With support for 
Keyword: HOMESTEADMIAMISPEEDWAY
Reverse Whois » KEYWORD [homesteadmiamispeedway ] { 9 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | homesteadmiamispeedway.com | Brandsight, Inc. | 31 Aug 1999 | 31 Jul 2024 | 31 Aug 2025 |
| 2 | homesteadmiamispeedway.miami | Brandsight, Inc. | 20 Nov 2015 | 8 Nov 2023 | 20 Nov 2024 |
| 3 | homesteadmiamispeedway.net | Brandsight, Inc. | 31 Aug 1999 | 31 Jul 2024 | 31 Aug 2025 |
| 4 | homesteadmiamispeedway.org | Brandsight, Inc. | 31 Aug 1999 | 5 Aug 2024 | 31 Aug 2025 |
| 5 | homesteadmiamispeedwaytickets.info | GoDaddy.com, LLC | 25 Jun 2018 | 6 Aug 2024 | 25 Jun 2024 |
| 6 | homesteadmiamispeedwayvolunteers.com | GoDaddy.com, LLC | 15 Oct 2018 | 27 Dec 2023 | 15 Oct 2023 |
| 7 | homesteadmiamispeedwayinsurance.com | Moniker Online Services LLC | 17 May 2023 | 18 May 2024 | 17 May 2025 |
| 8 | homesteadmiamispeedwaysuites.com | GoDaddy.com, LLC | 15 Dec 2023 | 15 Dec 2023 | 15 Dec 2024 |
| 9 | homesteadmiamispeedwayairbnb.com | GoDaddy.com, LLC | 20 Apr 2024 | 20 Apr 2024 | 20 Apr 2025 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=homesteadmiamispeedway
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |