 Apr 2000 | 29 Apr 2024 | 28 Apr 2025 |
| 826 | farewelldebt.com | GoDaddy.com, LLC | 6 Apr 2007 | 1 Apr 2024 | 6 Apr 2025 |
| 827 | farewelltoarms-pr.com | Tucows Domains Inc. | 30 Dec 2002 | 3 Jan 2022 | 30 Dec 2021 |
| 828 | farewelltohollywood.com | GoDaddy.com, LLC | 14 Jun 2012 | 14 Jun 2024 | 14 Jun 2025 |
| 829 | farewelljackwelch.com | CSC Corporate Domains, Inc. | 15 Nov 1999 | 21 Dec 2016 | 15 Nov 2017 |
| 830 | farewellindustries.com | Key-Systems GmbH | 8 Jul 2005 | 7 Jul 2024 | 8 Jul 2025 |
| 831 | farewellcare.com | GoDaddy.com, LLC | 8 Mar 2024 | 8 Mar 2024 | 8 Mar 2025 |
| 832 | farewellgluten.com | GoDaddy.com, LLC | 19 Feb 2014 | 19 Feb 2024 | 19 Feb 2025 |
| 833 | farewellmsg.com | GoDaddy.com, LLC | 14 Dec 2013 | 15 Dec 2015 | 14 Dec 2017 |
| 834 | farewellphotobook.com | PSI-USA, Inc. dba Domain Robot | 16 Aug 2010 | 17 Aug 2024 | 16 Aug 2025 |
| 835 | farewellagency.com | Wild West Domains, LLC | 2 Jan 2013 | 3 Jan 2024 | 2 Jan 2025 |
| 836 | farewellfrombeyond.com | Network Solutions, LLC | 6 Jun 2012 | 7 Apr 2017 | 6 Jun 2018 |
| 837 | farewellandaloha.com | GoDaddy.com, LLC | 30 Jan 2010 | 31 Jan 2016 | 30 Jan 2017 |
| 838 | farewellamelia.com | GoDaddy.com, LLC | 9 Oct 2014 | 9 Oct 2014 | 9 Oct 2016 |
| 839 | farewellletters.com | GoDaddy.com, LLC | 11 Sep 2024 | 11 Sep 2024 | 11 Sep 2025 |
| 840 | farewellconciergemoving.com | register.com, Inc. | 22 Feb 2014 | 7 Feb 2017 | 22 Feb 2018 |
| 841 | farewellenterprises.com | GoDaddy.com, LLC | 30 Mar 2009 | 31 Mar 2024 | 30 Mar 2025 |
| 842 | farewellstudentloans.online | NameCheap, Inc. | 30 Aug 2016 | 5 Oct 2017 | 30 Aug 2017 |
| 843 | farewellfatkatie.com | - | 2 Sep 2016 | 2 Sep 2016 | 2 Sep 2017 |
| 844 | farewellservices.com | GoDaddy.com, LLC | 3 Sep 2016 | 4 Sep 2024 | 3 Sep 2025 |
| 845 | farewellpresidentbarackobama.com | - | 3 Sep 2016 | 3 Sep 2016 | 3 Sep 2017 |
| 846 | farewellbarack.com | - | 3 Sep 2016 | 3 Sep 2016 | 3 Sep 2017 |
| 847 | farewellobamas.com | - | 3 Sep 2016 | 3 Sep 2016 | 3 Sep 2017 |
| 848 | farewellpresidentobama2016.com | - | 3 Sep 2016 | 3 Sep 2016 | 3 Sep 2017 |
| 849 | farewellstudentloans.us | NameCheap, Inc. | 2 Sep 2016 | 2 Sep 2016 | 1 Sep 2017 |
| 850 | farewellshelters.com | Tucows Domains Inc. | 7 Sep 2016 | 11 Sep 2018 | 7 Sep 2018 |
| 851 | farewellpain.com | GoDaddy.com, LLC | 29 Apr 2023 | 30 Apr 2024 | 29 Apr 2025 |
| 852 | farewellparkinson.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2016 | 3 Sep 2017 | 10 Sep 2018 |
| 853 | farewellmarc.com | - | 12 Sep 2016 | 12 Sep 2016 | 12 Sep 2017 |
| 854 | farewellmarcott.com | - | 12 Sep 2016 | 12 Sep 2016 | 12 Sep 2017 |
| 855 | farewelldirt.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Sep 2016 | 12 Aug 2017 | 11 Sep 2018 |
| 856 | farewellmeuamorfilm.com | GoDaddy.com, LLC | 16 Sep 2016 | 29 Sep 2022 | 16 Sep 2025 |
| 857 | farewellcheri.com | - | 16 Sep 2016 | 16 Sep 2016 | 16 Sep 2017 |
| 858 | farewellstore.com | GoDaddy.com, LLC | 8 May 2021 | 9 May 2024 | 8 May 2025 |
| 859 | farewell-tour.com | GoDaddy.com, LLC | 24 Aug 2019 | 24 Aug 2019 | 24 Aug 2020 |
| 860 | farewellravi.com | BigRock Solutions Ltd. | 26 Sep 2016 | 25 Jun 2024 | 26 Sep 2025 |
| 861 | farewelltimeshare.com | GoDaddy.com, LLC | 28 Mar 2019 | 31 May 2024 | 28 Mar 2025 |
| 862 | farewellride.com | Squarespace Domains LLC | 3 Sep 2024 | 3 Sep 2024 | 3 Sep 2025 |
| 863 | farewellimages.com | GoDaddy.com, LLC | 29 Sep 2016 | 4 Oct 2022 | 29 Sep 2024 |
| 864 | farewellmybread.com | Launchpad, Inc. | 2 Oct 2016 | 13 Nov 2017 | 2 Oct 2017 |
| 865 | farewellexperiences.com | - | 4 Oct 2016 | 4 Oct 2016 | 4 Oct 2018 |
| 866 | farewells.us | - | 3 Oct 2016 | 3 Oct 2016 | 2 Oct 2017 |
| 867 | farewellsnap.us | - | 4 Oct 2016 | 4 Oct 2016 | 3 Oct 2017 |
| 868 | farewellshort.us | Uniregistrar Corp | 3 Oct 2016 | 3 Oct 2016 | 2 Oct 2017 |
| 869 | farewellexperiences.us | - | 4 Oct 2016 | 4 Oct 2016 | 3 Oct 2018 |
| 870 | farewellsum.us | - | 4 Oct 2016 | 4 Oct 2016 | 3 Oct 2017 |
| 871 | farewell-dt.com | Xin Net Technology Corporation | 7 Jun 2021 | 12 Feb 2022 | 7 Jun 2022 |
| 872 | farewellevel.us | Uniregistrar Corp | 7 Oct 2016 | 7 Oct 2016 | 6 Oct 2017 |
| 873 | farewell-humankindness.info | Network Solutions, LLC | 14 Feb 2013 | 20 Dec 2021 | 14 Feb 2025 |
| 874 | farewell2fear.info | GoDaddy.com, LLC | 21 Sep 2012 | 8 Oct 2017 | 21 Sep 2022 |
| 875 | farewelltofear.info | GoDaddy.com, LLC | 7 Aug 2012 | 8 Aug 2016 | 7 Aug 2018 |
| 876 | farewellenterprises.info | GoDaddy.com, LLC | 30 Mar 2009 | 12 Jun 2024 | 30 Mar 2025 |
| 877 | farewellfirefilm.com | GoDaddy.com, LLC | 12 Oct 2016 | 13 Oct 2022 | 12 Oct 2024 |
| 878 | farewellwelch.net | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2020 | 15 Nov 2021 |
| 879 | farewellcolette.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 May 2010 | 5 May 2017 | 7 May 2018 |
| 880 | farewelljack.net | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 881 | farewell-friend.net | RegistryGate GmbH | 15 Mar 2007 | 15 Mar 2017 | 15 Mar 2018 |
| 882 | farewellcatering.net | Melbourne IT, Ltd | 23 Nov 2011 | 9 Dec 2013 | 23 Nov 2018 |
| 883 | farewell-my-friend.net | 1&1 Internet AG | 11 Nov 2011 | 23 Nov 2017 | 11 Nov 2018 |
| 884 | farewell2fat.net | GoDaddy.com, LLC | 1 Mar 2014 | 2 Mar 2016 | 1 Mar 2017 |
| 885 | farewelltofear.net | GoDaddy.com, LLC | 7 Aug 2012 | 7 Aug 2016 | 7 Aug 2018 |
| 886 | farewell-humankindness.net | Network Solutions, LLC | 14 Feb 2013 | 15 Dec 2021 | 14 Feb 2025 |
| 887 | farewellletters.net | GoDaddy.com, LLC | 4 Nov 2013 | 31 Oct 2023 | 4 Nov 2024 |
| 888 | farewelltohollywood.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Sep 2020 | 4 Sep 2020 | 4 Sep 2021 |
| 889 | farewellweight.net | GoDaddy.com, LLC | 3 Apr 2014 | 3 Apr 2014 | 3 Apr 2019 |
| 890 | farewellatlantis.net | MarkMonitor Inc. | 5 Aug 2008 | 31 Aug 2016 | 5 Aug 2017 |
| 891 | farewellfunerals.net | 1&1 Internet AG | 26 Feb 2014 | 23 Nov 2017 | 26 Feb 2018 |
| 892 | farewellgejack.net | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 893 | farewelldebt.net | GoDaddy.com, LLC | 6 Apr 2007 | 6 Apr 2015 | 6 Apr 2017 |
| 894 | farewellfriends.net | RegistryGate GmbH | 15 Mar 2007 | 15 Mar 2017 | 15 Mar 2018 |
| 895 | farewellcall.net | West263 International Limited | 29 Sep 2021 | 5 Nov 2023 | 29 Sep 2023 |
| 896 | farewelljackwelch.net | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 897 | farewellmyfriend.net | GoDaddy.com, LLC | 18 Dec 2007 | 18 Nov 2013 | 18 Dec 2016 |
| 898 | farewell-friends.net | RegistryGate GmbH | 15 Mar 2007 | 16 Mar 2017 | 15 Mar 2018 |
| 899 | farewelltofreedom.net | GoDaddy.com, LLC | 21 Dec 2009 | 21 Apr 2015 | 21 Dec 2016 |
| 900 | farewellfighter.net | GMO Internet Inc. | 15 Jul 2021 | 16 Jul 2021 | 15 Jul 2022 |
| 901 | farewellspeech.net | Namesilo, LLC | 11 Mar 2013 | 15 Oct 2016 | 11 Mar 2017 |
| 902 | farewellfornow.net | GoDaddy.com, LLC | 22 Nov 2008 | 14 Oct 2015 | 22 Nov 2016 |
| 903 | farewells.net | GoDaddy.com, LLC | 11 Mar 2019 | 12 Mar 2023 | 11 Mar 2025 |
| 904 | farewelljackwelch.org | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 905 | farewell-to-arms.org | GoDaddy.com, LLC | 10 Nov 2013 | 3 Jul 2024 | 10 Nov 2024 |
| 906 | farewellcancer.org | Network Solutions, LLC | 7 Sep 2005 | 29 Oct 2016 | 7 Sep 2018 |
| 907 | farewellrobbell.org | GoDaddy.com, LLC | 2 Mar 2011 | 3 Mar 2017 | 2 Mar 2018 |
| 908 | farewellwelch.org | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 909 | farewellvittorio.org | 1&1 Internet AG | 15 Apr 2011 | 9 Oct 2017 | 15 Apr 2018 |
| 910 | farewellacne.org | Moniker Online Services LLC | 10 Dec 2010 | 29 Nov 2016 | 10 Dec 2017 |
| 911 | farewellfornow.org | GoDaddy.com, LLC | 8 Nov 2009 | 14 Oct 2015 | 8 Nov 2016 |
| 912 | farewellplan.org | Mesh Digital Limited | 10 Jun 2020 | 25 Jul 2024 | 10 Jun 2025 |
| 913 | farewellgejack.org | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 914 | farewellletters.org | GoDaddy.com, LLC | 4 Nov 2013 | 1 Aug 2024 | 4 Nov 2024 |
| 915 | farewellgift.org | GoDaddy.com, LLC | 13 Jul 2024 | 18 Jul 2024 | 13 Jul 2025 |
| 916 | farewell-humankindness.org | Network Solutions, LLC | 14 Feb 2013 | 15 Dec 2021 | 14 Feb 2025 |
| 917 | farewells.org | Network Solutions, LLC | 27 Sep 2001 | 30 Sep 2023 | 27 Sep 2024 |
| 918 | farewellcellulite.org | Moniker Online Services LLC | 10 Dec 2010 | 29 Nov 2016 | 10 Dec 2017 |
| 919 | farewelltofear.org | GoDaddy.com, LLC | 25 Jul 2013 | 2 Jul 2024 | 25 Jul 2028 |
| 920 | farewelljack.org | CSC Corporate Domains, Inc. | 15 Nov 1999 | 11 Nov 2017 | 15 Nov 2018 |
| 921 | farewellmylittlevikingrecords.com | Tucows Domains Inc. | 24 Oct 2016 | 10 Oct 2023 | 24 Oct 2024 |
| 922 | farewelldeter.xyz | NameCheap, Inc. | 3 Jun 2016 | 27 Jun 2016 | 3 Jun 2017 |
| 923 | farewell-package.xyz | Uniregistrar Corp | 3 Jun 2016 | 23 Sep 2016 | 3 Jun 2017 |
| 924 | farewellpdx.xyz | Tucows Domains Inc. | 3 Jun 2016 | 19 Aug 2016 | 3 Jun 2017 |
| 925 | farewells.xyz | GMO Internet Inc. | 20 Jun 2024 | 25 Jun 2024 | 20 Jun 2025 |
| 926 | farewell-albion.de | - | - | 30 Nov 2017 | - |
| 927 | farewell-innovators.uk | - | 29 Jul 2014 | 29 Jun 2017 | 29 Jul 2018 |
| 928 | farewellmypet.co.uk | - | 20 Feb 2023 | 1 Apr 2024 | 20 Feb 2025 |
| 929 | farewell-furbaby.com | - | 2 Nov 2016 | 2 Nov 2016 | 2 Nov 2017 |
| 930 | farewellfurbaby.org | GoDaddy.com, LLC | 2 Nov 2016 | 14 Dec 2017 | 2 Nov 2018 |
| 931 | farewellcupid.com | Network Solutions, LLC | 3 Nov 2016 | 3 Nov 2016 | 3 Nov 2018 |
| 932 | farewellamerica.com | TurnCommerce, Inc. DBA NameBright.com | 30 Jan 2018 | 24 Jan 2021 | 30 Jan 2026 |
| 933 | farewellmyfaith.com | GMO Internet Inc. | 14 Nov 2016 | 13 Nov 2017 | 14 Nov 2018 |
| 934 | farewellparty.org | GoDaddy.com, LLC | 16 Nov 2016 | 16 Nov 2017 | 16 Nov 2018 |
| 935 | farewellsfargo.com | Tucows Domains Inc. | 20 Nov 2016 | 25 Nov 2017 | 20 Nov 2017 |
| 936 | farewellisland.com | eNom, Inc. | 26 Nov 2016 | 26 Nov 2016 | 26 Nov 2018 |
| 937 | farewellislands.com | eNom, Inc. | 26 Nov 2016 | 26 Nov 2016 | 26 Nov 2018 |
| 938 | farewellvalley.com | eNom, Inc. | 28 Nov 2016 | 1 Dec 2017 | 28 Nov 2017 |
| 939 | farewellevents.com | GoDaddy.com, LLC | 19 Feb 2019 | 5 Jan 2024 | 19 Feb 2025 |
| 940 | farewellfeatures.com | GoDaddy.com, LLC | 9 Dec 2016 | 9 Dec 2016 | 9 Dec 2018 |
| 941 | farewellclub.com | GoDaddy.com, LLC | 5 Oct 2023 | 22 Dec 2023 | 5 Oct 2024 |
| 942 | farewelllittlefriend.com | TPP Wholesale Pty Ltd. | 12 Dec 2016 | 2 Apr 2017 | 12 Dec 2019 |
| 943 | farewelltorazzaq.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Dec 2016 | 9 Jan 2018 | 20 Dec 2019 |
| 944 | farewellflowers.com | GoDaddy.com, LLC | 26 Dec 2016 | 27 Dec 2023 | 26 Dec 2024 |
| 945 | farewellmethod.com | GoDaddy.com, LLC | 29 Dec 2016 | 29 Dec 2016 | 29 Dec 2018 |
| 946 | farewelljunk.com | GoDaddy.com, LLC | 29 Dec 2016 | 29 Dec 2016 | 29 Dec 2017 |
| 947 | farewellfarrah.com | eNom, Inc. | 31 Dec 2016 | 2 Dec 2017 | 31 Dec 2018 |
| 948 | farewellmfg.com | GoDaddy.com, LLC | 17 Jan 2017 | 17 Jan 2017 | 17 Jan 2019 |
| 949 | farewellservices.com.au | - | - | 7 Jul 2024 | - |
| 950 | farewelltopain.com | GoDaddy.com, LLC | 25 Jan 2017 | 25 Jan 2017 | 25 Jan 2018 |
| 951 | farewellperiods.com | GoDaddy.com, LLC | 26 Jan 2017 | 26 Jan 2017 | 26 Jan 2019 |
| 952 | farewellperiod.com | GoDaddy.com, LLC | 26 Jan 2017 | 26 Jan 2017 | 26 Jan 2019 |
| 953 | farewellinnonce.com | GoDaddy.com, LLC | 27 Jan 2017 | 27 Jan 2017 | 27 Jan 2018 |
| 954 | farewelltopain.org | GoDaddy.com, LLC | 30 Jan 2017 | 1 Apr 2017 | 30 Jan 2018 |
| 955 | farewellstory.com | Gabia, Inc. | 6 Feb 2017 | 26 Feb 2020 | 6 Feb 2023 |
| 956 | farewellhouse.com | DropCatch.com 1488 LLC | 21 Jul 2024 | 22 Jul 2024 | 21 Jul 2025 |
| 957 | farewellhouse.net | GoDaddy.com, LLC | 17 Feb 2017 | 17 Feb 2017 | 17 Feb 2019 |
| 958 | farewell44.com | GoDaddy.com, LLC | 27 Feb 2017 | 27 Feb 2017 | 27 Feb 2018 |
| 959 | farewelltime.xyz | Uniregistrar Corp | 5 Mar 2017 | 26 May 2017 | 5 Mar 2018 |
| 960 | farewellhemorroids.com | NameCheap, Inc. | 7 Mar 2017 | 9 Mar 2017 | 7 Mar 2018 |
| 961 | farewelldays.com | Vautron Rechenzentrum AG | 9 Mar 2017 | 18 Mar 2024 | 9 Mar 2025 |
| 962 | farewelltotchotchkes.com | Tucows Domains Inc. | 14 Mar 2017 | 18 Mar 2018 | 14 Mar 2018 |
| 963 | farewell-architects.net | Network Solutions, LLC | 21 Mar 2017 | 21 Mar 2017 | 21 Mar 2018 |
| 964 | farewellfaithfulfriend.com | Wild West Domains, LLC | 26 Mar 2017 | 26 Mar 2017 | 26 Mar 2018 |
| 965 | farewellbro.com | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Aug 2023 | 17 Sep 2024 | 4 Aug 2024 |
| 966 | farewellbaby.com | DNSPod, Inc. | 15 Jun 2021 | 16 Jun 2021 | 15 Jun 2022 |
| 967 | farewell-cancer.com | Tucows Domains Inc. | 6 Apr 2017 | 6 Apr 2017 | 6 Apr 2018 |
| 968 | farewell-heartdisease.com | Tucows Domains Inc. | 6 Apr 2017 | 10 Apr 2021 | 6 Apr 2021 |
| 969 | farewell-diabetes.com | Tucows Domains Inc. | 5 Apr 2017 | 9 Apr 2019 | 5 Apr 2019 |
| 970 | farewelltoeu.com | Tucows Domains Inc. | 15 Apr 2017 | 19 Apr 2018 | 15 Apr 2018 |
| 971 | farewellfromhome.com | Wix.com Ltd. | 9 Jul 2021 | 9 Jun 2024 | 9 Jul 2025 |
| 972 | farewellprizes.zone | NameCheap, Inc. | 25 Apr 2017 | 29 Sep 2017 | 25 Apr 2018 |
| 973 | farewellchelsea.com | GoDaddy.com, LLC | 25 Apr 2017 | 25 Apr 2017 | 25 Apr 2022 |
| 974 | farewellphoto.com | Launchpad, Inc. | 27 Apr 2017 | 16 Apr 2024 | 27 Apr 2025 |
| 975 | farewellmeds.com | GoDaddy.com, LLC | 4 May 2017 | 5 May 2023 | 4 May 2025 |
| 976 | farewellmeds.org | GoDaddy.com, LLC | 4 May 2017 | 4 Jul 2017 | 4 May 2019 |
| 977 | farewellmeds.net | GoDaddy.com, LLC | 4 May 2017 | 4 May 2017 | 4 May 2019 |
| 978 | farewellmeds.info | GoDaddy.com, LLC | 4 May 2017 | 3 Jul 2017 | 4 May 2019 |
| 979 | farewelldrinks.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 6 May 2017 | 6 Jun 2017 | 6 May 2018 |
| 980 | farewellforte.com | Tucows Domains Inc. | 6 May 2017 | 21 Apr 2024 | 6 May 2025 |
| 981 | farewellextremist.net | GMO Internet Inc. | 9 May 2017 | 26 Aug 2017 | 9 May 2018 |
| 982 | farewellto8bit.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 1 Aug 2022 | 16 Sep 2023 | 1 Aug 2023 |
| 983 | farewellangellinamusic.com | GoDaddy.com, LLC | 23 May 2017 | 23 May 2017 | 23 May 2018 |
| 984 | farewellparkinson.com | NameCheap, Inc. | 31 May 2017 | 31 May 2017 | 31 May 2018 |
| 985 | farewellfuneralsupplies.com | eNom, Inc. | 1 Jun 2017 | 1 Jun 2017 | 1 Jun 2018 |
| 986 | farewellmemory.com | FastDomain Inc. | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 987 | farewellfunerals.info | Porkbun, LLC | 8 Jun 2017 | 18 Mar 2024 | 8 Jun 2025 |
| 988 | farewellgroup.com | TurnCommerce, Inc. DBA NameBright.com | 10 Jun 2017 | 18 May 2020 | 10 Jun 2025 |
| 989 | farewellmundania.com | GoDaddy.com, LLC | 9 Sep 2021 | 10 Sep 2024 | 9 Sep 2025 |
| 990 | farewellmisssmith.com | Crazy Domains FZ-LLC | 19 Jun 2017 | 20 Jun 2017 | 19 Jun 2018 |
| 991 | farewellmisssmith-hellomrskeulen.com | Network Solutions, LLC | 22 Jun 2017 | 22 Jun 2017 | 22 Jun 2018 |
| 992 | farewellheartdisease.com | Google, Inc. | 21 Jun 2017 | 21 Jun 2017 | 21 Jun 2018 |
| 993 | farewelljon.com | Tucows Domains Inc. | 22 Jun 2017 | 26 Jun 2019 | 22 Jun 2019 |
| 994 | farewellsafe.com | Amazon Registrar, Inc. | 2 Jul 2017 | 29 May 2024 | 2 Jul 2025 |
| 995 | farewellapp.com | NameCheap, Inc. | 22 Jun 2023 | 22 Jun 2023 | 22 Jun 2029 |
| 996 | farewellpas.com | Xin Net Technology Corporation | 23 May 2021 | 1 Nov 2021 | 23 May 2022 |
| 997 | farewellwish.com | GoDaddy.com, LLC | 6 Mar 2019 | 8 Mar 2024 | 6 Mar 2025 |
| 998 | farewellwinners.men | NameCheap, Inc. | 17 Jul 2017 | 17 Jul 2017 | 17 Jul 2018 |
| 999 | farewellwinners.accountant | NameCheap, Inc. | 20 Jul 2017 | 20 Jul 2017 | 20 Jul 2018 |
| 1000 | farewellflowers.org | Mesh Digital Limited | 27 Jul 2017 | 27 Jul 2017 | 27 Jul 2019 |
Displaying 1,000 out of 2,244 domains starting with the keyword "FAREWELL". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=farewell
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |