Our database now contains whois records of 613 Million (613,121,573) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [613 Million Domains] $10,000 Details

Keyword: FULLSIZE

Reverse Whois » KEYWORD [fullsize ]  { 577 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1fullsize.infoCronon AG29 Mar 202313 Nov 202429 Mar 2025
2fullsize.oneOne.com A/S20 Feb 201614 Feb 201720 Feb 2018
3fullsize.topPDR Ltd. d/b/a PublicDomainRegistry.com5 Mar 20165 Mar 20165 Mar 2017
4fullsize.clubNameCheap, Inc.30 Mar 201630 Mar 201629 Mar 2017
5fullsize.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Mar 20247 Mar 20256 Mar 2026
6fullsize.lifeGoDaddy.com, LLC25 Jul 20165 Sep 201725 Jul 2017
7fullsize.comGoDaddy.com, LLC23 Apr 199624 Apr 202524 Apr 2026
8fullsize.solutionsEuroDNS S.A.6 Oct 20166 Oct 20246 Oct 2025
9fullsize.neteNom, Inc.14 May 200110 Jul 202414 May 2025
10fullsize.orgNameKing.com Inc.19 Dec 20233 Mar 202519 Dec 2024
11fullsize.ch----
12fullsize.dk-25 Jul 2007-31 Jul 2022
13fullsize.fr-17 Apr 20083 Feb 2016-
14fullsize.co.uk-16 Jan 201819 Mar 202516 Jan 2026
15fullsize.runDynadot, LLC24 Sep 20203 Nov 202324 Sep 2023
16fullsize.onlineDNSPod, Inc.3 Apr 20247 Apr 20253 Apr 2026
17fullsize.storeBeget LLC29 Oct 202229 Oct 202229 Oct 2023
18fullsize.be-7 Jun 2016--
19fullsize.com.br-1 Mar 202011 Feb 20251 Mar 2026
20fullsize.io-29 Jun 202213 Aug 202429 Jun 2025
21fullsize.it-20 Jan 201025 Feb 20259 Feb 2026
22fullsize.liveNameCheap, Inc.22 Jul 202223 Jul 202322 Jul 2024
23fullsize.salePDR Ltd. d/b/a PublicDomainRegistry.com29 Oct 202229 Oct 202329 Oct 2024
24fullsize.eventsCloudFlare, Inc.13 Feb 202419 Jan 202513 Feb 2026
25fullsize.jp-4 Feb 20141 Mar 202528 Feb 2026
26fullsize.nl-1 May 201229 Jun 2024-
27fullsize.se-7 Dec 202313 Oct 20247 Dec 2025
28fullsize.coAbove.com Pty Ltd.19 May 20247 Dec 202419 May 2025
29fullsizechevy.comregister.com, Inc.5 Dec 200021 Apr 20245 Dec 2028
30fullsizebronco.comUniregistrar Corp28 Aug 200128 Aug 202428 Aug 2025
31fullsizeimages.comDynadot, LLC31 Aug 20168 Mar 201731 Aug 2017
32fullsizefashion.comeNom, Inc.24 Apr 201222 Apr 202424 Apr 2025
33fullsizemodels.comeNom, Inc.25 Jul 201127 Jul 202425 Jul 2025
34fullsizerefrigerator.comeNom, Inc.20 Apr 201011 May 201720 Apr 2018
35fullsizesuvs.comDynadot, LLC26 Jan 202031 Dec 202426 Jan 2026
36fullsizefutonmattress.comGoDaddy.com, LLC4 Jul 20095 Jul 20154 Jul 2016
37fullsizecomforterset.comGoDaddy.com, LLC3 Apr 202412 Mar 20253 Apr 2026
38fullsizedaybeds.comGo France Domains, LLC1 Jan 201026 Apr 20151 Jan 2016
39fullsizejeep.comRealtime Register B.V.28 Oct 199929 Sep 202428 Oct 2025
40fullsizewashers.comFabulous.com Pty Ltd.29 Jun 201130 Jun 201529 Jun 2016
41fullsizemovies.comEvoPlus Ltd.27 Jun 200730 May 202427 Jun 2025
42fullsizecars.netBigRock Solutions Ltd.21 May 201419 May 201721 May 2018
43fullsizeliving.comDomain Registration Services, Inc. dba dotEarth.co…20 Aug 201420 Aug 201420 Aug 2016
44fullsizemattresssale.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
45fullsizebeddimensions.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Feb 201727 Apr 201725 Feb 2018
46fullsizecot.comeNom, Inc.31 Aug 20142 Aug 201731 Aug 2018
47fullsizehental.comGoName.com, Inc.9 Sep 20148 Oct 20149 Sep 2015
48fullsizecatalog.comNetwork Solutions, LLC1 Oct 20142 Aug 20241 Oct 2025
49fullsizeamerican.comGoDaddy.com, LLC10 May 201710 May 201710 May 2018
50fullsizestyles.comWild West Domains, LLC30 Dec 201430 Dec 201430 Dec 2015
51fullsizeseason.comNetwork Solutions, LLC7 Jan 20157 Jan 20157 Jan 2016
52fullsize-golf.oneOne.com A/S3 Jun 20153 Jun 20173 Jun 2017
53fullsizemegazoom.topGandi SAS7 Aug 20157 Aug 20157 Aug 2016
54fullsizeheadboards.orgeNom, Inc.18 Aug 201518 Aug 201518 Aug 2016
55fullsizejeepparts.comGoDaddy.com, LLC22 Jan 201518 Mar 202522 Jan 2026
56fullsizejeeplife.comGoDaddy.com, LLC22 Jan 201518 Mar 202522 Jan 2026
57fullsizejeepjunky.comGoDaddy.com, LLC22 Jan 201518 Mar 202522 Jan 2026
58fullsizeplans.orgPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 20159 Mar 202526 Jan 2025
59fullsizeplans.netPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 20159 Mar 202526 Jan 2025
60fullsizeplans.infoPDR Ltd. d/b/a PublicDomainRegistry.com26 Jan 20159 Mar 202526 Jan 2025
61fullsizetires.netBigRock Solutions Ltd.2 Feb 20152 Feb 20152 Feb 2016
62fullsizetablet.comPearlNamingService.com LLC5 Feb 20155 Feb 20155 Feb 2016
63fullsizerender.comGoDaddy.com, LLC20 Mar 201920 Mar 201920 Mar 2020
64fullsizepooltable.comGoDaddy.com, LLC27 Apr 201927 Apr 201927 Apr 2020
65fullsizebeddingset.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2017
66fullsizeoriginal.comMesh Digital Limited11 Mar 20159 Feb 202511 Mar 2026
67fullsizechryslers.com----
68fullsizebedset.comGoDaddy.com, LLC3 Apr 20153 Apr 20153 Apr 2016
69fullsizestock.comTucows Domains Inc.5 Apr 20155 Apr 20155 Apr 2017
70fullsizemattresses.comGoDaddy.com, LLC23 Oct 202322 Jan 202523 Oct 2025
71fullsizememoryfoampillow.comGoDaddy.com, LLC28 Apr 201528 Apr 201528 Apr 2017
72fullsizeloftbeds.netBigRock Solutions Ltd.13 May 201513 May 201513 May 2016
73fullsize-incasso.comCronon AG18 May 201518 May 201518 May 2016
74fullsizewear.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
75fullsizetops.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
76fullsizetop.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
77fullsizeskirts.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
78fullsizeskirt.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
79fullsizeshoes.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
80fullsizeshoe.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
81fullsizeshapewear.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
82fullsizepants.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
83fullsizelingerie.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
84fullsizejeans.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
85fullsizejean.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
86fullsizejackets.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
87fullsizejacket.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
88fullsizegear.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
89fullsizefootwear.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
90fullsizedresses.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
91fullsizedress.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
92fullsizeclothing.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
93fullsizeclothes.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
94fullsizeblouses.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
95fullsizeblouse.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
96fullsizebelts.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
97fullsizebelt.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
98fullsizeapparel.comCSC Corporate Domains, Inc.21 May 201517 May 202321 May 2025
99fullsizesuits.comCSC Corporate Domains, Inc.22 May 201519 May 202323 May 2025
100fullsizesuit.comCSC Corporate Domains, Inc.22 May 201519 May 202323 May 2025
101fullsizesportsbras.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
102fullsizesportsbra.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
103fullsizesportbras.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
104fullsizesportbra.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
105fullsizepanty.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
106fullsizepanties.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
107fullsizebrands.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
108fullsizebrand.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
109fullsizebra.comCSC Corporate Domains, Inc.22 May 201518 May 202322 May 2025
110fullsizebottoms.comCSC Corporate Domains, Inc.22 May 201519 May 202323 May 2025
111fullsizebottom.comCSC Corporate Domains, Inc.22 May 201519 May 202323 May 2025
112fullsizewomensclothing.comCSC Corporate Domains, Inc.23 May 201520 May 202324 May 2025
113fullsizewomensapparel.comCSC Corporate Domains, Inc.23 May 201520 May 202324 May 2025
114fullsizemensclothing.comCSC Corporate Domains, Inc.24 May 201520 May 202324 May 2025
115fullsizemensapparel.comCSC Corporate Domains, Inc.23 May 201520 May 202324 May 2025
116fullsizewomenswear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
117fullsizewomensbrands.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
118fullsizewomensbrand.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
119fullsizetees.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
120fullsizetee.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
121fullsizeswimwear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
122fullsizesleepwear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
123fullsizesleepshirts.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
124fullsizesleepshirt.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
125fullsizeresortwear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
126fullsizepajamas.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
127fullsizemenswear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
128fullsizemensbrands.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
129fullsizemensbrand.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
130fullsizeleisurewear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
131fullsizeleggings.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
132fullsizelegging.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
133fullsizehoodies.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
134fullsizehoodie.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
135fullsizegloves.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
136fullsizeglove.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
137fullsizeformalwear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
138fullsizecoats.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
139fullsizecoat.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
140fullsizeactivewear.comCSC Corporate Domains, Inc.25 May 201521 May 202325 May 2025
141fullsizeinterior.comAscio Technologies, Inc. Danmark - Filial af Ascio…10 Jun 201510 Jun 201510 Jun 2016
142fullsizebedframe.netName.com, Inc.9 Jun 20159 Jun 20159 Jun 2016
143fullsizeboxspring.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
144fullsizephones.comGoDaddy.com, LLC23 Sep 201523 Sep 201523 Sep 2016
145fullsizetunics.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
146fullsizetunic.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
147fullsizetrends.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
148fullsizetrend.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
149fullsizestyle.comNamesilo, LLC21 Feb 202521 Feb 202521 Feb 2026
150fullsizesales.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
151fullsizesale.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
152fullsizeflannels.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
153fullsizeflannel.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
154fullsizedesigner.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
155fullsizecardigans.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
156fullsizecardigan.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
157fullsizecapripants.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
158fullsizecapri.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
159fullsizeboots.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
160fullsizeboot.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
161fullsizearrivals.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
162fullsizearrival.comMoniker Online Services LLC24 Sep 201513 Sep 201624 Sep 2017
163fullsizeallalloyvickersspitfireaircraftkits.comGoDaddy.com, LLC10 Jul 201510 Jul 201510 Jul 2017
164fullsizedisplays.comGoDaddy.com, LLC18 Jul 201519 Jul 202318 Jul 2025
165fullsizevr.comGoDaddy.com, LLC28 Sep 201529 Sep 202328 Sep 2025
166fullsizesweaters.comCSC Corporate Domains, Inc.29 Jul 201526 Jul 202330 Jul 2025
167fullsizesweater.comCSC Corporate Domains, Inc.29 Jul 201526 Jul 202330 Jul 2025
168fullsizefitness.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Aug 20154 Aug 202410 Aug 2025
169fullsizeicon.comGoDaddy.com, LLC16 Oct 201516 Oct 201516 Oct 2017
170fullsizemattress.netNameCheap, Inc.4 Sep 20244 Sep 20244 Sep 2025
171fullsizesleepersofa.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
172fullsizegrocerycartliner.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Nov 201520 Mar 201717 Nov 2017
173fullsizebedroomsets.netTLD Registrar Solutions Ltd.23 Nov 201523 Nov 201523 Nov 2016
174fullsizemattressset.xyzNameCheap, Inc.24 Nov 201510 Dec 201624 Nov 2017
175fullsizemattresssale.xyzNameCheap, Inc.24 Nov 20152 Dec 201624 Nov 2017
176fullsizeride.comDynadot, LLC23 Mar 202523 Mar 202523 Mar 2026
177fullsizeduvetcovers.xyzNameCheap, Inc.2 Dec 20155 Jan 20162 Dec 2017
178fullsizebroncos.comNameCheap, Inc.26 Mar 202427 Mar 202526 Mar 2026
179fullsizedfella.comWebfusion Ltd.26 Dec 201527 Jan 201726 Dec 2017
180fullsize2.comDomainsareforever.net LLC21 Mar 201722 Mar 201721 Mar 2018
181fullsizeloftbed.infoAlpnames Limited31 Dec 201531 Dec 201531 Dec 2016
182fullsizemattressset.websiteGoDaddy.com, LLC2 Feb 20162 Feb 20162 Feb 2017
183fullsizemattressset.onlineGoDaddy.com, LLC2 Feb 20162 Feb 20162 Feb 2017
184fullsizemattressset.infoGoDaddy.com, LLC2 Feb 2016-2 Feb 2017
185fullsizemattressset.orgGoDaddy.com, LLC2 Feb 20162 Feb 20162 Feb 2017
186fullsize-ao.com----
187fullsizecomfortersets.orgGoDaddy.com, LLC17 Feb 201617 Feb 201617 Feb 2017
188fullsizemattress.reviewNameCheap, Inc.14 Mar 201614 Mar 201613 Mar 2017
189fullsizefashions.comDynadot, LLC25 Mar 201625 Mar 202525 Mar 2026
190fullsizeplatformbed.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
191fullsizeswimsuits.comMoniker Online Services LLC6 Apr 20166 Apr 20176 Apr 2018
192fullsizeswimsuit.comMoniker Online Services LLC6 Apr 20166 Apr 20176 Apr 2018
193fullsizebathingsuits.comMoniker Online Services LLC6 Apr 20167 Apr 20176 Apr 2018
194fullsizebathingsuit.comMoniker Online Services LLC6 Apr 20167 Apr 20176 Apr 2018
195fullsizetrucks.net----
196fullsizeguitar.comShanghai Meicheng Technology Information Co., Ltd15 Apr 201620 Apr 201615 Apr 2026
197fullsizesexdoll.comNamesilo, LLC14 Sep 202318 Nov 202414 Sep 2024
198fullsizemotorcyclekits.orgGoDaddy.com, LLC26 Apr 201627 Apr 201726 Apr 2018
199fullsizemotorcyclekits.netGoDaddy.com, LLC26 Apr 201626 Apr 201626 Apr 2017
200fullsizemotorcyclekits.infoGoDaddy.com, LLC26 Apr 201627 Apr 201726 Apr 2018
201fullsizemotorcyclekits.comGoDaddy.com, LLC26 Apr 201626 Apr 201626 Apr 2017
202fullsizexjgear.comNamepanther.com LLC10 Oct 201911 Oct 201910 Oct 2020
203fullsizesheets.comEuroDNS S.A.21 May 201615 May 202420 May 2025
204fullsizeheadboarddimensions.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
205fullsizecandybarwrappertemplate.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
206fullsizebeds.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
207fullsizeairbeds.comTierraNet Inc. d/b/a DomainDiscover12 Jul 20118 Jun 201612 Jul 2017
208fullsizehealthchildsizecare.comMarkMonitor Inc.23 Jun 201622 May 202423 Jun 2026
209fullsizerefrigerators.comGoDaddy.com, LLC7 Jul 20168 Jul 20247 Jul 2025
210fullsizewoman.bizNameCheap, Inc.21 Nov 201122 Jul 201720 Nov 2018
211fullsizeman.bizNameCheap, Inc.21 Nov 201122 Jul 201720 Nov 2018
212fullsizemattressset.net-6 Aug 20166 Aug 20166 Aug 2017
213fullsizesound.comGoDaddy.com, LLC23 Aug 201623 Aug 202423 Aug 2026
214fullsizechevyparts.comNetwork Solutions, LLC1 Apr 200131 Jan 20251 Apr 2027
215fullsizeelectricclearance.comGoDaddy.com, LLC2 Feb 201021 Apr 20152 Feb 2017
216fullsizemusic.comDomain.com, LLC1 May 201316 Apr 20161 May 2017
217fullsizepickups.comGoDaddy.com, LLC3 Jul 200113 Jun 20243 Jul 2025
218fullsizeprint.comOne.com A/S4 Jan 20205 Dec 20244 Jan 2026
219fullsizetruckscene.comNameCheap, Inc.27 Dec 201328 Dec 202427 Dec 2025
220fullsizerentals.comGoDaddy.com, LLC15 Oct 201315 Oct 202415 Oct 2025
221fullsizecablepark.comGoDaddy.com, LLC30 Nov 20121 Dec 201530 Nov 2016
222fullsizepaper.comCloudFlare, Inc.7 Aug 20138 Jul 20247 Aug 2025
223fullsizecarclearance.comGoDaddy.com, LLC2 Feb 201013 Jan 20152 Feb 2017
224fullsizefashionista.comGoDaddy.com, LLC31 Mar 201731 Mar 201731 Mar 2022
225fullsizetruckclassifieds.comGoDaddy.com, LLC27 Sep 200728 Sep 201527 Sep 2016
226fullsizeposters.comGoDaddy.com, LLC4 Mar 20075 Mar 20254 Mar 2026
227fullsizeheadboards.comDropCatch.com 1044 LLC15 Oct 201616 Oct 201715 Oct 2018
228fullsizeviolin.comGoDaddy.com, LLC11 Nov 20099 Nov 201511 Nov 2016
229fullsizekids.comGoDaddy.com, LLC12 Apr 201417 Apr 202512 Apr 2026
230fullsizedsedan.comGoDaddy.com, LLC6 Aug 20067 Aug 20246 Aug 2025
231fullsizepontiacs.comNetwork Solutions, LLC15 Mar 200417 Mar 202515 Mar 2026
232fullsizetruckclearance.comHongkong Domain Name Information Management Co., L…25 Apr 202125 Apr 202125 Apr 2022
233fullsizeprints.comGoDaddy.com, LLC4 Mar 20075 Mar 20254 Mar 2026
234fullsizeelectricbuying101.comGoDaddy.com, LLC2 Feb 201013 Jan 20152 Feb 2017
235fullsizevideos.comEvoPlus Ltd.27 Jun 200730 May 202427 Jun 2025
236fullsizemattressetprices.comGoDaddy.com, LLC20 Sep 200921 Sep 202420 Sep 2025
237fullsizejeeps.com-17 Dec 202412 Jan 202517 Dec 2025
238fullsizebras.comGoDaddy.com, LLC13 Sep 200230 Jul 202413 Sep 2024
239fullsizebeds.comTurnCommerce, Inc. DBA NameBright.com9 Jul 20038 Jul 20229 Jul 2025
240fullsizemattressprices.comGoDaddy.com, LLC20 Sep 200921 Sep 202420 Sep 2025
241fullsizeford.comWild West Domains, LLC7 Aug 200328 Feb 202527 Feb 2026
242fullsizebeauty.comGoDaddy.com, LLC3 Aug 20203 Aug 20203 Aug 2021
243fullsizewaterbed.comeNom, Inc.5 Jan 20107 Dec 20165 Jan 2018
244fullsizetreesdirect.com1&1 Internet AG4 Jun 20145 Jun 20164 Jun 2018
245fullsizefordclub.comCronon AG26 Nov 200415 Jan 202526 Nov 2025
246fullsizedbronco.comGoDaddy.com, LLC26 May 200627 May 202426 May 2025
247fullsizewomen.comFabulous.com Pty Ltd.18 Dec 20011 Sep 202418 Dec 2025
248fullsizeset.comMoniker Online Services LLC18 Jul 200716 Jul 202418 Jul 2025
249fullsizeoutlet.comGoDaddy.com, LLC23 Jun 199924 Jun 202423 Jun 2025
250fullsizesportsballs.comGoDaddy.com, LLC14 Apr 20112 Jan 20256 Jan 2026
251fullsizetrucks.comUniregistrar Corp24 Jun 200029 May 202424 Jun 2025
252fullsizedbeds.comGoDaddy.com, LLC26 Jan 20066 Jan 202526 Jan 2026
253fullsizehybridbuying101.comGoDaddy.com, LLC2 Feb 201013 Jan 20152 Feb 2017
254fullsizedposters.comGoDaddy.com, LLC4 Mar 20075 Mar 20164 Mar 2017
255fullsizeairmattress.comGoDaddy.com, LLC16 Jan 202524 Jan 202516 Jan 2026
256fullsizeextralongsheets.comXiamen ChinaSource Internet Service Co., Ltd.21 Apr 202121 Apr 202121 Apr 2022
257fullsizepickup.comGoDaddy.com, LLC14 Jan 200725 Dec 202414 Jan 2026
258fullsizegeneticsreview.comLaunchpad, Inc.14 Jul 201420 Aug 201614 Jul 2016
259fullsizesingles.comGoDaddy.com, LLC5 Mar 20046 Mar 20255 Mar 2026
260fullsizebed.comTurnCommerce, Inc. DBA NameBright.com9 Jul 20039 Jul 20229 Jul 2025
261fullsizevanrental.comDNC Holdings, Inc.18 Jun 20054 May 202418 Jun 2025
262fullsizeplatformbeds.comGoDaddy.com, LLC16 Dec 200721 Dec 201516 Dec 2016
263fullsizeladies.comGoDaddy.com, LLC26 Dec 201227 Dec 201526 Dec 2016
264fullsizesedans.comGoDaddy.com, LLC16 Dec 200727 Nov 202416 Dec 2025
265fullsizecar.comGoDaddy.com, LLC1 Jun 19999 Feb 20251 Jun 2028
266fullsizecomfortersets.comGoDaddy.com, LLC16 Dec 200727 Nov 202416 Dec 2025
267fullsizecomforter.comGoDaddy.com, LLC13 Apr 202225 May 202413 Apr 2024
268fullsizesets.comMoniker Online Services LLC18 Jul 200716 Jul 202418 Jul 2025
269fullsizemattressreview.comGoDaddy.com, LLC20 Sep 200921 Sep 202420 Sep 2025
270fullsizetruckbuying101.comGoDaddy.com, LLC2 Feb 201021 Apr 20152 Feb 2017
271fullsizerental.comGoDaddy.com, LLC15 Oct 201315 Oct 202415 Oct 2025
272fullsizeimage.comMoniker Online Services LLC5 May 200711 May 20165 May 2017
273fullsizemattress.comTurnCommerce, Inc. DBA NameBright.com20 Jul 20048 Jul 202220 Jul 2025
274fullsizeposter.comGoDaddy.com, LLC4 Mar 20075 Mar 20254 Mar 2026
275fullsizevanrentals.comCSC Corporate Domains, Inc.23 Sep 200526 Aug 202423 Sep 2025
276fullsizegaming.com1&1 Internet AG24 Jan 201125 Jan 201724 Jan 2018
277fullsizepapers.comCloudFlare, Inc.7 Aug 20138 Jul 20247 Aug 2025
278fullsizebanner.com-23 Mar 202526 Mar 202523 Mar 2026
279fullsizerun.comNetwork Solutions, LLC18 Nov 200918 Nov 202318 Nov 2033
280fullsizemgf.comCronon AG27 Jan 201527 Jan 20154 Feb 2017
281fullsizefords.comGoDaddy.com, LLC14 Sep 200615 Sep 202414 Sep 2025
282fullsizehentai.comTucows Domains Inc.8 Dec 200618 Jan 20258 Dec 2024
283fullsizebedding.comGoDaddy.com, LLC8 Apr 202212 Mar 20258 Apr 2026
284fullsizedesign.comRegistryGate GmbH28 Jan 20105 Mar 202528 Jan 2026
285fullsizeusedauto.comGoDaddy.com, LLC28 Feb 20145 May 201528 Feb 2017
286fullsizeheadphones.comGoDaddy.com, LLC23 Jan 201220 Oct 201523 Jan 2017
287fullsizekeyboards.comGoDaddy.com, LLC23 Oct 20083 Oct 202423 Oct 2025
288fullsizepillowtopmattress.comGoDaddy.com, LLC5 Nov 20086 Nov 20245 Nov 2025
289fullsizemattresspillowtop.comGoDaddy.com, LLC13 Jan 200814 Jan 202513 Jan 2026
290fullsizemattresssets.comeNom, Inc.24 Aug 200524 Jun 201624 Aug 2018
291fullsizemattressdimensions.comGoDaddy.com, LLC28 Sep 200718 Aug 201628 Sep 2017
292fullsizedisguise.comGoDaddy.com, LLC24 Mar 200625 Mar 202524 Mar 2026
293fullsizedposter.comGoDaddy.com, LLC4 Mar 20075 Mar 20164 Mar 2017
294fullsizechevytruck.comGoDaddy.com, LLC7 Dec 20108 Dec 20157 Dec 2016
295fullsizediscountmattress.comGoDaddy.com, LLC1 Jan 20082 Jan 20251 Jan 2026
296fullsizefuton.comTurnCommerce, Inc. DBA NameBright.com9 Apr 201310 Apr 20179 Apr 2018
297fullsizechevytruckforum.comGoDaddy.com, LLC7 Dec 20108 Dec 20157 Dec 2016
298fullsizetruck.comGoDaddy.com, LLC24 Jun 20004 Jun 202424 Jun 2025
299fullsizespare.comNameCheap, Inc.16 Feb 202317 Jan 202516 Feb 2026
300fullsizemedia.comKey-Systems GmbH30 Mar 200629 Mar 202530 Mar 2027
301fullsized-rock.comRegistryGate GmbH6 Jan 201310 Feb 20256 Jan 2026
302fullsizetrundlebed.comGoDaddy.com, LLC16 Jan 202524 Jan 202516 Jan 2026
303fullsizebedframes.comDNC Holdings, Inc.9 Nov 200625 Sep 20249 Nov 2025
304fullsizecars.comGoDaddy.com, LLC1 Jun 19999 Feb 20251 Jun 2028
305fullsizemattressprice.comGoDaddy.com, LLC20 Sep 200921 Sep 202420 Sep 2025
306fullsizewallgraphics.comWild West Domains, LLC25 Sep 201326 Sep 202425 Sep 2025
307fullsizes.comDynadot, LLC12 May 200224 Apr 202412 May 2025
308fullsizeloftbeds.comDropCatch.com 1345 LLC27 Jan 201728 Jan 201727 Jan 2018
309fullsizesuvclearance.comGoDaddy.com, LLC2 Feb 201021 Apr 20152 Feb 2017
310fullsizewoman.comNameCheap, Inc.21 Nov 201122 Oct 202421 Nov 2025
311fullsizevan.comDNC Holdings, Inc.23 Jun 20059 May 202423 Jun 2025
312fullsizeairbed.comeNom, Inc.8 Jan 201010 Dec 20168 Jan 2018
313fullsizecello.comGoDaddy.com, LLC8 Dec 20099 Dec 20158 Dec 2016
314fullsizewakeboardcable.comGoDaddy.com, LLC6 Dec 20127 Dec 20146 Dec 2016
315fullsizebedsheets.comeNom, Inc.7 Jan 20109 Dec 20167 Jan 2018
316fullsizekeyboard.comeNom, Inc.7 Jan 20132 Jan 20157 Jan 2018
317fullsizeloftbed.comGoDaddy.com, LLC27 Jan 20236 Apr 202527 Jan 2026
318fullsizeplans.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Feb 200618 Feb 202528 Feb 2027
319fullsizebedroomsets.comGoDaddy.com, LLC16 Jan 202524 Jan 202516 Jan 2026
320fullsizecutouts.comGoDaddy.com, LLC11 Aug 200712 Sep 201623 Sep 2017
321fullsizemattressreviews.comGoDaddy.com, LLC20 Sep 200921 Sep 202420 Sep 2025
322fullsizedbed.comGoDaddy.com, LLC26 Jan 20066 Jan 202526 Jan 2026
323fullsizevans.comTurnCommerce, Inc. DBA NameBright.com9 Mar 200428 Feb 20229 Mar 2025
324fullsizefootballhelmetdisplaycase.comMarkMonitor Inc.10 Oct 20128 Sep 202410 Oct 2025
325fullsizepiece.comGoDaddy.com, LLC11 Apr 201212 Apr 202411 Apr 2026
326fullsizedodges.comGoDaddy.com, LLC21 Nov 200622 Nov 202421 Nov 2025
327fullsizeheadboard.comFabulous.com Pty Ltd.20 Jan 200521 Jan 201620 Jan 2017
328fullsizekits.comGMO Internet Inc.5 Nov 201828 Oct 20245 Nov 2025
329fullsizehybridclearance.comHongkong Domain Name Information Management Co., L…25 Apr 202125 Apr 202125 Apr 2022
330fullsizeinvasion.comGoDaddy.com, LLC7 Mar 201430 Jan 20247 Mar 2027
331fullsizepickuptruck.comDynadot, LLC29 Jul 201330 Jul 201629 Jul 2016
332fullsizegirls.comJiangsu Bangning Science and technology Co. Ltd.30 Jul 20222 Oct 202330 Jul 2023
333fullsizearcadegames.comNamesilo, LLC9 Oct 202018 Mar 20259 Oct 2025
334fullsizebedframe.comGoDaddy.com, LLC14 Aug 200915 Aug 202414 Aug 2025
335fullsizegm.comGoDaddy.com, LLC20 Jan 202221 Jan 202520 Jan 2026
336fullsizemattressset.comGoDaddy.com, LLC27 Aug 20057 Aug 202427 Aug 2025
337fullsizelife.comGoDaddy.com, LLC22 Oct 202313 Oct 202422 Oct 2025
338fullsizetv.comNetwork Solutions, LLC5 Dec 20095 Mar 20175 Dec 2019
339fullsizedaybed.comGoDaddy.com, LLC22 Apr 202412 May 202422 Apr 2025
340fullsizes4x4.comMagnate Domains, LLC16 Feb 201727 Feb 201716 Feb 2018
341fullsizesuv.comNameBrew LLC19 Feb 20136 Mar 202119 Feb 2026
342fullsizebedrails.comBeijing Lanhai Jiye Technology Co., Ltd6 Oct 20207 Oct 20236 Oct 2024
343fullsizedmattress.comDynadot, LLC27 Apr 20198 Jul 202427 Apr 2024
344fullsizecarbuying101.comHongkong Domain Name Information Management Co., L…25 Apr 202125 Apr 202125 Apr 2022
345fullsizebunkbeds.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
346fullsizewallpaper.comGoDaddy.com, LLC18 Dec 201128 Nov 202418 Dec 2025
347fullsizesuvbuying101.comGoDaddy.com, LLC2 Feb 201013 Jan 20152 Feb 2017
348fullsize4x4.comGoDaddy.com, LLC23 Sep 199822 Sep 202422 Sep 2025
349fullsizetx.comGMO Internet Inc.2 Dec 20213 Dec 20212 Dec 2022
350fullsized.comDynadot, LLC25 Dec 199925 Nov 202425 Dec 2025
351fullsizemen.comDNC Holdings, Inc.26 Feb 201426 Feb 201626 Feb 2017
352fullsizeman.comNameCheap, Inc.21 Nov 201122 Oct 202421 Nov 2025
353fullsizesleeper.comTierraNet Inc. d/b/a DomainDiscover23 May 20042 Jul 202423 May 2024
354fullsizesleepersofas.comGoDaddy.com, LLC9 Nov 200721 Oct 20249 Nov 2025
355fullsizebedmeasurements.com-20 Sep 201620 Sep 201620 Sep 2017
356fullsizespare.netLaunchpad, Inc.1 Oct 201630 Sep 20171 Oct 2018
357fullsizeloftbed.us-5 Oct 20165 Oct 20164 Oct 2017
358fullsizereducer.comeNom, Inc.10 Oct 201622 Nov 201710 Oct 2017
359fullsize-mirrorles.infoGMO Internet Inc.25 Oct 201330 Sep 202425 Oct 2025
360fullsizegaming.info1&1 Internet AG24 Jan 201125 Aug 201724 Jan 2018
361fullsizeloftbed.netWeb Commerce Communications Limited dba WebNic.cc20 May 202230 Jul 202320 May 2023
362fullsizetreesdirect.net1&1 Internet AG4 Jun 201427 Nov 20174 Jun 2018
363fullsizeman.netNameCheap, Inc.21 Nov 201122 Oct 202421 Nov 2025
364fullsizechevy.netGoDaddy.com, LLC4 Jul 20094 Jul 20164 Jul 2017
365fullsizewoman.netNameCheap, Inc.21 Nov 201122 Oct 202421 Nov 2025
366fullsizesuvrental.neteNom, Inc.7 May 20102 May 20177 May 2018
367fullsizevanrentals.netNameCheap, Inc.12 Jul 201011 Jan 201812 Jul 2018
368fullsizegaming.net1&1 Internet AG24 Jan 201127 Nov 201724 Jan 2018
369fullsizemattressdimensions.netGMO Internet Inc.22 Dec 201626 Dec 201621 Dec 2017
370fullsizememoryfoammattress.org1&1 Internet AG6 May 20117 May 20176 May 2018
371fullsizebunkbeds.org1&1 Internet AG11 Nov 200926 Dec 202411 Nov 2025
372fullsizebeds.orgGoDaddy.com, LLC7 Dec 20098 Dec 20167 Dec 2017
373fullsizegaming.org1&1 Internet AG24 Jan 20119 Oct 201724 Jan 2018
374fullsizememoryfoammattress.xyzNameCheap, Inc.3 Jun 201629 Jun 20163 Jun 2017
375fullsizebed.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
376fullsizebedroomfurniture.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
377fullsizebedheadboarddimensions.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
378fullsizebeddingdecor.xyzNameCheap, Inc.14 Sep 201522 Sep 201614 Sep 2017
379fullsizemattressreviews.xyzNameCheap, Inc.18 Sep 201527 Sep 201618 Sep 2017
380fullsizemattress.xyzNameCheap, Inc.19 Sep 201527 Sep 201619 Sep 2017
381fullsizebedsets.xyzNameCheap, Inc.14 Sep 201522 Sep 201614 Sep 2017
382fullsizebunkbedwithdesk.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
383fullsizebunkbedsforadults.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
384fullsizebedding.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
385fullsizebedroomfurnituresets.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
386fullsizebeddimensions.xyzNameCheap, Inc.19 Sep 201527 Sep 201619 Sep 2017
387fullsizejeep.dk-28 Jan 2004-31 Jan 2026
388fullsizeheaven.de--10 Nov 2017-
389fullsizebeddimension.comWild Bunch Domains, LLC7 Feb 20188 Feb 20187 Feb 2019
390fullsizechevi.comeNom, Inc.19 Dec 201619 Dec 201619 Dec 2017
391fullsizebroco.comGoDaddy.com, LLC9 Jan 20179 Jan 20179 Jan 2018
392fullsizesedan.comGoDaddy.com, LLC8 Feb 202321 Mar 20248 Feb 2024
393fullsizedaybed.spaceNameCheap, Inc.23 Jan 201731 Jan 201723 Jan 2018
394fullsizexperience.comGoDaddy.com, LLC14 Mar 201715 Mar 202514 Mar 2026
395fullsizesamples.comGoDaddy.com, LLC10 Feb 202210 Feb 202410 Feb 2026
396fullsizemattressdepot.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Mar 201715 May 201715 Mar 2018
397fullsizesuv.linkUniregistrar Corp16 Mar 201721 Mar 201716 Mar 2018
398fullsizecherokees.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201718 May 201718 Mar 2018
399fullsizecherokee.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201718 May 201718 Mar 2018
400fullsizebed.infoNameCheap, Inc.3 Apr 20173 Jun 20173 Apr 2018
401fullsizegarage.com1&1 Internet AG19 Apr 201719 Apr 201719 Apr 2018
402fullsizes.infoGoDaddy.com, LLC12 May 201712 May 201712 May 2018
403fullsizeoverland.comGoDaddy.com, LLC1 Jun 201712 Jul 20241 Jun 2024
404fullsizebueaty.comGoDaddy.com, LLC7 Jun 20177 Jun 20177 Jun 2018
405fullsizedmattresses.linkUniregistrar Corp13 Jun 201718 Jun 201713 Jun 2018
406fullsizesuv.clickUniregistrar Corp20 Jul 201720 Jul 201720 Jul 2018
407fullsizerunn.comNameCheap, Inc.11 Aug 201711 Aug 201711 Aug 2018
408fullsizebreasts.comNameCheap, Inc.17 Aug 201717 Aug 201717 Aug 2018
409fullsizebedsets.infoNamesilo, LLC22 Aug 201722 Aug 201822 Aug 2018
410fullsizebed.reviewNameCheap, Inc.26 Aug 201726 Aug 201726 Aug 2018
411fullsizereplica.comPSI-USA, Inc. dba Domain Robot3 Sep 20173 Sep 20173 Sep 2018
412fullsize-replica.comPSI-USA, Inc. dba Domain Robot3 Sep 20173 Sep 20173 Sep 2018
413fullsizetoday.comNamePal.com #80126 Jan 20207 Jan 20206 Jan 2021
414fullsizesexdoll.storeAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Nov 201710 Nov 201710 Nov 2018
415fullsizecarouselhorses.comDomain.com, LLC22 Dec 201722 Dec 201722 Dec 2018
416fullsizepooltable.co.uk-5 Oct 201311 Oct 20215 Oct 2023
417fullsizepooltables.co.uk-5 Oct 201311 Oct 20215 Oct 2023
418fullsizesnookertable.co.uk-22 Jan 200929 Feb 201622 Jan 2019
419fullsizesnookertables.co.uk-22 Jan 200929 Feb 201622 Jan 2019
420fullsizedesign.co.uk-24 Jun 200228 May 202124 Jun 2025
421fullsizepooltables.uk-21 Aug 201727 Oct 201921 Aug 2020
422fullsizedfella.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Dec 201521 Dec 201716 Dec 2017
423fullsizepooltable.uk-21 Aug 201727 Oct 201921 Aug 2020
424fullsizemedia.co.uk-30 Mar 200624 Mar 201530 Mar 2018
425fullsizeairhockeytable.comNameCheap, Inc.17 Jan 201817 Jan 201817 Jan 2019
426fullsizerigs.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Feb 20189 Feb 20189 Feb 2019
427fullsizejeepsforsale.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Mar 201818 Mar 201818 Mar 2019
428fullsizerun.co.uk-19 Mar 201819 Mar 201819 Mar 2019
429fullsizecampers.comunited-domains AG18 Apr 201814 Dec 202418 Apr 2025
430fullsizecampers.co.uk-19 Apr 201818 Apr 202419 Apr 2025
431fullsizeoverlandoutfitters.comTucows Domains Inc.18 May 20183 May 202418 May 2025
432fullsizerestoration.comGoDaddy.com, LLC20 Jul 201821 Jul 202420 Jul 2025
433fullsizepontiacs.netNetwork Solutions, LLC21 Jul 201822 Jul 201821 Jul 2019
434fullsizechevyparts.netNetwork Solutions, LLC1 Aug 20182 Aug 20181 Aug 2019
435fullsizechevrolet.comNamesilo, LLC8 Aug 201821 Mar 20258 Aug 2025
436fullsizeplan.comDiaMatrix C.C.14 Feb 202012 Feb 202514 Feb 2026
437fullsizebronco.netGoDaddy.com, LLC1 Oct 20181 Oct 20181 Oct 2019
438fullsizerunau.comTucows Domains Inc.14 Jan 201918 Jan 202014 Jan 2020
439fullsizerunnj.comWild West Domains, LLC13 Mar 201913 Mar 201913 Mar 2020
440fullsizebranco.comUniregistrar Corp19 Jun 201920 Jun 202419 Jun 2025
441fullsizeadventure.comGoDaddy.com, LLC6 Jul 20196 Jul 20196 Jul 2020
442fullsizeexpeditions.comGoDaddy.com, LLC6 Jul 20196 Jul 20196 Jul 2020
443fullsize-overland.comGoDaddy.com, LLC6 Jul 20196 Jul 20196 Jul 2020
444fullsizeboards.comNameCheap, Inc.16 Jul 20199 Jul 202416 Jul 2025
445fullsizedrone.comGoDaddy.com, LLC27 Jul 201927 Jul 201927 Jul 2020
446fullsizedonkey.comGoogle, Inc.13 Nov 201913 Nov 201913 Nov 2020
447fullsizefloorplan.comGoDaddy.com, LLC12 Nov 201912 Nov 201912 Nov 2020
448fullsizefloorplans.comGoDaddy.com, LLC11 Jul 20247 Nov 202411 Jul 2027
449fullsizeart.comOne.com A/S4 Jan 20205 Dec 20244 Jan 2026
450fullsizemakeupbox.clubNameCheap, Inc.21 Feb 202021 Feb 202021 Feb 2021
451fullsizetiger.com1API GmbH6 Mar 20206 Mar 20206 Mar 2021
452fullsizepicstop.clubDynadot, LLC17 Jul 202117 Jul 202117 Jul 2022
453fullsizesstore.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Apr 202013 Apr 202013 Apr 2021
454fullsizefurniture.comGoDaddy.com, LLC15 Apr 202015 Apr 202015 Apr 2022
455fullsizeriviera.comTucows Domains Inc.21 May 202025 May 202121 May 2021
456fullsizesuvs.icuWest263 International Limited29 Jan 20203 Feb 202029 Jan 2021
457fullsizetruckstrade.infoGoDaddy.com, LLC27 Jan 202028 Mar 202027 Jan 2021
458fullsizetrucksobtains.infoGoDaddy.com, LLC9 Apr 20208 Jun 20209 Apr 2021
459fullsizetrucktrade.infoGoDaddy.com, LLC27 Jan 202028 Mar 202027 Jan 2021
460fullsizetruckexplorer.infoGoDaddy.com, LLC24 Mar 202024 May 202024 Mar 2021
461fullsizekeyboard.infoNamesilo, LLC13 Sep 202013 Sep 202013 Sep 2021
462fullsizeoverlanding.comGoogle, Inc.23 Sep 20208 Sep 202423 Sep 2025
463fullsizeoverlandbuild.comGoDaddy.com, LLC7 Oct 20207 Oct 20207 Oct 2021
464fullsizewatch.comMat Bao Trading & Service Company Limited d/b/a Ma…7 Nov 20207 Nov 20207 Nov 2021
465fullsizej.comGoDaddy.com, LLC16 Nov 202027 Jan 202516 Nov 2024
466fullsizejay.comGoDaddy.com, LLC16 Nov 202027 Jan 202516 Nov 2024
467fullsizesuvforsaledeals.website1API GmbH17 Nov 202017 Nov 202017 Nov 2021
468fullsizesuvsdeals.website1API GmbH17 Nov 202017 Nov 202017 Nov 2021
469fullsizepickups.siteDOTSERVE INC.11 Dec 20201 Jan 202511 Dec 2025
470fullsizepickuptrucks.siteDOTSERVE INC.11 Dec 20201 Dec 202411 Dec 2025
471fullsizemattress.onlineGoDaddy.com, LLC18 Dec 202019 Dec 202018 Dec 2021
472fullsizetrucksvehiclesinfohome.siteGoDaddy.com, LLC10 Feb 202110 Feb 202110 Feb 2022
473fullsize-management.comCronon AG15 Feb 202116 Feb 202515 Feb 2026
474fullsizeev.comBeijing Lanhai Jiye Technology Co., Ltd17 Jun 202318 Jun 202417 Jun 2025
475fullsizeevs.comGoDaddy.com, LLC10 Mar 202110 Mar 202110 Mar 2022
476fullsizemidget.comGoDaddy.com, LLC13 Mar 202113 Mar 202513 Mar 2027
477fullsizelove.comNameCheap, Inc.23 May 20234 Aug 202423 May 2024
478fullsizefun.comunited-domains AG25 Sep 202321 Jul 202425 Sep 2025
479fullsizerun.siteNetwork Solutions, LLC19 Mar 202119 Mar 202119 Mar 2022
480fullsizechevy.onlineregister.com, Inc.20 Apr 202120 Apr 202120 Apr 2022
481fullsizedsuv-guide.siteDOTSERVE INC.11 Oct 20211 Oct 202411 Oct 2025
482fullsizetoddler.comDreamHost, LLC2 Nov 20212 Oct 20242 Nov 2025
483fullsizeindustries.comCronon AG11 Nov 202131 Dec 202411 Nov 2025
484fullsizefootballhelmets.comeNom, Inc.18 Dec 20212 Mar 202518 Dec 2024
485fullsizerun.storeDomain.com, LLC20 Jan 202225 Apr 202420 Jan 2027
486fullsizebronco.de--15 Sep 2022-
487fullsizeslipper.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Feb 20223 Feb 20223 Feb 2023
488fullsizeinstagram.comDynadot, LLC3 Mar 202213 May 20233 Mar 2023
489fullsizechevy.partsNetwork Solutions, LLC21 Apr 202225 Feb 202521 Apr 2026
490fullsizeadventurers.comNameCheap, Inc.1 Jun 20222 May 20241 Jun 2025
491fullsizesheetsets.comeNom, Inc.6 Jun 202219 Jul 20236 Jun 2023
492fullsizebed.netDynadot, LLC18 Jun 202228 Aug 202318 Jun 2023
493fullsizebronco.coNameKing.com Inc.10 Jul 202215 Jul 202310 Jul 2023
494fullsizeoffroad.comGoDaddy.com, LLC20 Jul 202221 Jul 202420 Jul 2025
495fullsizemascara.siteDOTSERVE INC.23 Aug 20221 Aug 202423 Aug 2025
496fullsizedpickuptrucks.siteDOTSERVE INC.1 Sep 20227 Nov 20231 Sep 2023
497fullsizeluxurysuv.siteDOTSERVE INC.22 Sep 202222 Sep 202222 Sep 2023
498fullsize-tradeclub.storeRealtime Register B.V.24 Sep 2022-24 Sep 2023
499fullsize-tradeclub.comRealtime Register B.V.24 Sep 20226 Dec 202324 Sep 2023
500fullsizeclassic.comHostinger, UAB29 Sep 20222 Sep 202429 Sep 2025
501fullsizepickuptruck.siteDOTSERVE INC.10 Oct 202210 Oct 202210 Oct 2023
502fullsizeleglamp.comGoogle, Inc.23 Oct 202224 Oct 202323 Oct 2024
503fullsizesedaninfo.siteDOTSERVE INC.1 Nov 20221 Nov 20221 Nov 2023
504fullsizesedan.siteDOTSERVE INC.2 Nov 20221 Dec 20242 Nov 2025
505fullsizeclothing.co.uk-2 Nov 202216 Aug 20242 Nov 2024
506fullsizedoll.comNameCheap, Inc.2 Nov 20223 Dec 20242 Nov 2025
507fullsizesuv-guide.siteDOTSERVE INC.8 Nov 20228 Nov 20228 Nov 2023
508fullsizecars.siteDOTSERVE INC.17 Nov 20221 Nov 202417 Nov 2025
509fullsizesuvprices.siteDOTSERVE INC.17 Nov 20221 Nov 202417 Nov 2025
510fullsizesuvinfo-guide.siteDOTSERVE INC.22 Nov 20221 Nov 202422 Nov 2025
511fullsizefoldingbikes.comNameCheap, Inc.28 Nov 20229 Feb 202428 Nov 2023
512fullsizefoldingbike.comNameCheap, Inc.28 Nov 20228 Jul 202428 Nov 2026
513fullsizesuv.siteDOTSERVE INC.15 Dec 20221 Jan 202515 Dec 2025
514fullsizebeef.comGoDaddy.com, LLC19 Dec 202220 Dec 202419 Dec 2026
515fullsizepickupprice.spaceDOTSERVE INC.12 Jan 202319 Mar 202412 Jan 2024
516fullsizepickuptrucks.spaceDOTSERVE INC.12 Jan 202319 Mar 202412 Jan 2024
517fullsizepickuptruckprices.spaceDOTSERVE INC.13 Jan 202320 Mar 202413 Jan 2024
518fullsizepickuptruck-guide.siteDOTSERVE INC.24 Jan 20231 Jan 202524 Jan 2026
519fullsizedspare.comNameCheap, Inc.16 Feb 202317 Jan 202516 Feb 2026
520fullsize-suvinfo.siteDOTSERVE INC.24 Feb 20231 Mar 202524 Feb 2026
521fullsizepickuptruck-us.siteDOTSERVE INC.6 Mar 20237 Mar 20256 Mar 2026
522fullsizesausage.comGoDaddy.com, LLC26 May 202127 May 202426 May 2025
523fullsizeluxurysuvs.siteDOTSERVE INC.18 Apr 202319 Apr 202418 Apr 2025
524fullsizeaudio.nl-29 Aug 20194 Oct 2022-
525fullsizerender.movPorkbun, LLC20 May 202324 May 202420 May 2025
526fullsizebox.onlineHostinger, UAB6 Jun 202313 Jul 20246 Jun 2024
527fullsizetoys.comGoDaddy.com, LLC19 Jun 202319 Jun 202319 Jun 2028
528fullsizebinoculars.comName.com, Inc.24 Jun 20236 Sep 202424 Jun 2024
529fullsizedoutdoors.comGoogle, Inc.26 Jun 202311 Jun 202426 Jun 2025
530fullsizedoverland.comGoogle, Inc.26 Jun 202311 Jun 202426 Jun 2025
531fullsizedoffroad.comGoogle, Inc.26 Jun 202311 Jun 202426 Jun 2025
532fullsizesamplebeautybox.siteDOTSERVE INC.14 Jul 20231 Jul 202414 Jul 2025
533fullsizertools.netHostinger, UAB19 Jul 202329 Aug 202419 Jul 2024
534fullsizebagcom.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Aug 20239 Oct 202428 Aug 2024
535fullsizefun.onlineunited-domains AG25 Sep 202313 Oct 202425 Sep 2024
536fullsizedigital.comHostinger, UAB19 Oct 20231 Jan 202519 Oct 2024
537fullsize-tech.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Nov 202326 Sep 20247 Nov 2025
538fullsize-mattressprice.shopDNSPod, Inc.27 Feb 20243 Jan 202527 Feb 2025
539fullsizestroller.comBeijing Lanhai Jiye Technology Co., Ltd2 Mar 20242 Mar 20252 Mar 2026
540fullsizefabrication.comDynadot, LLC2 Mar 20243 Mar 20252 Mar 2026
541fullsizemail.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Mar 202420 Mar 202519 Mar 2026
542fullsizecanvas.comAmazon Registrar, Inc.11 Apr 202412 Apr 202511 Apr 2025
543fullsizebedandframe.comGoDaddy.com, LLC19 Apr 202412 May 202419 Apr 2025
544fullsizegroms.comGoDaddy.com, LLC28 Apr 202413 Jan 202528 Apr 2025
545fullsizehasbulla.xyzNameCheap, Inc.30 Apr 20247 May 202430 Apr 2025
546fullsizecologne.de--10 Dec 2024-
547fullsized.de--31 May 2023-
548fullsizeonly.comGoDaddy.com, LLC9 Jul 20249 Jul 20249 Jul 2025
549fullsize4x4outfitters.comCloudFlare, Inc.25 Jul 20241 Aug 202425 Jul 2025
550fullsizeoffroadoutfitters.comCloudFlare, Inc.25 Jul 20241 Aug 202425 Jul 2025
551fullsizeslotmachineforhome.com-31 Jul 202431 Jul 202431 Jul 2025
552fullsizebedframes.shop-6 Aug 202419 Sep 20246 Aug 2025
553fullsizerun.inGoDaddy.com, LLC3 Jul 202315 Jul 20243 Jul 2025
554fullsizecarprices.siteDOTSERVE INC.18 Sep 20241 Oct 202418 Sep 2025
555fullsizerundrop.comTucows Domains Inc.4 Oct 20244 Oct 20244 Oct 2025
556fullsizesexdolls.comNameCheap, Inc.9 Dec 20249 Dec 20249 Dec 2025
557fullsizedspares.comNameCheap, Inc.31 Dec 202431 Dec 202431 Dec 2025
558fullsizefriday.comGoDaddy.com, LLC2 Jan 20252 Jan 20252 Jan 2028
559fullsizebedmattress.comGoDaddy.com, LLC16 Jan 202524 Jan 202516 Jan 2026
560fullsizejeepgarage.comGoDaddy.com, LLC25 Jan 202525 Jan 202525 Jan 2026
561fullsizebedsforsale.comGoDaddy.com, LLC30 Jan 202530 Jan 202530 Jan 2026
562fullsizemattressandboxspring.comGoDaddy.com, LLC24 Feb 202524 Feb 202524 Feb 2026
563fullsizemattresswithboxspring.comGoDaddy.com, LLC24 Feb 202524 Feb 202524 Feb 2026
564fullsizebedboxspring.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
565fullsizebedwithfullsizetrundle.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
566fullsizebedandtrundle.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
567fullsizebedwithfulltrundle.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
568fullsizebedwithstorage.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
569fullsizebedwithtrundlebed.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
570fullsizebumpbeds.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
571fullsizemurphybed.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
572fullsizesleepercouch.comGoDaddy.com, LLC28 Feb 202528 Feb 202528 Feb 2026
573fullsizerundrop.fr1API GmbH6 Sep 202411 Sep 20246 Sep 2025
574fullsizerides.comDynadot, LLC23 Mar 202523 Mar 202523 Mar 2026
575fullsizesystem.comGoogle, Inc.26 Mar 202526 Mar 202526 Mar 2026
576fullsizerunfoundation.orgGoDaddy.com, LLC7 Apr 20257 Apr 20257 Apr 2026
577fullsizerun.eu----

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=fullsize

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now