Our database now contains whois records of 605 Million (605,196,137) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [605 Million Domains] $10,000 Details

Keyword: HISTORICGREEN

Reverse Whois » KEYWORD [historicgreen ]  { 54 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1historicgreen.comTurnCommerce, Inc. DBA NameBright.com18 Jun 201312 Jun 202018 Jun 2025
2historicgreen.orgDropCatch.com 1319 LLC29 Dec 202210 Mar 202529 Dec 2024
3historicgreen.netGoDaddy.com, LLC29 Sep 202330 Sep 202429 Sep 2025
4historicgreenacres.comNameCheap, Inc.8 Mar 20244 Nov 20248 Mar 2025
5historicgreentour.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
6historicgreentours.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
7historicgreensburg.comGoDaddy.com, LLC13 Mar 201514 Mar 202413 Mar 2025
8historicgreensprings.orgTucows Domains Inc.17 Mar 201527 Nov 202217 Mar 2028
9historicgreensburgapartments.comWild West Domains, LLC25 Jun 201525 Jun 201525 Jun 2016
10historicgreenportvillage.comGoDaddy.com, LLC25 Nov 201525 Nov 201525 Nov 2016
11historicgreenmanor.comTucows Domains Inc.21 Aug 201225 Aug 201621 Aug 2016
12historicgreenslopes.comKey-Systems GmbH2 Oct 200831 Jan 20252 Oct 2025
13historicgreensprings.comeNom, Inc.22 Apr 201123 Mar 201722 Apr 2018
14historicgreenwich.comGoDaddy.com, LLC22 Oct 20209 Nov 202422 Oct 2025
15historicgreenvillage.comNameCheap, Inc.23 Nov 201222 Nov 202423 Nov 2025
16historicgreenville.comNameCheap, Inc.15 Feb 20045 Feb 202515 Feb 2026
17historicgreenback.comGoDaddy.com, LLC6 Mar 201212 Mar 20156 Mar 2017
18historicgreenwoodcemetery.comDomaininfo AB, aka domaininfo.com5 Feb 200931 Jan 20255 Feb 2026
19historicgreenbrierfarms.comNetwork Solutions, LLC27 Dec 20124 Jun 202427 Dec 2025
20historicgreenhouses.comWild West Domains, LLC18 Apr 201019 Apr 202418 Apr 2025
21historicgreenwood.comGoDaddy.com, LLC4 Aug 20035 Aug 20244 Aug 2025
22historicgreenspring.comGoDaddy.com, LLC1 Mar 20211 Mar 20211 Mar 2022
23historicgreenspringsinlouisa.comeNom, Inc.22 Apr 201123 Mar 201722 Apr 2018
24historicgreenroom.com-12 Sep 201612 Sep 201612 Sep 2018
25historicgreenwichnj.orgFastDomain Inc.17 Jan 201112 Jan 202517 Jan 2027
26historicgreenwoodcemetery.orgDomaininfo AB, aka domaininfo.com5 Feb 20095 Feb 20255 Feb 2026
27historicgreenspring.orgTierraNet Inc. d/b/a DomainDiscover15 Mar 20047 Feb 202315 Mar 2027
28historicgreenfieldma.orgTucows Domains Inc.9 Dec 201623 Jan 20259 Dec 2025
29historicgreenwoodchamberofcommerce.comregister.com, Inc.6 Apr 20176 Apr 20176 Apr 2018
30historicgreendale.comLaunchpad, Inc.1 May 201816 Apr 20241 May 2025
31historicgreenwoodsc.comGoDaddy.com, LLC17 Aug 201817 Aug 201817 Aug 2020
32historicgreenwichvillage.comNameCheap, Inc.18 Apr 201918 Apr 201918 Apr 2020
33historicgreenstreet.comTucows Domains Inc.27 Apr 201912 Apr 202427 Apr 2025
34historicgreenstreetchurch.comNameCheap, Inc.30 Sep 2019-30 Sep 2020
35historicgreenwooddistrict.comNameCheap, Inc.13 Nov 202015 Jan 202413 Nov 2031
36historicgreenwoodfest.comGoDaddy.com, LLC6 Jan 20216 Jan 20216 Jan 2022
37historicgreens.comGoDaddy.com, LLC30 Dec 202331 Dec 202430 Dec 2025
38historicgreenwoodave.comNameCheap, Inc.18 Sep 202229 Nov 202318 Sep 2023
39historicgreenwoodavedistrict.comNameCheap, Inc.18 Sep 202229 Nov 202318 Sep 2023
40historicgreensllc.comGoogle, Inc.1 Nov 202225 Nov 20231 Nov 2023
41historicgreenwood1921.comGoDaddy.com, LLC9 Feb 202123 Mar 20239 Feb 2023
42historicgreenspringsproperty.comWix.com Ltd.25 Jun 20215 Aug 202325 Jun 2023
43historicgreenwood.orgGoDaddy.com, LLC10 Oct 201924 Nov 202410 Oct 2025
44historicgreenfield.orgGoogle, Inc.18 May 202023 Apr 202418 May 2029
45historicgreenwooddistrict.orgFastDomain Inc.22 Nov 202016 Jan 202522 Nov 2025
46historicgreenville.orgNameCheap, Inc.4 Feb 202125 Jan 20254 Feb 2026
47historicgreenportauditorium.orgGoDaddy.com, LLC16 Aug 202112 Aug 202416 Aug 2025
48historicgreenvillepickens.comGoDaddy.com, LLC15 Jun 202326 Jun 202415 Jun 2025
49historicgreenvillepickensspeedway.comGoDaddy.com, LLC15 Jun 202326 Jul 202415 Jun 2024
50historicgreenestate.comGoDaddy.com, LLC17 Sep 202318 Sep 202417 Sep 2025
51historicgreenestatellc.comGoDaddy.com, LLC20 Mar 202411 Jan 202520 Mar 2027
52historicgreenwood.onlineNameCheap, Inc.6 Apr 202415 Nov 20246 Apr 2026
53historicgreenwoodcc.comWix.com Ltd.17 Jan 202517 Jan 202517 Jan 2027
54historicgreeneco.comGoDaddy.com, LLC19 Feb 202519 Feb 202519 Feb 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=historicgreen

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now