Our database now contains whois records of 598 Million (598,330,150) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [598 Million Domains] $10,000 Details

Keyword: HUMPHRIES

Reverse Whois » KEYWORD [humphries ]  { 484 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1humphries.infoNameCheap, Inc.23 Sep 201729 Aug 202423 Sep 2025
2humphries.xyzGoDaddy.com, LLC26 Sep 202425 Nov 202426 Sep 2025
3humphries.sciencePDR Ltd. d/b/a PublicDomainRegistry.com19 Mar 201520 Mar 201518 Mar 2016
4humphries.flowersUniregistrar Corp7 Apr 20157 Apr 20157 Apr 2016
5humphries.bizGoDaddy.com, LLC27 Aug 20152 Sep 202426 Aug 2025
6humphries.onlineCrazy Domains FZ-LLC20 Jan 201617 Jan 202420 Jan 2026
7humphries.comTucows Domains Inc.3 Jun 19964 May 20242 Jun 2025
8humphries.techeNom, Inc.7 Jun 201612 Aug 20247 Jun 2025
9humphries.com.auVentraIP Australia Pty Ltd-13 Sep 2016-
10humphries.mobieNom, Inc.20 Jan 201112 Mar 201720 Jan 2018
11humphries.netTucows Domains Inc.2 Nov 19983 Oct 20241 Nov 2025
12humphries.orgGoDaddy.com, LLC6 Jan 200010 Jan 20256 Jan 2026
13humphries.kiwiAscio Technologies, Inc. Danmark - Filial af Ascio…7 May 201421 Jun 20247 May 2025
14humphries.technologyGandi SAS24 Nov 201626 Oct 202424 Nov 2025
15humphries.cymruAscio Technologies, Inc. Danmark - Filial af Ascio…18 Apr 2017-18 Apr 2018
16humphries.emailTucows Domains Inc.6 Dec 201710 Dec 20246 Dec 2025
17humphries.me.uk-12 Jun 20021 Sep 202412 Jun 2025
18humphries.uk-10 Sep 202219 Oct 202410 Sep 2025
19humphries.co.uk-3 May 19981 Sep 20243 May 2032
20humphries.org.uk-6 Oct 200230 Jul 20246 Oct 2025
21humphries.club1&1 Internet AG14 Feb 201919 Feb 201914 Feb 2020
22humphries.devGlobal Domains International, Inc. DBA DomainCostC…2 Mar 201910 May 20242 Mar 2024
23humphries.groupAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…15 Aug 202216 Aug 202315 Aug 2024
24humphries.ca-10 Nov 200026 Mar 20211 Dec 2029
25humphries.realtyGoogle, Inc.19 May 202218 Jul 202419 May 2024
26humphries.tvTucows Domains Inc.30 May 201030 Apr 202230 May 2024
27humphries.cloudCloudFlare, Inc.12 Nov 202218 Oct 202412 Nov 2025
28humphries.familyeNom, Inc.24 Nov 202130 Oct 202424 Nov 2025
29humphries.homesGoDaddy.com, LLC25 Oct 202225 Nov 202425 Oct 2026
30humphries.pageGoogle, Inc.20 Apr 202120 Apr 202320 Apr 2024
31humphries.chatNameCheap, Inc.16 May 202327 Jul 202416 May 2024
32humphries.vipNameCheap, Inc.16 May 202321 Apr 202416 May 2025
33humphries.consultingNameCheap, Inc.22 May 202327 Apr 202422 May 2025
34humphries.digitalGoDaddy.com, LLC23 May 20237 Jul 202423 May 2025
35humphries.net.au--2 Jun 2024-
36humphrieslaw.comDynadot, LLC22 Mar 202122 Feb 202422 Mar 2025
37humphriesbacp.comGoDaddy.com, LLC26 Feb 201020 May 201526 Feb 2016
38humphriesrealty.comTucows Domains Inc.13 Oct 202413 Oct 202413 Oct 2025
39humphriesreviews.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 201427 Aug 201427 Aug 2015
40humphriesknivesandcoins.comGoDaddy.com, LLC28 Aug 20143 Aug 201628 Aug 2017
41humphriestire.comRegistrarDirect LLC19 Aug 201320 Aug 201719 Aug 2018
42humphriesandassociates.comDomain.com, LLC27 Dec 201112 Sep 201427 Dec 2016
43humphries4.comDNC Holdings, Inc.21 Aug 20117 Jul 202321 Aug 2026
44humphriesconstructionllc.comGoDaddy.com, LLC17 Oct 201418 Oct 202317 Oct 2025
45humphriesluxurytravel.infoGoDaddy.com, LLC15 Oct 201415 Oct 201415 Oct 2015
46humphriesconstructionllc.netGoDaddy.com, LLC17 Oct 201417 Oct 201417 Oct 2015
47humphriesconstructionllc.usGoDaddy.com, LLC17 Oct 201417 Oct 201416 Oct 2015
48humphriesconstructionllc.orgGoDaddy.com, LLC17 Oct 201417 Oct 201417 Oct 2015
49humphriesbunchphoto.comGoDaddy.com, LLC2 Jan 20152 Jan 20152 Jan 2016
50humphriesonline.xyzNetwork Solutions, LLC17 Jul 201417 Jul 201417 Jul 2015
51humphrieslanguage.comWild West Domains, LLC5 Jan 20155 Jan 20155 Jan 2016
52humphriesblog.comeNom, Inc.6 Jan 20156 Jan 20156 Jan 2016
53humphriesresearch.comGoDaddy.com, LLC20 Jan 201520 Jan 201520 Jan 2016
54humphrieselectronics.comGoDaddy.com, LLC23 Jan 201524 Jan 202523 Jan 2027
55humphriesdemolition.comWebfusion Ltd.23 Feb 201515 Feb 201723 Feb 2018
56humphriesdemo.comWebfusion Ltd.23 Feb 201515 Feb 201723 Feb 2018
57humphriesinc.comGoDaddy.com, LLC27 Feb 201518 Sep 202227 Feb 2025
58humphriesautocity.comFabulous.com Pty Ltd.19 Mar 200528 Jan 201819 Mar 2018
59humphriespc.usDomain.com, LLC28 Apr 2015-27 Apr 2017
60humphrieshomesinc.comCronon AG3 Aug 20213 Aug 20213 Aug 2022
61humphriesproductions.comGoDaddy.com, LLC15 Sep 201516 Sep 202415 Sep 2025
62humphriespartyoftwo.comTucows Domains Inc.7 Jun 201411 Jun 20157 Jun 2016
63humphriesmortgage.comDropCatch.com 450 LLC18 Sep 201519 Sep 201618 Sep 2017
64humphriesblockandconstruction.comTucows Domains Inc.29 Jun 20093 Jul 201529 Jun 2016
65humphrieshandpiecerepair.comGoDaddy.com, LLC24 Sep 201524 Sep 201524 Sep 2016
66humphriesconcerts.comGoDaddy.com, LLC8 Apr 20198 Apr 20198 Apr 2020
67humphries2.comNetwork Solutions, LLC20 Jul 20158 May 202020 Jul 2025
68humphriesbcc.comXin Net Technology Corporation8 Oct 201525 Mar 20218 Oct 2026
69humphriestower.comGoogle, Inc.21 Oct 201521 Oct 201521 Oct 2016
70humphries2.infoNetwork Solutions, LLC21 Oct 201521 Oct 201521 Oct 2016
71humphriescross.comGoDaddy.com, LLC9 Jan 201610 Jan 20249 Jan 2026
72humphrieslab.infoNameCheap, Inc.10 Apr 201925 Apr 202010 Apr 2021
73humphries4u.comGoDaddy.com, LLC11 Jan 201611 Jan 201611 Jan 2017
74humphriesfirm.law101domain, Inc.12 Jan 20163 Oct 202312 Jan 2027
75humphrieschiro.comDropCatch.com 1043 LLC31 Jan 20161 Feb 201731 Jan 2018
76humphriesentertainment.comGoDaddy.com, LLC13 Feb 201621 Oct 202413 Feb 2025
77humphriesboys.comGoDaddy.com, LLC13 Feb 201621 Oct 202413 Feb 2025
78humphriesforwisconsinschools.orgregister.com, Inc.27 Feb 201627 Feb 201627 Feb 2017
79humphriesforwisconsinkids.orgregister.com, Inc.27 Feb 201627 Feb 201627 Feb 2017
80humphriesforschools.orgGMO Internet Inc.18 May 20188 May 202318 May 2025
81humphriesdevelopments.comGoDaddy.com, LLC17 Mar 200929 Jul 202431 Jul 2025
82humphriesforjudge.comGoDaddy.com, LLC13 Mar 201613 Mar 201613 Mar 2017
83humphriesdesign.comNamesilo, LLC23 Jun 201923 Jun 201923 Jun 2020
84humphries-kinfolk.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Mar 201630 Mar 201722 Mar 2018
85humphriesconstructioncompany.comTucows Domains Inc.4 Apr 20124 Apr 20124 Apr 2017
86humphriesbpl.comCrazy Domains FZ-LLC30 Mar 201210 Apr 201930 Mar 2019
87humphriesfirm.comGoDaddy.com, LLC12 Apr 201613 Apr 202412 Apr 2025
88humphriesinsuranceagency.com-14 Apr 201614 Apr 201614 Apr 2017
89humphries-group.comTucows Domains Inc.21 Apr 201625 Apr 201921 Apr 2019
90humphriesagency.net-8 May 20168 May 20168 May 2017
91humphriesagency.comGoDaddy.com, LLC6 Oct 20226 Oct 20246 Oct 2026
92humphriesrealtyteam.comGoDaddy.com, LLC13 May 201613 May 201613 May 2017
93humphries4house.comGoDaddy.com, LLC15 May 201615 May 202415 May 2025
94humphriesinsurance.comGoDaddy.com, LLC17 May 200415 Jul 202415 Jul 2025
95humphrieselectricalcontracting.comNetwork Solutions, LLC12 Jun 202422 Jul 202412 Jun 2025
96humphriesbythebay.comGoDaddy.com, LLC30 Apr 201930 Apr 201930 Apr 2020
97humphriespt.comGoDaddy.com, LLC20 Jun 20166 Sep 202420 Jun 2025
98humphriesmonuments.comTucows Domains Inc.2 Jul 20122 Jul 20122 Jul 2017
99humphriessolutions.comGoDaddy.com, LLC6 Jul 20166 Jul 20166 Jul 2017
100humphriesgarage.comTucows Domains Inc.7 Jun 201611 Jun 20207 Jun 2020
101humphriesdirectory.siteNameCheap, Inc.15 Jun 201627 Jun 201615 Jun 2017
102humphriesletterpress.comDynamic Network Services, Inc.24 Jul 201618 Jul 201724 Jul 2018
103humphriesandhumpries.com-26 Jul 201626 Jul 201626 Jul 2018
104humphriesholidays.comDropCatch.com 576 LLC20 Oct 201820 Oct 201820 Oct 2019
105humphriesheatingcooling.comeNom, Inc.2 Feb 20192 Feb 20192 Feb 2020
106humphriesco.comNetwork Solutions, LLC21 Dec 202322 Dec 202421 Dec 2025
107humphriesphotos.comFastDomain Inc.26 Aug 200711 Aug 202426 Aug 2025
108humphriesford.comBrandsight, Inc.6 Dec 20045 Nov 20246 Dec 2025
109humphries-const.comNetwork Solutions, LLC15 Apr 199912 Mar 202115 Apr 2026
110humphriesconstruction.comGoDaddy.com, LLC17 Oct 200129 Aug 202417 Oct 2025
111humphriesfarmequipment.comBrandsight, Inc.10 Feb 200913 Jan 202410 Feb 2025
112humphriesbrewing.comGoDaddy.com, LLC28 Dec 20118 Jan 201523 Jan 2018
113humphriesmedia.comName.com, Inc.21 Jul 201427 Jun 201721 Jul 2018
114humphriesfamilydentistry.comGoDaddy.com, LLC11 Oct 201211 Oct 202411 Oct 2025
115humphriesconsulting.comNetwork Solutions, LLC9 Jan 20249 Jan 20259 Jan 2026
116humphriespc.comXin Net Technology Corporation30 Aug 202430 Aug 202430 Aug 2034
117humphriesphoto.comNameCheap, Inc.1 Mar 20241 Mar 20241 Mar 2025
118humphriesfamily.comNameCheap, Inc.23 Aug 201124 Jul 202423 Aug 2025
119humphriesmedicalmedia.comTucows Domains Inc.8 May 201212 Aug 20248 May 2025
120humphriesjobsite.comNetwork Solutions, LLC28 Apr 200513 Jan 202328 Apr 2026
121humphriesmachinery.comDropCatch.com 1036 LLC25 Mar 202125 Mar 202125 Mar 2022
122humphriesconstructionproducts.comGoDaddy.com, LLC12 Jun 201927 Oct 202212 Jun 2027
123humphries-scientific.comNetwork Solutions, LLC4 Aug 20145 Jun 20244 Aug 2026
124humphriesscreenprinting.comSquarespace Domains LLC25 Sep 201310 Sep 202425 Sep 2025
125humphriescpa.comWild West Domains, LLC19 Apr 201020 Apr 202419 Apr 2025
126humphriesgroup.com-16 Jan 202516 Jan 202516 Jan 2026
127humphriesauction.com1&1 Internet AG20 May 201121 May 201620 May 2017
128humphriespestcontrol.comunited-domains AG3 Jun 202430 Nov 20243 Jun 2025
129humphriesmotors.comNameCheap, Inc.9 Jan 201410 Dec 20249 Jan 2026
130humphriesart.comGoDaddy.com, LLC20 Jun 201021 Jun 202420 Jun 2026
131humphriesdatadesign.comGoDaddy.com, LLC1 Mar 20121 Mar 20161 Mar 2017
132humphriesweaving.comBB Online Ltd17 May 201218 May 202417 May 2025
133humphriesfamilyresearch.com1&1 Internet AG12 Mar 20125 Jul 201612 Mar 2017
134humphriesorthodontics.comGoDaddy.com, LLC19 May 200616 Sep 202416 Sep 2025
135humphriesdetails.comNetwork Solutions, LLC8 Aug 200710 Aug 20168 Aug 2017
136humphrieslawnandlandscape.comName.com, Inc.12 Feb 201412 Feb 201612 Feb 2017
137humphriesbrothers.comGoDaddy.com, LLC25 Mar 201126 Mar 201625 Mar 2018
138humphriesmortgageteam.comCloudFlare, Inc.4 Feb 201323 Jan 20244 Feb 2025
139humphriesenvironmental.comGoDaddy.com, LLC27 Aug 20078 Jan 202327 Aug 2027
140humphrieschiropractic.comTucows Domains Inc.20 Jun 201122 May 202420 Jun 2025
141humphriesautomotive.comWild West Domains, LLC30 Jul 201331 Jul 202430 Jul 2025
142humphriesprinting.comGoDaddy.com, LLC19 Dec 200316 Dec 202419 Dec 2025
143humphriesscientific.comGoDaddy.com, LLC22 Jun 201415 Jun 202422 Jun 2025
144humphriesforsheriff.com-7 Mar 20227 Mar 20227 Mar 2023
145humphriesarchery.comTucows Domains Inc.15 Apr 200421 Apr 202415 Apr 2025
146humphriesmusic.comGoogle, Inc.8 Jan 20238 Jan 20258 Jan 2025
147humphriesdevelopment.comGoDaddy.com, LLC29 Aug 200829 Jul 202431 Jul 2025
148humphrieskerstetter.comGoDaddy.com, LLC7 Nov 201213 Nov 20237 Nov 2026
149humphries-russ.comTucows Domains Inc.7 Jul 20068 Jun 20247 Jul 2025
150humphriesandparks.comWebfusion Ltd.8 May 201423 Jan 20238 May 2027
151humphries-dolnick.comDreamHost, LLC31 Oct 20082 Sep 20241 Nov 2025
152humphriesandcompany.comNetwork Solutions, LLC14 Mar 200113 Jan 202314 Mar 2026
153humphriesoxford.comTucows Domains Inc.28 Apr 20162 May 202128 Apr 2021
154humphriesortho.comGoDaddy.com, LLC2 Oct 200716 Sep 202416 Sep 2025
155humphriesholidayhouse.comGoDaddy.com, LLC6 Dec 20097 Dec 20156 Dec 2017
156humphries-house.comNameCheap, Inc.23 May 20088 May 202423 May 2025
157humphriesblock.comGoDaddy.com, LLC19 Jun 200330 May 202419 Jun 2025
158humphrieselectric.comGoDaddy.com, LLC2 Mar 20102 Mar 20162 Mar 2017
159humphrieslab.comGoDaddy.com, LLC21 Dec 201022 Dec 202421 Dec 2025
160humphriesusa.comGoDaddy.com, LLC24 Mar 201325 Mar 201624 Mar 2019
161humphriesbuildingproducts.comTucows Domains Inc.23 May 201229 May 202323 May 2024
162humphriesdental.comGoDaddy.com, LLC30 Sep 20101 Oct 202430 Sep 2025
163humphriesphotography.comGoDaddy.com, LLC12 Feb 20009 Feb 202412 Feb 2027
164humphriescasters.comGoDaddy.com, LLC24 Aug 200415 Jul 202424 Aug 2025
165humphriesscrap.comTucows Domains Inc.2 Sep 201330 Aug 20242 Sep 2026
166humphriesconstructioninc.comGoDaddy.com, LLC7 Jun 200819 Nov 20227 Jun 2027
167humphriesj.comGoDaddy.com, LLC17 May 201118 May 202417 May 2025
168humphriesteam.comCloudFlare, Inc.8 Dec 201027 Nov 20248 Dec 2025
169humphrieshouse.comNameCheap, Inc.13 May 20128 May 202413 May 2025
170humphriesfarms.comBrandsight, Inc.14 Oct 200211 Nov 202414 Oct 2025
171humphriesbldg.comLaunchpad, Inc.26 Apr 200611 Apr 202426 Apr 2025
172humphriesengineering.comGoDaddy.com, LLC26 May 20096 Sep 202226 May 2025
173humphriestrack.comUniregistrar Corp---
174humphrieslandscape.comWild West Domains, LLC21 Jun 202121 Jun 202121 Jun 2022
175humphriesplanning.comNetwork Solutions, LLC20 Oct 200318 Sep 202420 Oct 2033
176humphriesclass.comTucows Domains Inc.29 Jun 200415 Jun 202429 Jun 2025
177humphrieshomes.comGoDaddy.com, LLC8 Jul 201213 Sep 20228 Jul 2026
178humphrieslawfirm.comGoDaddy.com, LLC29 Nov 202130 Nov 202429 Nov 2025
179humphriesandson.comTucows Domains Inc.16 Aug 201220 Aug 201716 Aug 2017
180humphriesmarketinggroup.comGoDaddy.com, LLC4 Jan 202030 Dec 20244 Jan 2026
181humphriesnation.comDropCatch.com 1318 LLC21 Feb 202026 Sep 202221 Feb 2025
182humphriesgroupllc.comGoDaddy.com, LLC20 Jul 201231 Aug 202420 Jul 2024
183humphriesroadpharmacy.comCrazy Domains FZ-LLC20 Sep 201112 Aug 201720 Sep 2019
184humphriespcc.comXin Net Technology Corporation15 Apr 201425 Mar 202115 Apr 2026
185humphrieswealthgroup.comGoDaddy.com, LLC12 Sep 201612 Sep 202412 Sep 2026
186humphriesfamilyreunion.orgPDR Ltd. d/b/a PublicDomainRegistry.com2 Oct 20161 Oct 20172 Oct 2018
187humphriesandco.comGoDaddy.com, LLC9 Oct 20169 Oct 20249 Oct 2026
188humphriesdevelopment.infoGoDaddy.com, LLC29 Aug 200810 Oct 201629 Aug 2017
189humphriesdevelopments.infoGoDaddy.com, LLC17 Mar 200928 Apr 202417 Mar 2024
190humphriesfamily.info1&1 Internet AG23 Aug 20118 Oct 201623 Aug 2017
191humphriesart.netGoogle, Inc.10 Feb 202010 Feb 202010 Feb 2021
192humphriesteam.netCloudFlare, Inc.26 Jan 20103 Jan 202526 Jan 2026
193humphriesdevelopments.netGoDaddy.com, LLC17 Mar 200929 Jul 202431 Jul 2025
194humphrieslaw.netGoDaddy.com, LLC8 Aug 20139 Aug 20238 Aug 2025
195humphries-dolnick.netAmazon Registrar, Inc.11 Mar 20126 Feb 202411 Mar 2025
196humphriespainting.netGoDaddy.com, LLC3 Aug 20096 Aug 20163 Aug 2018
197humphriesgroup.netGoDaddy.com, LLC20 Jul 20121 Aug 201720 Jul 2018
198humphriesdevelopment.netGoDaddy.com, LLC29 Aug 200829 Jul 202431 Jul 2025
199humphriesgroupllc.netGoDaddy.com, LLC20 Jul 201221 Jul 201520 Jul 2017
200humphriesweaving.netBB Online Ltd17 May 201218 May 202417 May 2025
201humphriesportfolio.com-20 Oct 201620 Oct 201620 Oct 2017
202humphriesdevelopment.orgGoDaddy.com, LLC29 Aug 200810 Oct 201629 Aug 2017
203humphriesfamily.org1&1 Internet AG23 Aug 20117 Oct 201623 Aug 2017
204humphriestree.orgNetwork Solutions, LLC3 Aug 20083 Jun 20213 Aug 2026
205humphriesfoundation.orgGoDaddy.com, LLC24 Jul 20065 Jul 202424 Jul 2032
206humphriesonline.orgGoDaddy.com, LLC21 Nov 20115 Jan 202521 Nov 2026
207humphrieslab.orgGoDaddy.com, LLC21 Dec 201016 Dec 202421 Dec 2025
208humphriesdevelopments.orgGoDaddy.com, LLC17 Mar 200929 Mar 202417 Mar 2025
209humphrieslaw.orgTucows Domains Inc.16 Oct 200921 Sep 202416 Oct 2025
210humphriesbook429.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
211humphriestimberproductsws10.co.uk-17 Sep 201319 Aug 201517 Sep 2016
212humphriesheating.com-28 Oct 201628 Oct 201628 Oct 2018
213humphriesconstruction.co.uk-17 Jan 202116 Jan 202417 Jan 2026
214humphriesandbegg.co.ukLCN.COM Ltd.9 Dec 201010 Jan 20229 Dec 2027
215humphriesshoes.co.uk-6 Feb 20063 Sep 20246 Feb 2025
216humphrieswelding.comGoDaddy.com, LLC14 Nov 201614 Nov 201614 Nov 2017
217humphriessanitation.comGoDaddy.com, LLC16 Nov 201616 Nov 201616 Nov 2018
218humphries429.xyzUniregistrar Corp2 Jun 201623 Sep 20162 Jun 2017
219humphrieswellness.comWild West Domains, LLC11 Jan 202312 Jan 202511 Jan 2026
220humphries2.netNetwork Solutions, LLC4 Jan 20176 Jan 20184 Jan 2019
221humphriesconcreteblockco.comGoDaddy.com, LLC17 Jan 201717 Jan 201717 Jan 2019
222humphriesblockco.comGoDaddy.com, LLC17 Jan 201717 Jan 201717 Jan 2019
223humphriesengineering.co.uk-25 Mar 200027 Feb 202425 Mar 2029
224humphriesresidential.comGoDaddy.com, LLC28 Oct 202028 Oct 202028 Oct 2021
225humphriesdevelopments.bizGoDaddy.com, LLC23 Mar 20173 May 202422 Mar 2024
226humphrieswellness.netGoDaddy.com, LLC2 Apr 20172 Apr 20172 Apr 2018
227humphrieskirk.co.uk-28 Jan 199930 Dec 202428 Jan 2026
228humphrieswwc.comTucows Domains Inc.26 Apr 201730 Apr 201826 Apr 2018
229humphriesinsgroup.comGoDaddy.com, LLC14 Jun 201715 Jun 202314 Jun 2025
230humphriesinsagency.comGoDaddy.com, LLC14 Jun 20176 May 202414 Jun 2025
231humphriesharvest.comFastDomain Inc.27 Jun 201712 Jun 202427 Jun 2025
232humphriesfaq.comTucows Domains Inc.29 Jun 201725 Jun 202429 Jun 2025
233humphriesautomotiveinc.orgDomainPeople, Inc.25 Jul 201715 Jul 202425 Jul 2025
234humphrieselectric.netregister.com, Inc.6 Aug 20176 Aug 20176 Aug 2018
235humphries-electric.comregister.com, Inc.7 Aug 20177 Aug 20177 Aug 2018
236humphriespress.comTucows Domains Inc.18 Aug 201720 Jul 202418 Aug 2025
237humphriesaviation.comTucows Domains Inc.3 Oct 201718 Sep 20243 Oct 2025
238humphries-stonemasons.co.uk-28 Jun 200723 Jun 202328 Jun 2025
239humphriesholdingsllc.comNetwork Solutions, LLC5 Dec 20175 Dec 20175 Dec 2018
240humphriesfarm.comeNom, Inc.18 Dec 201717 Dec 201718 Dec 2018
241humphriescars.co.uk-21 Aug 201430 Dec 202221 Aug 2024
242humphriestimberproducts.co.ukKey-Systems GmbH8 Apr 201726 Apr 20178 Apr 2018
243humphriesdemo.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…23 Feb 201515 Feb 201723 Feb 2018
244humphries-taxis-odiham-greywell.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
245humphrieskerstetter.co.uk-7 Nov 20125 Jul 20247 Nov 2026
246humphriesdigitalaerials.co.uk-12 Dec 201128 Nov 202412 Dec 2025
247humphriesholidays.co.uk-3 Aug 20164 Jul 20173 Aug 2018
248humphriesav.co.uk-20 Nov 200719 Nov 202320 Nov 2025
249humphries-cars-bramshill-heckfield.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
250humphries-cars-hartleywintney.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
251humphriesandparks.co.uk-17 Feb 200012 Jul 202417 Feb 2028
252humphries-smith.co.uk-28 Apr 200017 Apr 202428 Apr 2025
253humphries-cars-winchfield.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
254humphries-cars-aldershot-ash.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
255humphriesholdings.co.uk-21 Mar 20098 Apr 201321 Mar 2018
256humphriesandparks-mitsubishi.co.uk-24 Jan 201220 Jan 202524 Jan 2026
257humphries-taxis-sandhurst-crowthorne.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
258humphriesscrap.co.uk-2 Sep 20132 Aug 20172 Sep 2019
259humphries-taxis-farnborough-cove.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
260humphries-taxis-farnham-hale.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
261humphries-cars-bagshot-windlesham.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
262humphrieslegal.infoGoDaddy.com, LLC6 Jan 20187 Jan 20206 Jan 2022
263humphriesifa.co.uk-29 Jul 200429 Jun 202429 Jul 2025
264humphries-signs.co.uk-1 Sep 20112 Sep 20241 Sep 2028
265humphriesdemolition.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…23 Feb 201515 Feb 201723 Feb 2018
266humphries-taxis-winchfield.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
267humphries-taxis-bagshot-windlesham.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
268humphriesmail.co.uk-15 Mar 201414 Feb 202415 Mar 2026
269humphries-cars-odiham-greywell.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
270humphries-cars-fleet.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
271humphrieskirkfinancialservices.co.uk-27 Sep 201114 Sep 201727 Sep 2019
272humphries-taxis-aldershot-ash.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
273humphriestimber.co.uk-14 May 200816 May 201614 May 2018
274humphries-taxis-fleet.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
275humphries-taxis-camberley-frimley.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
276humphries-taxis-hartleywintney.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
277humphries-taxis-crondall-ewshot.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
278humphries-taxis-bramshill-heckfield.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
279humphriesandco.uk-1 Jul 201522 Jun 20241 Jul 2025
280humphriesandjones.co.uk-9 Sep 201112 Jul 20249 Sep 2026
281humphries-cars-farnborough-cove.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
282humphries-cars-farnham-hale.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
283humphries-cars-sandhurst-crowthorne.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
284humphries-taxis-yateley-eversley.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
285humphries-roofing.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…20 Sep 201613 Sep 201720 Sep 2018
286humphriesfamily.org.uk-6 Jan 20043 Jan 20256 Jan 2026
287humphriesweaving.co.uk-9 Jul 19988 Jul 20249 Jul 2026
288humphriestaxis.co.ukReserved23 Jan 201522 Jan 201723 Jan 2019
289humphriesandparksmedway.co.uk-2 Jan 202315 May 20232 Jan 2024
290humphriestimber.uk-16 Oct 201716 Oct 201716 Oct 2019
291humphries-cars-hook-rotherwick.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
292humphries-cars-crondall-ewshot.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
293humphriesoxford.co.uk-6 Oct 20227 Oct 20236 Oct 2024
294humphries-cars-camberley-frimley.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
295humphries-cars-yateley-eversley.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
296humphries-taxis-hook-rotherwick.co.ukReserved22 Feb 201521 Feb 201722 Feb 2019
297humphriescross.co.uk-9 Jan 201626 Dec 20179 Jan 2020
298humphries-solicitors.co.uk-20 Mar 20122 Apr 202420 Mar 2025
299humphriesdocument.co.ukLCN.COM Ltd.15 Feb 201730 Apr 201715 Feb 2018
300humphriestohubbard.comFastDomain Inc.4 Feb 20184 Feb 20184 Feb 2019
301humphriestech.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Feb 20189 Feb 20189 Feb 2019
302humphriesdisability.comGoogle, Inc.7 Mar 20181 Jun 20247 Mar 2025
303humphriesfencing.comNetRegistry Pty Ltd.29 Jun 201829 Jun 201829 Jun 2019
304humphriesdevelopmentgroup.comGoDaddy.com, LLC13 Jul 201824 Sep 202313 Jul 2023
305humphriesplanning.netNetwork Solutions, LLC18 Jul 201830 Aug 202418 Jul 2024
306humphriesheatingandcooling.comDropCatch.com 445 LLC6 Nov 20246 Nov 20246 Nov 2025
307humphriesturf.comKey-Systems GmbH9 Nov 202222 Jan 20249 Nov 2023
308humphriesfamilydental.comGoDaddy.com, LLC14 Sep 201815 Sep 202414 Sep 2025
309humphries-do.comTucows Domains Inc.24 Sep 20187 Jan 202324 Sep 2032
310humphriesautomotivein.comGoDaddy.com, LLC5 Oct 20186 Oct 20245 Oct 2025
311humphrieshomegrown.comGoogle, Inc.22 Oct 201822 Oct 201822 Oct 2019
312humphriesfamilychemdry.comGoDaddy.com, LLC6 Nov 20187 Nov 20236 Nov 2028
313humphrieslajolla.comeNom, Inc.4 Feb 20193 Feb 20194 Feb 2020
314humphriesautomotivesales.comeNom, Inc.12 Feb 201912 Feb 201912 Feb 2020
315humphriesrealtygroup.comGoDaddy.com, LLC13 Feb 201914 Feb 202413 Feb 2025
316humphriesconstructionkiwi.comNameCheap, Inc.14 Feb 201914 Feb 201914 Feb 2020
317humphrieselectrical.comGoDaddy.com, LLC5 Mar 20196 Mar 20245 Mar 2025
318humphriesandparks.netGoDaddy.com, LLC27 Mar 201928 Mar 202427 Mar 2025
319humphriesconsultingllc.comGoDaddy.com, LLC23 Apr 201924 Apr 202423 Apr 2025
320humphriesrealestate.comNameCheap, Inc.5 Oct 202317 Oct 20245 Oct 2025
321humphriesplumbing.comGoogle, Inc.13 Jan 202513 Jan 202513 Jan 2026
322humphriespetservices.comGoDaddy.com, LLC24 Jun 201924 Jun 201924 Jun 2020
323humphriesandsonsgradingplastering.comGoDaddy.com, LLC7 Aug 20197 Aug 20197 Aug 2020
324humphriesfirm.netGoogle, Inc.22 Aug 201922 Aug 201922 Aug 2020
325humphriesmanagement.comGoogle, Inc.10 Apr 20247 Jun 202410 Apr 2025
326humphriesautodetailing.comGoogle, Inc.29 Dec 201929 Dec 201929 Dec 2020
327humphriesgroupkw.comGoogle, Inc.23 Jan 20208 Jan 202523 Jan 2026
328humphriesdentaltx.comGoDaddy.com, LLC19 Feb 202020 Feb 202419 Feb 2025
329humphries-civilengineering.comFastDomain Inc.25 Feb 202025 Feb 202025 Feb 2021
330humphrieshealth.comGoDaddy.com, LLC30 Mar 202031 Mar 202330 Mar 2026
331humphrieskingrealty.comGoDaddy.com, LLC7 Apr 20208 Apr 20247 Apr 2025
332humphriesandbrooks.comName.com, Inc.7 Apr 20207 Apr 20207 Apr 2021
333humphriesandkingrealty.comGoDaddy.com, LLC7 Apr 20208 Apr 20247 Apr 2025
334humphriesandking.comGoDaddy.com, LLC8 Apr 20209 Apr 20248 Apr 2025
335humphriesheatingcooling.netGoogle, Inc.19 Apr 202015 May 202419 Apr 2025
336humphrieshomes.infoGoDaddy.com, LLC22 Dec 201921 Feb 202022 Dec 2020
337humphriesestateagents.comLaunchpad, Inc.11 Jun 202011 Jun 202011 Jun 2021
338humphriesestateagents.co.uk-10 Jun 20209 Feb 202110 Jun 2021
339humphriesautorepair.comGoDaddy.com, LLC6 Jul 20206 Jul 20206 Jul 2021
340humphries-associes.comNamebay SAM15 Jul 20206 Oct 202415 Jul 2025
341humphriesassocies.comNamebay SAM15 Jul 20206 Oct 202415 Jul 2025
342humphriescockapoos.comTucows Domains Inc.14 Aug 202015 Jul 202414 Aug 2026
343humphriespoos.comTucows Domains Inc.14 Aug 202015 Jul 202414 Aug 2026
344humphriesheart.comGoogle, Inc.31 Aug 202031 Aug 202031 Aug 2021
345humphrieshvac.comGoogle, Inc.17 Sep 20242 Oct 202417 Sep 2025
346humphriesautorepairar.comGoDaddy.com, LLC1 Oct 20201 Oct 20201 Oct 2021
347humphriesproperties.comGoDaddy.com, LLC4 Oct 20205 Oct 20244 Oct 2025
348humphriescountyhomes.comGoDaddy.com, LLC19 Oct 202019 Oct 202019 Oct 2022
349humphrieses.comGoogle, Inc.21 Oct 202021 Oct 202021 Oct 2021
350humphriesshoes.comGoDaddy.com, LLC11 Dec 202011 Dec 202011 Dec 2021
351humphries-cockapoos.comTucows Domains Inc.1 Jan 20212 Dec 20241 Jan 2027
352humphries-poos.comTucows Domains Inc.1 Jan 20212 Dec 20241 Jan 2027
353humphriesgardening.comRegister.it SPA7 Jan 20217 Jan 20217 Jan 2022
354humphriesgardening.co.uk-7 Jan 20219 Feb 20217 Jan 2022
355humphries-ignorant.comGMO Internet Inc.23 Jan 202124 Jan 202123 Jan 2022
356humphries-family.netAmazon Registrar, Inc.27 Jan 202127 Jan 202127 Jan 2022
357humphriesmls.comGoDaddy.com, LLC12 Mar 202112 Mar 202112 Mar 2022
358humphrieshomestylekitchen.comMedia Elite Holdings Limited6 Sep 20227 Sep 20236 Sep 2023
359humphriesdistrict.sitePDR Ltd. d/b/a PublicDomainRegistry.com7 May 20217 May 20217 May 2022
360humphriesptyltd.comWild West Domains, LLC24 Jun 202124 Jun 202124 Jun 2022
361humphriesmatusky.comNameCheap, Inc.2 Jul 20212 Jun 20242 Jul 2025
362humphriessounds.comAutomattic Inc.26 Jul 202126 Jul 202126 Jul 2022
363humphries-sounds.comFastDomain Inc.26 Jul 20218 Oct 202426 Jul 2024
364humphriescalculus.comGoogle, Inc.31 Jul 202116 Jul 202431 Jul 2025
365humphriesenterprise.comGoDaddy.com, LLC9 Aug 20219 Aug 20239 Aug 2023
366humphrieswalker.comNetwork Solutions, LLC4 Nov 202317 Jan 20254 Nov 2024
367humphriespropose.sitePDR Ltd. d/b/a PublicDomainRegistry.com7 Sep 20217 Sep 20217 Sep 2022
368humphriesmobilenotary.comPorkbun, LLC4 Oct 202118 Dec 20244 Oct 2024
369humphrieshvacr.comWild West Domains, LLC10 Oct 202111 Oct 202410 Oct 2025
370humphriesandsons.comLaunchpad, Inc.13 Oct 202113 Jun 202413 Oct 2027
371humphrieskaylauyjmsminh.comWild West Domains, LLC20 Oct 202120 Oct 202120 Oct 2022
372humphriescommunity.comGoogle, Inc.8 Nov 202120 Dec 20248 Nov 2024
373humphrieses.xyzGMO Internet Inc.13 Nov 202113 Nov 202113 Nov 2022
374humphriesmediamarketers.comGoDaddy.com, LLC11 Dec 202122 Jan 202411 Dec 2023
375humphriesteam.sitePDR Ltd. d/b/a PublicDomainRegistry.com14 Feb 202231 Mar 202214 Feb 2024
376humphrieslandsurveying.comAutomattic Inc.11 Apr 202216 Apr 202411 Apr 2025
377humphriesbrickwork.comTucows Domains Inc.28 Apr 202229 Mar 202428 Apr 2026
378humphriesplanning.onlineNetwork Solutions, LLC6 May 202218 Jul 20236 May 2023
379humphriesconstco.comDynadot, LLC12 May 202221 Jun 202412 May 2024
380humphriesdigitalmarketing.comGoDaddy.com, LLC27 Feb 201828 Feb 202427 Feb 2025
381humphriesand.companyNetwork Solutions, LLC1 Jul 202212 Sep 20231 Jul 2023
382humphrieslawn.comGoogle, Inc.19 Jul 202219 Jul 202319 Jul 2024
383humphries-associes.fr-15 Jul 202027 Jun 202215 Jul 2023
384humphriesmotorsportremaps.co.uk-23 Jul 20226 Aug 202323 Jul 2023
385humphriesstudio.comDomain.com, LLC2 Aug 20222 Aug 20222 Aug 2027
386humphries-eysler.comGMO Internet Inc.8 Sep 202220 Nov 20238 Sep 2023
387humphriesclub.comLaunchpad, Inc.9 Sep 202221 Oct 20239 Sep 2023
388humphriescatering.comGoogle, Inc.9 Sep 202210 Sep 20239 Sep 2024
389humphriesenterprise.orgGoogle, Inc.11 Sep 202212 Sep 202411 Sep 2025
390humphries2.onlineNetwork Solutions, LLC20 Sep 202220 Sep 202220 Sep 2023
391humphriespestcontrol.netGoogle, Inc.27 Sep 20222 Apr 202427 Sep 2032
392humphriesonestop.comNameCheap, Inc.17 Oct 202229 Dec 202317 Oct 2023
393humphriescon.comGoDaddy.com, LLC21 Oct 20222 Jan 202421 Oct 2023
394humphriesplumbingandheating.co.uk-1 Nov 202226 Oct 20241 Nov 2025
395humphriesmediation.comGoDaddy.com, LLC11 Aug 201722 Oct 202311 Aug 2023
396humphriesandcompany.websiteGoDaddy.com, LLC9 Nov 20229 Nov 20229 Nov 2023
397humphriesandco.netCloudFlare, Inc.13 Dec 20229 Oct 202413 Dec 2025
398humphriescatering.co.uk-21 Dec 202221 Dec 202421 Dec 2026
399humphries-fugler.comGMO Internet Inc.27 Dec 20229 Mar 202427 Dec 2023
400humphriesandjones.comAscio Technologies, Inc. Danmark - Filial af Ascio…18 Sep 200321 Jul 202418 Sep 2026
401humphries-household.comNameCheap, Inc.24 Jan 20237 Mar 202424 Jan 2024
402humphriesautoservice.ca-22 Jan 200824 Dec 202422 Jan 2026
403humphriesconstruction.ca-1 Aug 20142 Aug 20231 Aug 2025
404humphriesheatingandair.comGoDaddy.com, LLC23 Feb 202323 Feb 202323 Feb 2025
405humphriesdiesel.comGoDaddy.com, LLC12 Dec 201713 Dec 202212 Dec 2027
406humphrieslegal.comGoDaddy.com, LLC6 Jan 20181 Jun 20246 Jan 2026
407humphriescapital.comNamesilo, LLC31 Jul 20196 Aug 202431 Jul 2025
408humphriesaviationllc.comGoDaddy.com, LLC17 Mar 202321 Mar 202317 Mar 2025
409humphries-joanne.comGMO Internet Inc.22 Mar 20233 May 202422 Mar 2024
410humphries-law.comGoDaddy.com, LLC9 Feb 202110 Jan 20239 Feb 2025
411humphrieshomestylekitchens.comGoDaddy.com, LLC8 Mar 202120 May 20248 Mar 2024
412humphriesranch.comCloudFlare, Inc.27 Mar 20232 Oct 202427 Mar 2025
413humphriescreative.comSquarespace Domains LLC14 Jul 202113 Sep 202314 Jul 2023
414humphriesautosupply.comWild West Domains, LLC29 Jul 202130 Jul 202429 Jul 2025
415humphriescustomhomes.comSquarespace Domains LLC11 Aug 202128 Jul 202411 Aug 2025
416humphriesconsultinggroup.comGoDaddy.com, LLC24 Jan 20224 Oct 202224 Jan 2027
417humphriescorp.comGoDaddy.com, LLC3 Feb 20228 Feb 20243 Feb 2026
418humphrieshomestead.comGoDaddy.com, LLC3 Feb 20223 Feb 20243 Feb 2026
419humphriescycles.ie-24 Oct 20114 Dec 202425 Oct 2025
420humphriescustomhomes.netSquarespace Domains LLC11 Aug 202128 Jul 202411 Aug 2025
421humphries-russ.netGoDaddy.com, LLC18 Dec 202119 Dec 202418 Dec 2025
422humphriesassociates.comGoDaddy.com, LLC22 Apr 202322 Apr 202322 Apr 2024
423humphriespeople.co.nz-28 Nov 20148 Oct 2023-
424humphriesconstruction.co.nz-26 Jul 200131 Jul 2024-
425humphries-lab.orgNetwork Solutions, LLC13 Apr 20189 May 202413 Apr 2027
426humphries-russ.orgGoDaddy.com, LLC18 Dec 202119 Dec 202418 Dec 2025
427humphriesfleetservices.comWild West Domains, LLC22 Jul 202422 Jul 202422 Jul 2025
428humphrieshoes.co.uk-4 Mar 202226 Jul 20224 Mar 2023
429humphries-construction.co.uk-28 Mar 202115 Jan 202528 Mar 2027
430humphriescoaches.co.ukYour Domain LLC15 Jul 202015 Jun 202415 Jul 2026
431humphriescockapoos.co.uk-14 Aug 202015 Jul 202414 Aug 2026
432humphriesandrew.comWix.com Ltd.19 Jun 202320 May 202419 Jun 2025
433humphries-fillia.comGMO Internet Inc.11 Jul 202322 Aug 202411 Jul 2024
434humphrieswoodburners.comWebfusion Ltd.20 Jul 202321 Jul 202420 Jul 2025
435humphrieswoodburners.netWebfusion Ltd.20 Jul 202321 Jul 202420 Jul 2025
436humphrieswoodburners.co.uk-20 Jul 202321 Jul 202420 Jul 2025
437humphrieswoodburners.uk-20 Jul 202331 Jul 202420 Jul 2025
438humphriesharvest.onlinePDR Ltd. d/b/a PublicDomainRegistry.com9 Sep 202313 Nov 20249 Sep 2025
439humphriesecological.comWix.com Ltd.14 Sep 202314 Sep 202314 Sep 2025
440humphriesandparks.orgNameCheap, Inc.19 Sep 202331 Oct 202419 Sep 2024
441humphries-kvell.comGMO Internet Inc.12 Oct 202323 Nov 202412 Oct 2024
442humphrieshomesnd.comDomainPeople, Inc.23 Oct 202317 Oct 202423 Oct 2025
443humphriescleaning.co.uk-19 Nov 202320 Nov 202419 Nov 2025
444humphriesatlanta.comGoogle, Inc.3 Dec 202318 Nov 20243 Dec 2025
445humphrieslawncare.comGoDaddy.com, LLC15 Dec 202319 Feb 202415 Dec 2025
446humphries-pitt.comGMO Internet Inc.19 Dec 202330 Jan 202519 Dec 2024
447humphriesodoom.co.uk-22 Dec 20236 Sep 202422 Dec 2026
448humphrieshomefurnishings.netGoogle, Inc.17 Jan 20242 Jan 202517 Jan 2026
449humphriesheating.co.uk-23 Jan 202412 May 202423 Jan 2025
450humphrieshomesales.comNameCheap, Inc.26 Jan 202427 Dec 202426 Jan 2026
451humphrieschimneysweeps.infoGoogle, Inc.29 Jan 202414 Jan 202529 Jan 2026
452humphrieshome.comAmazon Registrar, Inc.8 Feb 20248 Apr 20248 Feb 2025
453humphries-bluhm.comGMO Internet Inc.15 Feb 202426 Feb 202415 Feb 2025
454humphrieshometeam.comCloudFlare, Inc.21 Feb 202428 Feb 202421 Feb 2025
455humphriesmanagment.comGoogle, Inc.10 Apr 20246 Jun 202410 Apr 2025
456humphries-poos.co.uk-1 Jan 20212 Dec 20241 Jan 2027
457humphriesbrickwork.co.uk-28 Apr 202229 Mar 202428 Apr 2026
458humphriesconstructions.com.au--20 Oct 2024-
459humphriesheatingandplumbing.co.ukYour Domain LLC30 Oct 201930 Sep 202330 Oct 2025
460humphriesroadmc.com.au--15 Oct 2024-
461humphriessigns.co.uk-27 Jun 201821 Aug 202427 Jun 2025
462humphries-fassbender.comGMO Internet Inc.25 Apr 202420 Aug 202425 Apr 2025
463humphries-cockapoos.shopTucows Domains Inc.1 Jan 202118 Jan 20241 Jan 2025
464humphrieshomeloans.comNameCheap, Inc.8 May 20248 May 20248 May 2029
465humphriesllc.comNameCheap, Inc.8 May 20248 May 20248 May 2026
466humphriesclan.comCloudFlare, Inc.27 May 20243 Jun 202427 May 2025
467humphriesconstructionandhandymanservice.comNameCheap, Inc.18 Jun 202418 Jun 202418 Jun 2025
468humphries-ga.siteGMO Internet Inc.20 Jun 202425 Jun 202420 Jun 2025
469humphries-homes.comregister.com, Inc.15 Jul 202415 Jul 202415 Jul 2029
470humphriesfleetservices.netGoDaddy.com, LLC22 Jul 202422 Jul 202422 Jul 2029
471humphriesventures.comCloudFlare, Inc.8 Aug 202415 Aug 20248 Aug 2025
472humphries-consulting.comCloudFlare, Inc.12 Sep 202419 Sep 202412 Sep 2025
473humphriesforsherwood.comGoDaddy.com, LLC25 Sep 202425 Sep 202425 Sep 2025
474humphriescleaning.onlineGoDaddy.com, LLC1 Oct 202425 Nov 20241 Oct 2025
475humphries-cleaning.comGoDaddy.com, LLC1 Oct 20241 Oct 20241 Oct 2025
476humphriescleaning.comGoDaddy.com, LLC1 Oct 20241 Oct 20241 Oct 2025
477humphries-crumb.comGMO Internet Inc.17 Oct 202429 Oct 202417 Oct 2025
478humphriesrecruitment.com1&1 Internet AG6 Nov 20246 Nov 20246 Nov 2025
479humphrieshealthsolutions.comGoDaddy.com, LLC12 Nov 202412 Nov 202412 Nov 2025
480humphries2.bizNetwork Solutions, LLC8 Dec 20248 Dec 20248 Dec 2025
481humphriesinvestments.comGoDaddy.com, LLC31 Dec 202431 Dec 202431 Dec 2025
482humphrieslandscaping.comGoogle, Inc.12 Jan 202512 Jan 202512 Jan 2026
483humphriesfitness.storeDOTSERVE INC.15 Jan 202515 Jan 202515 Jan 2026
484humphrieselectrical.co.uk-26 Jan 202526 Jan 202526 Jan 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=humphries

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now