Our database now contains whois records of 592 Million (592,649,088) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [592 Million Domains] $10,000 Details

Keyword: HACKENSACKMERIDIANHEALTH

Reverse Whois » KEYWORD [hackensackmeridianhealth ]  { 31 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1hackensackmeridianhealth.comNetwork Solutions, LLC12 Sep 201414 Jul 202412 Sep 2029
2hackensackmeridianhealth.orgGoDaddy.com, LLC9 Oct 201423 Nov 20249 Oct 2025
3hackensackmeridianhealth.infoGoDaddy.com, LLC9 Oct 201416 Nov 20169 Oct 2018
4hackensackmeridianhealth.netGoDaddy.com, LLC9 Oct 201410 Oct 20249 Oct 2025
5hackensackmeridianhealth.careGoDaddy.com, LLC7 Jul 202221 Aug 20247 Jul 2025
6hackensackmeridianhealth.icuGoogle, Inc.29 Sep 202231 Aug 202329 Sep 2024
7hackensackmeridianhealth.xyzNameCheap, Inc.22 Oct 20236 Nov 202422 Oct 2025
8hackensackmeridianhealthnetwork.comNetwork Solutions, LLC22 Apr 201622 Feb 202422 Apr 2026
9hackensackmeridianhealthcardio.comTucows Domains Inc.20 Oct 201624 Oct 202120 Oct 2021
10hackensackmeridianhealthpartners.orgNetwork Solutions, LLC11 Nov 201617 Sep 202411 Nov 2025
11hackensackmeridianhealthathome.comNetwork Solutions, LLC24 May 201725 Mar 202424 May 2025
12hackensackmeridianhealthmedicalgroup.comNetwork Solutions, LLC26 Jul 201727 May 202426 Jul 2025
13hackensackmeridianhealthmedicalgroup.orgNetwork Solutions, LLC26 Jul 20171 Jun 202426 Jul 2025
14hackensackmeridianhealthvillage.comNetwork Solutions, LLC21 Aug 201722 Jun 202421 Aug 2025
15hackensackmeridianhealththeatre.comNetwork Solutions, LLC19 Jul 201819 May 202319 Jul 2028
16hackensackmeridianhealththeater.comNetwork Solutions, LLC19 Jul 201819 May 202319 Jul 2028
17hackensackmeridianhealththeatre.netNetwork Solutions, LLC19 Jul 201819 May 202319 Jul 2028
18hackensackmeridianhealthkids.comWild West Domains, LLC5 Mar 20196 Mar 20245 Mar 2025
19hackensackmeridianhealthmychart.comEpik Inc.20 Feb 202020 Feb 202020 Feb 2021
20hackensackmeridianhealthurgentcare.comGoDaddy.com, LLC10 Oct 201711 Oct 202410 Oct 2025
21hackensackmeridianhealthpiscataway.comGoDaddy.com, LLC1 Dec 20201 Dec 20201 Dec 2021
22hackensackmeridianhealthcare.comDomain.com, LLC4 Apr 20237 Apr 20244 Apr 2025
23hackensackmeridianhealthsystem.comGoDaddy.com, LLC18 Feb 202118 Feb 202118 Feb 2022
24hackensackmeridianhealthnj.orgGoDaddy.com, LLC22 Apr 202218 Aug 202422 Apr 2025
25hackensackmeridianhealthemployportal.com-14 Apr 20247 Dec 202414 Apr 2025
26hackensackmeridianhealththeater.netNetwork Solutions, LLC19 Jul 201819 May 202319 Jul 2028
27hackensackmeridianhealththeater.orgNetwork Solutions, LLC19 Jul 201824 May 202319 Jul 2028
28hackensackmeridianhealththeatre.orgNetwork Solutions, LLC19 Jul 201824 May 202319 Jul 2028
29hackensackmeridianhealthkids.orgWild West Domains, LLC5 Mar 201912 Jun 20245 Mar 2025
30hackensackmeridianhealths.comGoDaddy.com, LLC29 Dec 202319 Jun 202429 Dec 2025
31hackensackmeridianhealthmgtcareer.orgNamesilo, LLC20 Aug 20246 Dec 202420 Aug 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=hackensackmeridianhealth

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now