Our database now contains whois records of 587 Million (587,901,530) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1571 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [587 Million Domains] $10,000 Details

Keyword: FMTC

Reverse Whois » KEYWORD [fmtc ]  { 343 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1fmtc.coNameCheap, Inc.3 Feb 20148 Jan 20242 Feb 2025
2fmtc.comNetwork Solutions, LLC12 Oct 19958 Jul 202111 Oct 2026
3fmtc.xyzDynadot, LLC28 Nov 202329 Nov 202428 Nov 2025
4fmtc.wangeName Technology Co., Ltd.1 Jul 20156 Nov 20161 Jul 2018
5fmtc.topDNSPod, Inc.29 Dec 202129 Dec 202129 Dec 2022
6fmtc.usDynadot, LLC6 Jul 20236 Jul 20246 Jul 2024
7fmtc.netThe Registry at Info Avenue, LLC d/b/a Spirit Comm…12 Feb 199719 Dec 202313 Feb 2025
8fmtc.renChengdu West Dimension Digital Technology Co., Ltd…13 Dec 2015-13 Dec 2016
9fmtc.clubChengdu West Dimension Digital Technology Co., Ltd…7 Feb 2016-6 Feb 2017
10fmtc.redWest263 International Limited17 Feb 2016-17 Feb 2017
11fmtc.siteChengdu West Dimension Digital Technology Co., Ltd…24 Feb 2016-24 Feb 2017
12fmtc.xin-15 Mar 201615 Mar 201615 Mar 2017
13fmtc.ca-12 May 200627 Apr 202412 May 2025
14fmtc.vip-18 May 201618 May 201618 May 2017
15fmtc.amsterdamKey-Systems, LLC17 Aug 201517 Aug 201917 Aug 2020
16fmtc.bizThe Registry at Info Avenue, LLC d/b/a Spirit Comm…15 Nov 200130 Sep 201518 Nov 2020
17fmtc.infoPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 200116 May 202215 Aug 2027
18fmtc.orgNaugus Limited LLC4 Jun 200619 Jul 20244 Jun 2025
19fmtc.ccTucows Domains Inc.10 Feb 200313 Jan 202411 Feb 2025
20fmtc.it-7 May 200930 May 202414 May 2025
21fmtc.techNameCheap, Inc.15 Nov 201615 Nov 202415 Nov 2025
22fmtc.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Sep 201719 Sep 201719 Sep 2018
23fmtc.onlineNetwork Solutions, LLC30 May 202211 Aug 202330 May 2023
24fmtc.co.id-15 Mar 2013-15 Mar 2025
25fmtc.co.uk-30 Dec 20187 Oct 202430 Dec 2024
26fmtc.my.id-12 Jun 202013 Jun 202212 Jun 2023
27fmtc.globalPDR Ltd. d/b/a PublicDomainRegistry.com27 Feb 202212 Apr 202427 Feb 2026
28fmtc.com.au--7 Feb 2024-
29fmtc.cloudCloudFlare, Inc.17 Dec 202210 Oct 202317 Dec 2025
30fmtc.gamesDNSPod, Inc.3 Jan 20239 Nov 20243 Jan 2026
31fmtc.appGoogle, Inc.20 Jan 20231 Jun 202420 Jan 2025
32fmtc.be-3 Sep 2003--
33fmtc.buzzNamesilo, LLC24 Jun 202228 Jul 202324 Jun 2023
34fmtc.com.br-18 Nov 201928 Nov 202218 Nov 2024
35fmtc.cn????????????10 Nov 2005-10 Nov 2025
36fmtc.nl-11 Aug 20084 Apr 2023-
37fmtc.jp-8 Jul 20211 Aug 202431 Jul 2025
38fmtc.asiaDNSPod, Inc.18 Oct 202317 Nov 202418 Oct 2024
39fmtc.ru-28 May 2024-28 May 2025
40fmtc.fr-8 Feb 20216 Jan 20248 Feb 2025
41fmtc.meInstra Corporation Pty Ltd.22 Jun 202211 Jun 202422 Jun 2025
42fmtc.de--30 Nov 2023-
43fmtc.euRealtime Register B.V.---
44fmtc.in-1 Jul 20221 Jul 20241 Jul 2024
45fmtc.shopRealtime Register B.V.30 Jul 202430 Jul 202430 Jul 2025
46fmtc.web.id-12 May 2020-12 May 2026
47fmtconsultants.comGoDaddy.com, LLC29 Jan 20045 Sep 202229 Jan 2025
48fmtconstructionservicesllc.netTucows Domains Inc.16 Oct 201220 Oct 201416 Oct 2015
49fmtcanada.comAbove.com Pty Ltd.2 Jun 20222 Jun 20222 Jun 2023
50fmtcnc.comHiChina Zhicheng Technology Limited7 Nov 20141 Dec 20217 Nov 2026
51fmtcdb.comUniregistrar Corp---
52fmtchina.comHiChina Zhicheng Technology Limited2 Oct 201427 Sep 20242 Oct 2025
53fmtcyberindustry.comGMO Internet Inc.12 Oct 201423 Mar 201512 Oct 2017
54fmtconstructionservicesllc.comTucows Domains Inc.16 Oct 201220 Oct 201416 Oct 2015
55fmtcpnirfydmgehqhhahytqgdkfyp.org-28 Nov 201412 Jan 202428 Nov 2024
56fmtcg.comGoDaddy.com, LLC16 Mar 202416 Mar 202416 Mar 2029
57fmtcew.xyzGMO Internet Inc.28 Aug 201428 Aug 201428 Aug 2015
58fmtcmeduwtg33.websiteGMO Internet Inc.26 Mar 2015-26 Mar 2016
59fmtcdc.comEranet International Limited30 May 202231 May 202330 May 2023
60fmtccouponpress.comNameCheap, Inc.14 Feb 201514 Oct 202414 Feb 2026
61fmtcclipper.comNameCheap, Inc.14 Feb 201514 Oct 202414 Feb 2026
62fmtcg.net-4 May 20215 May 20214 May 2022
63fmtc-dz.comOnlineNIC, Inc.18 Feb 201518 Feb 201518 Feb 2016
64fmtcr.com-14 Mar 202214 Mar 202214 Mar 2023
65fmtchem.comNamesilo, LLC29 Aug 202029 Aug 202229 Aug 2022
66fmtchina.orgUdomainName.com LLC15 Sep 202329 Oct 202415 Sep 2024
67fmtctogo.comNameCheap, Inc.5 May 20155 Apr 20245 May 2025
68fmtc2go.comNameCheap, Inc.5 May 20155 Apr 20245 May 2025
69fmtconsultores.comArsys Internet, S.L. dba NICLINE.COM8 May 20156 Jul 20178 May 2019
70fmtcastleford.comEranet International Limited4 Mar 20214 Mar 20214 Mar 2022
71fmtclinics.comEpik Inc.9 May 20158 Jun 20249 May 2025
72fmtclinic.comEpik Inc.9 May 20157 Jun 20249 May 2025
73fmtcoord.orgGoDaddy.com, LLC11 May 201511 May 201511 May 2016
74fmtcontracting.comGoDaddy.com, LLC14 Sep 201515 Sep 202414 Sep 2026
75fmtcable.comOnlineNIC, Inc.6 Jul 20158 Jul 20176 Jul 2018
76fmtcw.comEranet International Limited3 Dec 201719 Jan 20243 Dec 2023
77fmtclub.comHiChina Zhicheng Technology Limited29 Sep 201529 Sep 201529 Sep 2016
78fmtcshop.comCSC Corporate Domains, Inc.31 Jul 201527 Jul 202431 Jul 2025
79fmtcs.comGoDaddy.com, LLC19 Sep 200117 Sep 202419 Sep 2029
80fmtcv.comGoDaddy.com, LLC12 Oct 201512 Oct 201512 Oct 2016
81fmtcj.comBizcn.com, Inc.15 Jan 201730 Sep 201715 Jan 2018
82fmtczg.comDynadot3 LLC3 Nov 20243 Nov 20243 Nov 2025
83fmtcenter.comGoDaddy.com, LLC5 Nov 20155 Nov 20155 Nov 2017
84fmtch.comGoDaddy.com, LLC9 Aug 202219 Sep 20239 Aug 2023
85fmtcf.comHiChina Zhicheng Technology Limited7 Nov 201530 Jun 20177 Nov 2017
86fmtcb.comHiChina Zhicheng Technology Limited23 Jan 20171 Oct 201723 Jan 2018
87fmtcm.comNameKing.com Inc.20 Jun 202020 Jun 202020 Jun 2021
88fmtcx.comDomain.com, LLC25 Jan 202210 Jan 202425 Jan 2025
89fmtck.comGoogle, Inc.5 Aug 20234 Aug 20245 Aug 2025
90fmtcater.comTucows Domains Inc.24 Nov 201528 Nov 201624 Nov 2016
91fmtcqsnfxxgpnamaqlfmnozlttg.infoReserved for non-billable transactions where Regis…30 Nov 20151 Dec 201930 Nov 2020
92fmtcp.comXin Net Technology Corporation28 Mar 201723 Apr 201728 Mar 2018
93fmtcd.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED24 Aug 202124 Aug 202124 Aug 2022
94fmtck.winXiamen Nawang Technology Co., Ltd27 Jan 201627 Jan 201626 Jan 2017
95fmtcw.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…14 Feb 201611 Mar 201614 Feb 2017
96fmtcq.comeName Technology Co., Ltd.18 Feb 201618 Feb 201618 Feb 2017
97fmtcl.comHosting Concepts B.V. dba Openprovider31 Dec 202319 Aug 202431 Dec 2024
98fmtct.comAlethia Domains, LLC3 Mar 202317 May 20243 Mar 2024
99fmtcnscc.orgGoDaddy.com, LLC14 Apr 201626 Apr 202314 Apr 2024
100fmtcapsules.comGoDaddy.com, LLC29 Nov 202010 Feb 202429 Nov 2023
101fmtcmsg.comDomain.com, LLC16 May 20161 Apr 202316 May 2028
102fmtchd.comURL Solutions, Inc.17 May 201617 Apr 202417 May 2025
103fmtcourse.comGoDaddy.com, LLC15 Jun 201615 Jun 201615 Jun 2018
104fmtconsulting.gmbhCronon AG22 Jun 20166 Aug 202422 Jun 2025
105fmtcta.xyz-24 Jun 201624 Jun 201624 Jun 2017
106fmtcons-store.bizeNom, Inc.4 Jul 201611 Mar 20173 Jul 2017
107fmtcw.topeName Technology Co., Ltd.16 Feb 201616 Feb 201616 Feb 2017
108fmtconseil.bizOVH sas17 Feb 201212 Apr 201616 Feb 2017
109fmtcoach.comMAFF Inc.19 May 202028 Jul 202419 May 2024
110fmtctest.comTucows Domains Inc.11 Nov 200413 Sep 201811 Nov 2027
111fmtccorp.comGoDaddy.com, LLC31 May 20141 Jun 202431 May 2026
112fmtcmoms.comNamesilo, LLC3 Oct 202021 Aug 20223 Oct 2022
113fmtcontract.comeNom, Inc.31 Jul 20143 Aug 201631 Jul 2016
114fmtcargo.comCloudFlare, Inc.23 Feb 199911 May 202223 Feb 2027
115fmtcabfix.comDomainPeople, Inc.12 Mar 20107 Mar 202412 Mar 2025
116fmtcz.com-24 Apr 202427 Apr 202424 Apr 2025
117fmtcncrouters.comRegister.it SPA29 Oct 201313 Feb 202429 Oct 2026
118fmtcswb.comNetwork Solutions, LLC26 May 20051 May 202426 May 2025
119fmtcompany.comGoDaddy.com, LLC13 Jul 201029 Jun 202413 Jul 2027
120fmtcc.comGoDaddy.com, LLC23 Nov 202124 Nov 202423 Nov 2027
121fmtcn.comHiChina Zhicheng Technology Limited14 Jul 201030 May 202214 Jul 2025
122fmtchinese.comGoDaddy.com, LLC20 Jul 201321 Jul 201620 Jul 2017
123fmtcnet.comNetwork Solutions, LLC6 Jul 19999 Jul 20196 Jul 2028
124fmtc1883.comGoDaddy.com, LLC23 May 201223 May 202423 May 2025
125fmtconsultant.comGoDaddy.com, LLC29 Jul 20096 Sep 202229 Jul 2027
126fmtcuae.comFastDomain Inc.16 Apr 200211 Feb 202416 Apr 2025
127fmtconsulting.comGoDaddy.com, LLC29 Jul 20096 Sep 202229 Jul 2027
128fmtcrew.comTucows Domains Inc.10 Nov 201131 Oct 202410 Nov 2027
129fmtcmarchmania.comeNom, Inc.11 Mar 201322 Apr 201511 Mar 2017
130fmtcctv.comHiChina Zhicheng Technology Limited28 Apr 201429 Apr 202428 Apr 2025
131fmtcons.comBeijing Lanhai Jiye Technology Co., Ltd31 Jan 20238 Nov 202431 Jan 2025
132fmtconstruction.comNameCheap, Inc.26 Jul 202126 Jul 202426 Jul 2025
133fmtcllc.comGoDaddy.com, LLC27 Apr 201227 Apr 202427 Apr 2026
134fmtcproductions.comIn2net Network, Inc.8 Nov 201222 Nov 20168 Nov 2017
135fmtcbowlchallenge.comeNom, Inc.30 Oct 20124 Oct 201730 Oct 2017
136fmtconseil.comOVH sas17 Feb 201216 Feb 201617 Feb 2017
137fmtco.comAbove.com Pty Ltd.22 Nov 200918 Apr 202322 Nov 2024
138fmtcorp.comNetwork Solutions, LLC19 Nov 199623 Oct 202118 Nov 2026
139fmtc88.comHiChina Zhicheng Technology Limited22 May 201427 May 202222 May 2025
140fmtcblue.comNetwork Solutions, LLC25 Mar 200524 Jan 202225 Mar 2027
141fmtclinicba.comregister.com, Inc.10 Jun 20147 Jun 201610 Jun 2017
142fmtcbil.comActive Registrar, Inc.20 May 200829 Nov 201420 May 2018
143fmtcy.comXin Net Technology Corporation26 Sep 201312 Sep 202426 Sep 2025
144fmtcapital.comGoDaddy.com, LLC25 Aug 201615 Oct 202425 Aug 2025
145fmtchurch.orgGoDaddy.com, LLC9 Sep 20169 Sep 20169 Sep 2017
146fmtcetifzgu.infoReserved for non-billable transactions where Regis…22 Dec 200922 Dec 201922 Dec 2020
147fmtconseil.infoOVH sas17 Feb 201217 Feb 201617 Feb 2017
148fmtcw.neteName Technology Co., Ltd.15 Nov 201515 Nov 201515 Nov 2016
149fmtcrew.netTucows Domains Inc.10 Nov 201110 Jun 202410 Nov 2027
150fmtconseil.netOVH sas17 Feb 201216 Feb 201617 Feb 2017
151fmtconsulting.netGoDaddy.com, LLC5 May 201214 Apr 20165 May 2017
152fmtccorp.netGoDaddy.com, LLC31 May 20141 Jun 202431 May 2026
153fmtcpallimukku.orgGoDaddy.com, LLC4 Dec 20071 Sep 20244 Dec 2024
154fmtcmylapore.orgGoDaddy.com, LLC28 Apr 20219 Jun 202328 Apr 2023
155fmtconseil.orgOVH sas17 Feb 201216 Feb 201617 Feb 2017
156fmtc-ev.orgDeutsche Telekom AG13 Sep 200714 Sep 201613 Sep 2017
157fmtczn.xyzPDR Ltd. d/b/a PublicDomainRegistry.com2 Jun 20163 Aug 20162 Jun 2017
158fmtcks.comXin Net Technology Corporation8 Nov 20168 Nov 20168 Nov 2017
159fmtcfhmleivg.clickStichting Registrar of Last Resort Foundation30 Nov 20161 Dec 201730 Nov 2018
160fmtcmma.comGoDaddy.com, LLC7 Dec 20167 Dec 20167 Dec 2018
161fmtcc.loanAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Dec 201619 Dec 201717 Dec 2017
162fmtc-services.comGoDaddy.com, LLC3 Mar 201713 Apr 20233 Mar 2023
163fmtccb.loanAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…23 Mar 201713 Apr 201722 Mar 2018
164fmtccc.loanAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…30 Mar 20179 Apr 201729 Mar 2018
165fmtcruise.comNameCheap, Inc.1 Apr 20172 Mar 20241 Apr 2025
166fmtcyt.loanAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…13 Apr 201724 Oct 201713 Apr 2018
167fmtcmifa.infoWest263 International Limited27 Apr 201726 Jun 201727 Apr 2018
168fmtclubindia.comPDR Ltd. d/b/a PublicDomainRegistry.com17 May 201717 May 201717 May 2018
169fmtcrawlerdrill.comPDR Ltd. d/b/a PublicDomainRegistry.com19 May 201719 Jul 201719 May 2018
170fmtcfdc.comGoogle, Inc.7 Jun 201723 May 20247 Jun 2025
171fmtcake.comXin Net Technology Corporation17 Jul 202317 Jul 202317 Jul 2024
172fmtcmetals.comeNom, Inc.7 Jul 20178 Jun 20247 Jul 2025
173fmtcbnl.comDomain.com, LLC8 Aug 20178 Aug 20178 Aug 2018
174fmtcwll.comTucows Domains Inc.22 Aug 201716 Aug 202422 Aug 2025
175fmtcmkvo.downloadNameCheap, Inc.15 Sep 201715 Sep 201715 Sep 2018
176fmtcons.netPDR Ltd. d/b/a PublicDomainRegistry.com13 Oct 201717 Oct 202413 Oct 2025
177fmtcoin.comBeijing Lanhai Jiye Technology Co., Ltd25 Sep 202227 Oct 202425 Sep 2024
178fmtcjeez.infoHiChina Zhicheng Technology Limited10 Nov 201717 Jan 201810 Nov 2018
179fmtcglobal.comKey-Systems GmbH16 Nov 201716 Nov 201716 Nov 2018
180fmtcsafety.comKey-Systems GmbH16 Nov 201715 Nov 202416 Nov 2025
181fmtcgroup.comGoDaddy.com, LLC1 May 202113 Jul 20231 May 2023
182fmtchina.netHiChina Zhicheng Technology Limited6 Dec 20177 Dec 20176 Dec 2020
183fmtcnaon.infoHiChina Zhicheng Technology Limited26 Dec 201728 Dec 201726 Dec 2018
184fmtcorporation.co.uk-7 Jun 201626 Jun 20247 Jun 2025
185fmtcomputers.co.uk-22 Jun 200522 Jun 201622 Jun 2018
186fmtcare.co.uk-8 May 20157 Apr 20178 May 2018
187fmtchange.comOVH sas23 Jan 201823 Jan 201823 Jan 2019
188fmtcou.loanALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED7 Feb 2018-7 Feb 2019
189fmtcaoz.bizGMO Internet Inc.5 Feb 2018-5 Feb 2019
190fmtconsultent.comBigRock Solutions Ltd.15 Feb 201815 Feb 201815 Feb 2019
191fmtcdr.menNameCheap, Inc.1 Mar 20181 Mar 20181 Mar 2019
192fmtcskw.partyNameCheap, Inc.21 Mar 201821 Mar 201821 Mar 2019
193fmtcmbxh.menAlpnames Limited23 Mar 201823 Mar 201823 Mar 2019
194fmtcg.bizHiChina Zhicheng Technology Limited28 Mar 201810 Apr 201828 Mar 2019
195fmtcnet.onlineNetwork Solutions, LLC26 Jun 202228 Jun 202326 Jun 2024
196fmtcd.bizHiChina Zhicheng Technology Limited17 May 201817 May 201817 May 2019
197fmtcydh.loanALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED26 Jun 2018-26 Jun 2019
198fmtchain.comHosting Concepts B.V. dba Openprovider22 Sep 201922 Sep 201922 Sep 2020
199fmtc4point0.comCV. Rumahweb Indonesia28 Nov 2018-28 Nov 2020
200fmtco.netAmazon Registrar, Inc.5 Dec 201831 Oct 20235 Dec 2024
201fmtc-motoculture.comTucows Domains Inc.18 Dec 201822 Dec 201918 Dec 2019
202fmtcinc.clubNameCheap, Inc.7 Jan 20197 Jan 20197 Jan 2020
203fmtcll.clubNameCheap, Inc.20 Jan 201920 Jan 201920 Jan 2020
204fmtcllc.netGoogle, Inc.18 Jan 201918 Jan 201918 Jan 2020
205fmtcphysicians.comNameCheap, Inc.2 Mar 20191 Feb 20242 Mar 2025
206fmtchemical.comHiChina Zhicheng Technology Limited25 Mar 201925 Mar 201925 Mar 2020
207fmtcncrouter.comGoDaddy.com, LLC15 Apr 201915 Apr 201915 Apr 2020
208fmtconnect.comDynadot, LLC21 Jun 201921 Jun 201921 Jun 2020
209fmtclyf.comChengdu West Dimension Digital Technology Co., Ltd…21 Jul 201921 Jul 201921 Jul 2022
210fmtcsae.comGoDaddy.com, LLC23 Jul 201923 Jul 201923 Jul 2020
211fmtclfy.comDynadot, LLC24 Jul 201924 Jul 201924 Jul 2020
212fmtconnected.comGoDaddy.com, LLC30 Jul 201911 Oct 202330 Jul 2023
213fmtcloud.netAmazon Registrar, Inc.23 Oct 201924 Oct 201923 Oct 2020
214fmtcs-sh.comHiChina Zhicheng Technology Limited30 Oct 201921 Aug 202330 Oct 2026
215fmtcsuae.comGoDaddy.com, LLC5 Nov 20195 Nov 20195 Nov 2020
216fmtcoman.comTucows Domains Inc.22 Nov 201922 Nov 202322 Nov 2024
217fmtconsulting.de--30 Aug 2022-
218fmtcentral.comGoDaddy.com, LLC2 Mar 20203 Mar 20242 Mar 2026
219fmtconsult.comDreamHost, LLC12 Mar 202024 May 202412 Mar 2024
220fmtcloud.comTucows Domains Inc.25 Dec 202325 Dec 202325 Dec 2024
221fmtcc-eg.comAmazon Registrar, Inc.5 Apr 20205 Apr 20245 Apr 2026
222fmtchs.comBeijing Lanhai Jiye Technology Co., Ltd7 Apr 202018 Nov 20247 Apr 2025
223fmtcdb.infoGoDaddy.com, LLC22 Mar 20193 Apr 202022 Mar 2021
224fmtc-safety.comEPAG Domainservices GmbH27 Apr 202027 Apr 202027 Apr 2021
225fmtcs-elearn.comPDR Ltd. d/b/a PublicDomainRegistry.com14 May 202012 Apr 202414 May 2027
226fmtconsultancy.comFenominal, Inc.10 Jun 202010 Jun 202010 Jun 2021
227fmtc66.comBeijing Lanhai Jiye Technology Co., Ltd11 Sep 202113 Oct 202411 Sep 2024
228fmtc888.comWest263 International Limited26 Jun 202026 Jun 202026 Jun 2021
229fmtcfmtc.comGoDaddy.com, LLC27 Jun 202028 Jun 202427 Jun 2025
230fmtchannel.comGoDaddy.com, LLC4 Jul 20204 Jul 20204 Jul 2021
231fmtcgulf.comTucows Domains Inc.12 Jul 202028 Jun 202412 Jul 2025
232fmtcolorado.comGoogle, Inc.24 Aug 20209 Aug 202424 Aug 2025
233fmtcty.icuAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Jan 202018 Feb 20207 Jan 2021
234fmtcfhmleivg.bidStichting Registrar of Last Resort Foundation30 Nov 20163 Dec 201929 Nov 2024
235fmtcysuzda.clubNameCheap, Inc.20 Sep 2020-20 Sep 2021
236fmtclp.comHiChina Zhicheng Technology Limited24 Sep 202025 Sep 202024 Sep 2021
237fmtcqatar.comGoDaddy.com, LLC26 Sep 202026 Sep 202026 Sep 2021
238fmtcacademy.comGoogle, Inc.23 Oct 202023 Oct 202023 Oct 2021
239fmtcapsule.comGoDaddy.com, LLC29 Nov 202010 Feb 202429 Nov 2023
240fmtcotx.comGoDaddy.com, LLC28 Jan 202128 Jan 202428 Jan 2025
241fmtcompanyinc.comGoDaddy.com, LLC28 Jan 20212 Nov 202228 Jan 2025
242fmtcm.ca-18 Jun 201918 Aug 201918 Jun 2021
243fmtckr.comNameCheap, Inc.16 Mar 2021-16 Mar 2022
244fmtcac.comDynadot, LLC27 Apr 202127 Jan 202427 Apr 2025
245fmtclt.comGoDaddy.com, LLC20 May 202121 May 202420 May 2025
246fmtcaruso.comOVH sas13 Jul 202114 Jul 202413 Jul 2025
247fmtc67ocar.comGoDaddy.com, LLC26 Jul 202126 Jul 202126 Jul 2022
248fmtcoaching.com1&1 Internet AG4 Aug 20214 Aug 20214 Aug 2025
249fmtchiro.comGoDaddy.com, LLC15 Sep 202116 Sep 202415 Sep 2025
250fmtckykfj.com1&1 Internet AG2 Dec 20212 Dec 20212 Dec 2022
251fmtckykfj02.sitePorkbun, LLC21 Dec 202124 Jan 202221 Dec 2022
252fmtci.com-6 May 20238 Jul 20246 May 2024
253fmtcwc-161w.bizGMO Internet Inc.23 Feb 202225 Mar 202323 Feb 2023
254fmtcx.xyzNamesilo, LLC22 Mar 202229 Apr 202222 Mar 2024
255fmtconsultsllc.comGoogle, Inc.25 Apr 202225 Apr 202225 Apr 2023
256fmtcek-upes.comFastDomain Inc.4 May 20224 May 20224 May 2023
257fmtcei.comGoogle, Inc.15 Jun 202215 Jul 202415 Jun 2024
258fmtcservices.comWeb Commerce Communications Limited dba WebNic.cc18 Jun 202218 Jun 202218 Jun 2023
259fmtc-crm.xyzCV. Jogjacamp14 Jul 202219 Jul 202214 Jul 2024
260fmtcdn.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…13 May 202016 Jul 202213 May 2023
261fmtcryptotrade.netNameCheap, Inc.30 Jul 202111 Oct 202330 Jul 2023
262fmtcah2.xyzPorkbun, LLC25 Aug 20224 Sep 202325 Aug 2024
263fmtclinic.co.uk-29 Aug 20226 Aug 202329 Aug 2023
264fmtcqhse.teamOne.com A/S15 Oct 202220 Sep 202415 Oct 2025
265fmtcservice.comNameCheap, Inc.21 Oct 20222 Jan 202421 Oct 2023
266fmtcapitalslimited.comNameCheap, Inc.27 Oct 20228 Jan 202427 Oct 2023
267fmtcia.comCloudFlare, Inc.30 Oct 202230 Sep 202430 Oct 2025
268fmtc-ia.comCloudFlare, Inc.30 Oct 202230 Sep 202430 Oct 2025
269fmtcb.onlineNameCheap, Inc.14 Nov 202215 Nov 202314 Nov 2024
270fmtcaruso.it-13 Jul 202129 Jul 202413 Jul 2025
271fmtcmylapore.comGoDaddy.com, LLC4 Dec 202114 Feb 20244 Dec 2028
272fmtcketojmpo.cyouGMO Internet Inc.5 Dec 20226 Dec 20235 Dec 2024
273fmtcl.cn-3 Apr 2020-3 Apr 2028
274fmtch.bizNameCheap, Inc.26 Dec 202210 Jan 202426 Dec 2023
275fmtclimited.comNameCheap, Inc.5 Jan 202318 Mar 20245 Jan 2024
276fmtcxh.bar-26 Oct 202210 Dec 202326 Oct 2023
277fmtclobnuplgrr.comTucows Domains Inc.31 Jan 202312 Mar 202431 Jan 2024
278fmtcfaber.nl-14 Nov 201231 Jan 2024-
279fmtcamp.comCloudFlare, Inc.10 Feb 202311 Jan 202410 Feb 2025
280fmtcoaching.co.uk-4 Aug 20213 Aug 20244 Aug 2025
281fmtconsultoria.com.br-16 Jun 20204 Jun 202416 Jun 2026
282fmtcpic.comNetwork Solutions, LLC5 Jul 20225 Jul 20225 Jul 2027
283fmtcal.comGoDaddy.com, LLC26 Jun 20177 Aug 202326 Jun 2023
284fmtcstaging.nl-6 May 20204 Apr 2023-
285fmtconstruct.be-4 May 2017--
286fmtcorp.co.th-6 Jan 201624 Aug 20235 Jan 2027
287fmtctech.comNameCheap, Inc.24 Jul 202424 Jul 202424 Jul 2025
288fmtcaskcompany.comGoDaddy.com, LLC23 Feb 202311 Nov 202423 Feb 2025
289fmtcaskcompany.co.uk-23 Feb 202323 Feb 202323 Feb 2025
290fmtcoiy.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Mar 202313 Apr 20246 Mar 2024
291fmtcjdbs.xyzBeijing Lanhai Jiye Technology Co., Ltd13 Mar 202314 May 202413 Mar 2024
292fmtcode.comGMO Internet Inc.31 May 202311 Jul 202431 May 2024
293fmtchile.cl-11 Aug 2022-11 Aug 2026
294fmtcnl.cfdGMO Internet Inc.14 Apr 202323 Apr 202414 Apr 2025
295fmtcxx.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Apr 201922 Apr 201922 Apr 2025
296fmtcolemps.topNamesilo, LLC18 May 202321 Jun 202418 May 2024
297fmtcapital.co.uk-5 Jun 20223 Sep 20245 Jun 2025
298fmtcon.comWild West Domains, LLC25 May 20236 Jul 202425 May 2024
299fmtcxygc.cfdGMO Internet Inc.2 Jun 202313 Jul 20242 Jun 2024
300fmtcship.ae----
301fmtce.comHostinger, UAB6 Jun 20234 May 20246 Jun 2025
302fmtcc.topNamesilo, LLC20 Oct 202220 Oct 202320 Oct 2024
303fmtcopy.comHostinger, UAB7 Jul 202316 Sep 20247 Jul 2024
304fmtcs.websiteHostinger, UAB9 Jul 202314 Sep 20249 Jul 2024
305fmtck.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…17 Jul 202312 Aug 202417 Jul 2025
306fmtcolloc.storeeNom, Inc.28 Jul 20239 Oct 202428 Jul 2024
307fmtcolloc.comRegister.it SPA28 Jul 202329 Sep 202428 Jul 2024
308fmtco.orgGoDaddy.com, LLC3 Sep 202315 Oct 20243 Sep 2024
309fmtcw.icuALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED24 Sep 20232 Nov 202424 Sep 2024
310fmtcd3v.lat-1 Oct 202312 Nov 20241 Oct 2024
311fmtcvd.comCommuniGal Communication Ltd.10 Oct 202311 Oct 202410 Oct 2025
312fmtcommerce.comGoDaddy.com, LLC23 Nov 202324 Nov 202423 Nov 2025
313fmtc582.comDynadot, LLC7 Dec 202327 Dec 20237 Dec 2024
314fmtccq.usPDR Ltd. d/b/a PublicDomainRegistry.com18 Jun 202318 Jun 202418 Jun 2024
315fmtcsms.comNameCheap, Inc.30 Jan 202430 Jan 202430 Jan 2025
316fmtcreatives.co.uk-8 Mar 20248 Mar 20248 Mar 2025
317fmtcpallimukku.comGoDaddy.com, LLC18 Mar 202418 Mar 202418 Mar 2025
318fmtcs.shopHostinger, UAB21 Apr 202410 Jun 202421 Apr 2025
319fmtclc.lolGMO Internet Inc.24 Apr 202429 Apr 202424 Apr 2025
320fmtcmnt.comNameCheap, Inc.27 Apr 202427 Apr 202427 Apr 2025
321fmtcuaw.comDNSPod, Inc.18 May 20241 Jul 202418 May 2025
322fmtcoaching.de--5 Apr 2022-
323fmtcon.de--16 Oct 2018-
324fmtcnc.hu-29 Dec 2023--
325fmtcollective.comSquarespace Domains LLC3 Jun 20243 Jun 20243 Jun 2025
326fmtcaldeiraria.com.br-17 Aug 202116 Oct 202417 Aug 2025
327fmtcleaning.comGoogle, Inc.11 Jun 202411 Jun 202411 Jun 2025
328fmtces.comName.com, Inc.15 Jul 202415 Jul 202415 Jul 2025
329fmtcooler.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Jul 202419 Jul 202419 Jul 2027
330fmtclinics.orgNameCheap, Inc.24 Jul 202429 Jul 202424 Jul 2025
331fmtc7.usNamesilo, LLC28 Jul 20242 Aug 202428 Jul 2025
332fmtciggs.sbsGMO Internet Inc.8 Aug 202413 Aug 20248 Aug 2025
333fmtcfreight.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Aug 202420 Oct 202419 Aug 2025
334fmtchiropractic.comGoDaddy.com, LLC19 Aug 202419 Aug 202419 Aug 2025
335fmtc-crm.my.id-6 Jul 2023-6 Jul 2025
336fmtcn.cn-19 Sep 2024-19 Sep 2025
337fmtcapital.com.br-22 Sep 202422 Sep 202422 Sep 2025
338fmtcsb.de--31 Jul 2024-
339fmtcapitalfund.comNamesilo, LLC5 Oct 20245 Oct 20245 Oct 2025
340fmtcrm.comHostinger, UAB28 Oct 202428 Oct 202428 Oct 2025
341fmtcbip.cn-12 Sep 2024-12 Sep 2025
342fmtclinic.ca-21 Oct 20245 Nov 202421 Oct 2025
343fmtcapitallcc.comHosting Concepts B.V. dba Openprovider14 Nov 202414 Nov 202414 Nov 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=fmtc

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now