With support for 
Keyword: JANES
Reverse Whois » KEYWORD [janes ] { 9,168 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | janes.com | Amazon Registrar, Inc. | 12 Aug 1994 | 7 Jul 2024 | 11 Aug 2025 |
| 2 | janes.us | Dynadot, LLC | 21 Mar 2021 | 18 Jul 2024 | 21 Mar 2025 |
| 3 | janes.town | Tucows Domains Inc. | 25 Aug 2014 | 29 Aug 2024 | 25 Aug 2025 |
| 4 | janes.xyz | Automattic Inc. | 25 Mar 2022 | 19 Dec 2023 | 25 Mar 2030 |
| 5 | janes.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Jan 2015 | 5 Jan 2015 | 5 Nov 2015 |
| 6 | janes.world | GoDaddy.com, LLC | 5 Jul 2016 | 19 Aug 2024 | 5 Jul 2025 |
| 7 | janes.flowers | Uniregistrar Corp | 7 Apr 2015 | 15 Mar 2017 | 7 Apr 2018 |
| 8 | janes.pro | Tucows Domains Inc. | 28 May 2015 | 1 Jun 2021 | 28 May 2022 |
| 9 | janes.de | - | - | 28 Aug 2015 | - |
| 10 | janes.news | GoDaddy.com, LLC | 20 Oct 2017 | 20 Oct 2017 | 20 Oct 2018 |
| 11 | janes.family | CloudFlare, Inc. | 7 May 2020 | 18 Feb 2024 | 7 May 2025 |
| 12 | janes.club | GoDaddy.com, LLC | 20 Oct 2017 | 21 Oct 2021 | 20 Oct 2022 |
| 13 | janes.technology | GoDaddy.com, LLC | 5 Jul 2016 | 19 Aug 2024 | 5 Jul 2025 |
| 14 | janes.tech | GoDaddy.com, LLC | 5 Jul 2016 | 6 Jul 2024 | 5 Jul 2025 |
| 15 | janes.life | GoDaddy.com, LLC | 5 Jul 2016 | 1 Aug 2024 | 5 Jul 2025 |
| 16 | janes.kitchen | GoDaddy.com, LLC | 5 Jul 2016 | 1 Aug 2024 | 5 Jul 2025 |
| 17 | janes.guru | GoDaddy.com, LLC | 5 Jul 2016 | 19 Aug 2024 | 5 Jul 2025 |
| 18 | janes.garden | GoDaddy.com, LLC | 5 Jul 2016 | 11 Jul 2024 | 5 Jul 2025 |
| 19 | janes.farm | GoDaddy.com, LLC | 5 Jul 2016 | 19 Aug 2024 | 5 Jul 2025 |
| 20 | janes.education | GoDaddy.com, LLC | 5 Jul 2016 | 19 Aug 2024 | 5 Jul 2025 |
| 21 | janes.company | GoDaddy.com, LLC | 5 Jul 2016 | 6 Jul 2024 | 5 Jul 2025 |
| 22 | janes.store | GoDaddy.com, LLC | 24 Jul 2023 | 25 Jul 2024 | 24 Jul 2025 |
| 23 | janes.top | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 16 Mar 2023 | 16 Mar 2023 | 16 Mar 2033 |
| 24 | janes.biz | CSC Corporate Domains, Inc. | 5 Oct 2001 | 7 Nov 2023 | 6 Nov 2024 |
| 25 | janes.info | Gandi SAS | 22 Sep 2001 | 24 Aug 2023 | 22 Sep 2024 |
| 26 | janes.mobi | HiChina Zhicheng Technology Limited | 26 Sep 2006 | 21 Sep 2017 | 26 Sep 2018 |
| 27 | janes.net | TurnCommerce, Inc. DBA NameBright.com | 30 Jul 2002 | 20 Jul 2024 | 30 Jul 2025 |
| 28 | janes.org | Tucows Domains Inc. | 13 Dec 1996 | 18 Nov 2023 | 12 Dec 2024 |
| 29 | janes.be | - | 8 Jun 2023 | - | - |
| 30 | janes.co | GoDaddy.com, LLC | 16 May 2017 | 26 Jun 2024 | 15 May 2025 |
| 31 | janes.ch | - | - | - | - |
| 32 | janes.me | GoDaddy.com, LLC | 8 Aug 2008 | 9 Aug 2017 | 8 Aug 2019 |
| 33 | janes.it | - | 9 Dec 2011 | 11 Apr 2024 | 9 Dec 2024 |
| 34 | janes.co.uk | - | 3 Oct 2009 | 27 Dec 2023 | 3 Oct 2025 |
| 35 | janes.tv | GoDaddy.com, LLC | 27 Feb 2019 | 28 Jun 2024 | 27 Feb 2025 |
| 36 | janes.ws | GoDaddy.com, LLC | 1 Mar 2007 | 2 Mar 2024 | 1 Mar 2025 |
| 37 | janes.website | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Dec 2020 | 29 Dec 2020 | 29 Dec 2021 |
| 38 | janes.one | Tucows Domains Inc. | 25 Apr 2017 | 6 Apr 2024 | 25 Apr 2025 |
| 39 | janes.salon | eNom, Inc. | 10 Jul 2017 | 10 Jul 2017 | 10 Jul 2018 |
| 40 | janes.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 23 Jul 2017 | 23 Jul 2017 | 23 Jul 2018 |
| 41 | janes.photos | GoDaddy.com, LLC | 11 Oct 2017 | 25 Nov 2019 | 11 Oct 2020 |
| 42 | janes.studio | GoDaddy.com, LLC | 20 Oct 2017 | 20 Oct 2017 | 20 Oct 2018 |
| 43 | janes.group | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Jun 2024 | 2 Jul 2024 | 27 Jun 2025 |
| 44 | janes.video | GoDaddy.com, LLC | 20 Oct 2017 | 20 Oct 2017 | 20 Oct 2018 |
| 45 | janes.me.uk | - | 15 Jan 2002 | 16 Dec 2023 | 15 Jan 2026 |
| 46 | janes.org.uk | - | 24 Jan 2000 | 17 Jan 2024 | 24 Jan 2026 |
| 47 | janes.uk.com | Reserved for non-billable transactions where Regis… | 7 Nov 2014 | 1 Nov 2017 | 7 Nov 2018 |
| 48 | janes.international | GoDaddy.com, LLC | 29 Mar 2018 | 13 May 2024 | 29 Mar 2025 |
| 49 | janes.online | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Apr 2018 | 22 May 2018 | 28 Apr 2019 |
| 50 | janes.page | Google, Inc. | 20 May 2021 | 4 Jul 2024 | 20 May 2025 |
| 51 | janes.supply | GoDaddy.com, LLC | 18 Dec 2018 | 15 Aug 2024 | 18 Dec 2025 |
| 52 | janes.dev | 1&1 Internet AG | 2 Mar 2019 | 16 Apr 2024 | 2 Mar 2025 |
| 53 | janes.business | GoDaddy.com, LLC | 7 Nov 2019 | 7 Nov 2019 | 7 Nov 2020 |
| 54 | janes.tel | Namesilo, LLC | 5 Jun 2020 | 11 Jun 2023 | 5 Jun 2033 |
| 55 | janes.global | GoDaddy.com, LLC | 29 Mar 2018 | 1 Aug 2024 | 29 Mar 2025 |
| 56 | janes.asia | CSC Corporate Domains, Inc. | 2 Jun 2017 | 3 Jun 2024 | 2 Jun 2025 |
| 57 | janes.money | Tucows Domains Inc. | 10 Dec 2020 | 15 Dec 2020 | 10 Dec 2030 |
| 58 | janes.network | Uniregistrar Corp | 12 Mar 2021 | 11 Apr 2022 | 12 Mar 2023 |
| 59 | janes.fund | register.com, Inc. | 26 Mar 2021 | 26 Mar 2021 | 26 Mar 2022 |
| 60 | janes.kiwi | Web Drive Ltd | 23 Nov 2016 | 7 Jan 2024 | 23 Nov 2024 |
| 61 | janes.place | NameCheap, Inc. | 25 Apr 2021 | 6 Jun 2023 | 25 Apr 2023 |
| 62 | janes.care | Key-Systems, LLC | 14 Dec 2021 | 27 Jan 2024 | 14 Dec 2025 |
| 63 | janes.dk | - | 26 Sep 2016 | - | 30 Sep 2025 |
| 64 | janes.space | GoDaddy.com, LLC | 18 Apr 2017 | 29 Jun 2023 | 18 Apr 2023 |
| 65 | janes.uk | - | 27 Mar 2019 | 27 Dec 2023 | 27 Mar 2025 |
| 66 | janes.co.jp | - | 7 Sep 2020 | 1 Oct 2023 | - |
| 67 | janes.com.br | - | 8 Jul 2008 | 7 Jul 2024 | 8 Jul 2025 |
| 68 | janes.com.cn | - | 20 Jan 2015 | - | 20 Jan 2025 |
| 69 | janes.moda | Gransy s.r.o. d/b/a subreg.cz | 26 Jan 2022 | 6 Mar 2024 | 26 Jan 2024 |
| 70 | janes.link | Namesilo, LLC | 6 Jun 2022 | 6 Jun 2023 | 6 Jun 2024 |
| 71 | janes.com.au | - | - | 23 Jul 2023 | - |
| 72 | janes.pt | - | - | - | - |
| 73 | janes.icu | Google, Inc. | 6 Mar 2023 | 6 May 2024 | 6 Mar 2024 |
| 74 | janes.earth | GoDaddy.com, LLC | 21 Mar 2022 | 10 Jun 2024 | 21 Mar 2025 |
| 75 | janes.fun | GoDaddy.com, LLC | 14 Apr 2022 | 25 Jun 2023 | 14 Apr 2023 |
| 76 | janes.lol | Dynadot, LLC | 24 Aug 2022 | 4 Oct 2023 | 24 Aug 2023 |
| 77 | janes.nl | - | 27 Aug 2014 | 24 Apr 2023 | - |
| 78 | janes.stream | NameCheap, Inc. | 20 Mar 2018 | 18 Feb 2023 | 20 Mar 2028 |
| 79 | janes.com.ng | - | 22 Oct 2022 | 19 Jan 2024 | 22 Oct 2023 |
| 80 | janes.vin | Gandi SAS | 20 Nov 2023 | 25 Nov 2023 | 20 Nov 2025 |
| 81 | janes.academy | Name.com, Inc. | 28 Nov 2023 | 25 Jun 2024 | 28 Nov 2024 |
| 82 | janes.computer | NameCheap, Inc. | 2 Jan 2024 | 7 Jan 2024 | 2 Jan 2025 |
| 83 | janes.house | Limited Liability Company "Registrar of domain nam… | 21 Feb 2024 | 26 Feb 2024 | 21 Feb 2025 |
| 84 | janes.app | Global Domains International, Inc. DBA DomainCostC… | 4 Mar 2024 | 9 Mar 2024 | 4 Mar 2025 |
| 85 | janes.live | NameCheap, Inc. | 23 Mar 2024 | 28 Mar 2024 | 23 Mar 2025 |
| 86 | janes.cafe | CloudFlare, Inc. | 25 Mar 2024 | 30 Mar 2024 | 25 Mar 2025 |
| 87 | janes.in | Dynadot, LLC | 3 Jan 2021 | 15 Dec 2023 | 3 Jan 2025 |
| 88 | janes.shop | NameKing.com Inc. | 5 Oct 2023 | 25 Dec 2023 | 5 Oct 2024 |
| 89 | janes.ru | - | 12 Jan 2007 | - | 12 Jan 2025 |
| 90 | janesvilleseo.net | GoDaddy.com, LLC | 20 Sep 2010 | 21 Sep 2023 | 20 Sep 2024 |
| 91 | janesaddiction.com | Network Solutions, LLC | 20 Nov 2000 | 28 Sep 2022 | 20 Nov 2026 |
| 92 | janesguide.com | Tucows Domains Inc. | 25 Jun 1998 | 26 May 2024 | 24 Jun 2025 |
| 93 | janestreet.com | MarkMonitor Inc. | 11 Jan 2003 | 10 Dec 2023 | 11 Jan 2026 |
| 94 | janeschwan.com | Dynadot7 LLC | 2 Jul 2016 | 28 Aug 2017 | 2 Jul 2018 |
| 95 | janeshealthykitchen.com | GoDaddy.com, LLC | 19 May 2012 | 22 Mar 2024 | 19 May 2026 |
| 96 | janesoft.net | Japan Registry Services Co., Ltd. | 20 Dec 2008 | 26 Oct 2023 | 20 Dec 2024 |
| 97 | janessabrazil.com | GoDaddy.com, LLC | 21 Jan 2008 | 9 Feb 2024 | 21 Jan 2025 |
| 98 | janesti.com | GoDaddy.com, LLC | 26 Jan 2024 | 26 Jan 2024 | 26 Jan 2025 |
| 99 | janestube.com | NameCheap, Inc. | 15 Oct 2012 | 15 Sep 2023 | 15 Oct 2024 |
| 100 | janesville.wi.us | Uber Australia E1 Pty Ltd | 31 Jan 2003 | 31 Dec 2014 | 30 Jan 2018 |
| 101 | janesauerlaw.com | GoDaddy.com, LLC | 21 Oct 2014 | 22 Oct 2023 | 21 Oct 2024 |
| 102 | janesplaces.com | GoDaddy.com, LLC | 22 Oct 2014 | 23 Oct 2016 | 22 Oct 2018 |
| 103 | janesfolly.com | TurnCommerce, Inc. DBA NameBright.com | 22 Oct 2014 | 16 Oct 2020 | 22 Oct 2023 |
| 104 | janeseedwellness.com | 1&1 Internet AG | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 105 | janesjourney.net | Dynadot, LLC | 4 May 2023 | 15 Jun 2024 | 4 May 2024 |
| 106 | janeshousebiz.com | Wild West Domains, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 107 | janeschultzart.com | Wild West Domains, LLC | 24 Oct 2014 | 25 Oct 2022 | 24 Oct 2024 |
| 108 | janesneakpeak.com | GoDaddy.com, LLC | 19 Jun 2012 | 27 Jun 2024 | 19 Jun 2025 |
| 109 | janeseandtim.com | GoDaddy.com, LLC | 24 May 2012 | 25 May 2015 | 24 May 2016 |
| 110 | janessa-newland.us | eNom, Inc. | 23 Oct 2014 | 23 Oct 2014 | 22 Oct 2015 |
| 111 | janessa-forester.us | eNom, Inc. | 23 Oct 2014 | 23 Oct 2014 | 22 Oct 2015 |
| 112 | janesvilleflowers.com | - | - | - | - |
| 113 | janeshousehunters.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 114 | janeschoi.com | Google, Inc. | 4 Feb 2020 | 29 Feb 2024 | 4 Feb 2025 |
| 115 | janesbargainhouses.com | GoDaddy.com, LLC | 25 Oct 2014 | 21 Oct 2015 | 25 Oct 2017 |
| 116 | janesfitness1.com | GoDaddy.com, LLC | 31 May 2013 | 31 May 2015 | 31 May 2016 |
| 117 | janeschwab.com | GoDaddy.com, LLC | 28 Dec 2015 | 10 May 2023 | 9 May 2026 |
| 118 | janesvillelandscaping.com | Tucows Domains Inc. | 28 Oct 2014 | 13 Oct 2023 | 28 Oct 2024 |
| 119 | janestorybooks.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2016 |
| 120 | janeshuhomebaking.com | register.com, Inc. | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 121 | janesfashion19.com | Wild West Domains, LLC | 27 Oct 2014 | 9 Oct 2016 | 27 Oct 2017 |
| 122 | janesvilleconcrete.com | GoDaddy.com, LLC | 26 Aug 2008 | 25 Aug 2024 | 26 Aug 2025 |
| 123 | janescatering.com | Network Solutions, LLC | 12 Feb 2011 | 13 Feb 2024 | 12 Feb 2025 |
| 124 | janestephenson.com | Google, Inc. | 7 Jul 2020 | 22 Jun 2024 | 7 Jul 2025 |
| 125 | janestephens.com | eNom, Inc. | 23 Sep 2010 | 19 Sep 2023 | 23 Sep 2024 |
| 126 | janesmeds.com | GoDaddy.com, LLC | 5 May 2019 | 5 May 2019 | 5 May 2020 |
| 127 | janesdepot.com | GoDaddy.com, LLC | 5 Mar 2014 | 6 Mar 2015 | 5 Mar 2016 |
| 128 | janespal.com | GoDaddy.com, LLC | 19 Feb 2014 | 5 May 2015 | 19 Feb 2016 |
| 129 | janeswollongong.com | Network Solutions, LLC | 28 Oct 2014 | 26 Oct 2017 | 28 Oct 2018 |
| 130 | janesjaunts.com | Realtime Register B.V. | 8 Apr 2024 | 7 Jun 2024 | 8 Apr 2025 |
| 131 | janesvilletv.com | GoDaddy.com, LLC | 26 Jun 2008 | 27 Jun 2015 | 26 Jun 2016 |
| 132 | janesdeals.com | GoDaddy.com, LLC | 4 Dec 2002 | 14 Nov 2023 | 4 Dec 2024 |
| 133 | janesjoy.com | TurnCommerce, Inc. DBA NameBright.com | 29 Oct 2014 | 26 Aug 2021 | 29 Oct 2024 |
| 134 | janesantos.com | eNom, Inc. | 10 Mar 2011 | 7 Mar 2024 | 10 Mar 2025 |
| 135 | janeshopping.com | Dynadot, LLC | 23 Jan 2024 | 8 May 2024 | 23 Jan 2025 |
| 136 | janesblond.com | Namesilo, LLC | 6 Jul 2008 | 17 May 2024 | 6 Jul 2025 |
| 137 | janesawyer.com | eNom, Inc. | 22 May 2012 | 25 May 2024 | 22 May 2025 |
| 138 | janestonewood.com | GoDaddy.com, LLC | 30 Jun 2013 | 10 Jun 2024 | 30 Jun 2025 |
| 139 | janestevens.com | eNom, Inc. | 28 Jun 2009 | 26 Jun 2024 | 28 Jun 2025 |
| 140 | janestothert.com | Domain.com, LLC | 12 Feb 2005 | 15 Dec 2023 | 12 Feb 2025 |
| 141 | janesaddiction-fc.info | Wild West Domains, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 142 | janesfoods.com | Webnames.ca Inc. | 8 Mar 2017 | 6 Jun 2024 | 8 Mar 2029 |
| 143 | janesvillecvb.com | Network Solutions, LLC | 30 Dec 1997 | 30 Oct 2023 | 29 Dec 2025 |
| 144 | janessabrazilnudes.com | GMO Internet Inc. | 1 Nov 2014 | 31 Oct 2016 | 31 Oct 2017 |
| 145 | janesharvina.com | GoDaddy.com, LLC | 31 Oct 2014 | 1 Nov 2022 | 31 Oct 2024 |
| 146 | janesaddicktion.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 147 | janeseeds.com | Hosting Concepts B.V. dba Openprovider | 16 Feb 2021 | 16 Feb 2021 | 16 Feb 2022 |
| 148 | janesblog.com | GoDaddy.com, LLC | 25 Feb 2005 | 26 Feb 2024 | 25 Feb 2025 |
| 149 | janesvilleserviceparts.com | eNom, Inc. | 24 Sep 2014 | 9 Feb 2015 | 24 Sep 2015 |
| 150 | janescarousel.com | Google, Inc. | 25 Sep 2006 | 17 May 2024 | 25 Sep 2024 |
| 151 | janeskofineart.com | GoDaddy.com, LLC | 28 Aug 2002 | 29 Aug 2024 | 28 Aug 2025 |
| 152 | janessabrazilclub.com | Namesilo, LLC | 12 Jul 2021 | 13 Jul 2021 | 12 Jul 2022 |
| 153 | janesbestvacuums.com | Beijing Lanhai Jiye Technology Co., Ltd | 13 May 2021 | 14 Jun 2024 | 13 May 2024 |
| 154 | janesjournal.com | GoDaddy.com, LLC | 30 Jan 2016 | 31 Jan 2024 | 30 Jan 2026 |
| 155 | janesdomain.com | GoDaddy.com, LLC | 17 Feb 2016 | 1 Apr 2016 | 17 Feb 2018 |
| 156 | janesville.biz | GoDaddy.com, LLC | 15 May 2010 | 28 May 2017 | 14 May 2018 |
| 157 | janesvillerv.com | Gransy s.r.o. d/b/a subreg.cz | 10 Feb 2021 | 10 Apr 2024 | 10 Feb 2025 |
| 158 | janesvillerealtor.com | NameCheap, Inc. | 14 Feb 2024 | 28 Mar 2024 | 14 Feb 2025 |
| 159 | janesdick.com | GoDaddy.com, LLC | 19 Apr 2021 | 31 May 2024 | 19 Apr 2024 |
| 160 | janeseymour.com | Network Solutions, LLC | 7 Jan 2000 | 9 Nov 2022 | 7 Jan 2028 |
| 161 | janesbarefootdreams.com | GKG.NET, INC. | 28 Mar 2014 | 16 Mar 2017 | 28 Mar 2018 |
| 162 | janesinger.com | GoDaddy.com, LLC | 4 Dec 1999 | 4 Sep 2022 | 4 Dec 2024 |
| 163 | janesvillehardware.com | CloudFlare, Inc. | 15 Aug 2006 | 16 Jul 2024 | 15 Aug 2025 |
| 164 | janesville.tv | Dynadot, LLC | 25 Jun 2011 | 26 Jun 2017 | 25 Jun 2017 |
| 165 | janesvilleonline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2014 | 25 May 2017 | 24 Jun 2018 |
| 166 | janeslittleworld.com | NameCheap, Inc. | 21 Mar 2019 | 20 Feb 2024 | 21 Mar 2025 |
| 167 | janesh.net | Dynadot8 LLC | 12 May 2014 | 6 Jun 2017 | 12 May 2018 |
| 168 | janestone.com | HiChina Zhicheng Technology Limited | 4 Dec 2009 | 5 Dec 2022 | 4 Dec 2024 |
| 169 | janesvilleacoustics.com | Network Solutions, LLC | 28 Jun 2006 | 29 Apr 2021 | 28 Jun 2026 |
| 170 | janesvillehousepainting.com | GoDaddy.com, LLC | 2 Nov 2014 | 3 Nov 2016 | 2 Nov 2017 |
| 171 | janesjewelrystore.com | register.com, Inc. | 2 Nov 2014 | 2 Nov 2014 | 2 Nov 2015 |
| 172 | janeshardware.com | GoDaddy.com, LLC | 2 Nov 2014 | 6 Nov 2023 | 2 Nov 2024 |
| 173 | janescoolast.com | Launchpad, Inc. | 2 Nov 2014 | 12 Nov 2016 | 2 Nov 2017 |
| 174 | janesvillewebdevelopment.com | eNom, Inc. | 9 May 2019 | 9 May 2019 | 9 May 2020 |
| 175 | janesvillewihomes.com | GoDaddy.com, LLC | 25 May 2012 | 5 Aug 2024 | 25 May 2024 |
| 176 | janeswalk.org | GoDaddy.com, LLC | 8 Mar 2007 | 20 Aug 2024 | 8 Mar 2025 |
| 177 | janesvillechryslerblog.com | GoDaddy.com, LLC | 8 Jun 2012 | 9 Jun 2015 | 8 Jun 2016 |
| 178 | janeseymourbotanicals.com | NameCheap, Inc. | 4 Mar 2010 | 18 Mar 2024 | 4 Mar 2026 |
| 179 | janesvillehairsalon.com | GoDaddy.com, LLC | 11 Jun 2013 | 12 Jun 2015 | 11 Jun 2016 |
| 180 | janessexstories.com | GoDaddy.com, LLC | 11 Jun 2008 | 11 Jun 2015 | 11 Jun 2016 |
| 181 | janesvillemorningrotary.org | GoDaddy.com, LLC | 24 Oct 2005 | 7 Aug 2024 | 24 Oct 2024 |
| 182 | janesofalltrades.us | GoDaddy.com, LLC | 12 Jun 2013 | 16 Jun 2014 | 11 Jun 2015 |
| 183 | janesvillegazette.com | Network Solutions, LLC | 26 Aug 1998 | 12 Sep 2021 | 25 Aug 2025 |
| 184 | janesthumbs.com | NameCheap, Inc. | 20 Jun 2004 | 15 Jul 2024 | 20 Jun 2025 |
| 185 | janesassaman.com | Tucows Domains Inc. | 13 Jun 2001 | 13 Jun 2024 | 13 Jun 2025 |
| 186 | janesiberry.com | Tucows Domains Inc. | 3 Aug 1999 | 4 Jul 2024 | 3 Aug 2025 |
| 187 | janesphotoimpressions.net | GoDaddy.com, LLC | 6 Jul 2012 | 25 Jun 2015 | 6 Jul 2016 |
| 188 | janesoceania.com | GoDaddy.com, LLC | 29 Sep 2002 | 29 Sep 2023 | 29 Sep 2024 |
| 189 | janesstockingsandfeet.com | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Nov 2019 | 27 Nov 2019 | 27 Nov 2020 |
| 190 | janespatisserie.com | Wild West Domains, LLC | 3 Nov 2014 | 4 Oct 2023 | 3 Nov 2024 |
| 191 | janessvitonerealestate.com | GoDaddy.com, LLC | 25 Jul 2023 | 30 Jul 2024 | 25 Jul 2025 |
| 192 | janesradiant.com | Network Solutions, LLC | 10 Jun 2009 | 11 Apr 2024 | 10 Jun 2029 |
| 193 | janeslawblog.com | Above.com Pty Ltd. | 20 Dec 2013 | 12 Dec 2023 | 20 Dec 2024 |
| 194 | janesartglass.com | Tucows Domains Inc. | 27 Jul 2024 | 27 Jul 2024 | 27 Jul 2025 |
| 195 | janessaddlebag.com | GoDaddy.com, LLC | 20 Oct 2005 | 3 Sep 2022 | 20 Oct 2024 |
| 196 | janeschmidthomes.com | GoDaddy.com, LLC | 13 May 2008 | 14 May 2023 | 13 May 2025 |
| 197 | janeslonglastinglips.com | Google, Inc. | 7 Jun 2022 | 7 Jul 2024 | 7 Jun 2024 |
| 198 | janescanvascreations.com | register.com, Inc. | 17 Aug 2014 | 2 Aug 2016 | 17 Aug 2018 |
| 199 | janeskitchens.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2016 | 18 Aug 2017 |
| 200 | janesvillevwblog.com | GoDaddy.com, LLC | 13 Jun 2012 | 14 Jun 2015 | 13 Jun 2016 |
| 201 | janesadler.com | DropCatch.com 498 LLC | 5 Nov 2015 | 6 Nov 2016 | 5 Nov 2017 |
| 202 | janessabellydance.net | Tucows Domains Inc. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 203 | janesenergy.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 24 Jun 2015 | 1 May 2017 | 24 Jun 2019 |
| 204 | janesfacesonfilm.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 205 | janeshealing.com | Domain.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 206 | janesheffield.com | NameCheap, Inc. | 27 May 2022 | - | 27 May 2023 |
| 207 | janesta.com | Moniker Online Services LLC | 14 Sep 2017 | 14 Sep 2023 | 14 Sep 2024 |
| 208 | janeswhiteglove.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Jun 2015 | 23 Jun 2017 | 24 Jun 2018 |
| 209 | janesadowsky.biz | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 19 Aug 2015 |
| 210 | janesadowsky.info | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 211 | janesadowsky.mobi | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 212 | janesadowsky.net | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 213 | janesadowsky.org | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 214 | janesbeautyhouse.com | GoDaddy.com, LLC | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 215 | janesu.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Jan 2020 | 5 Jul 2024 | 17 Jan 2025 |
| 216 | janesville-fast-profits-at-home.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 217 | janesafe.com | GoDaddy.com, LLC | 1 Feb 2024 | 1 Feb 2024 | 1 Feb 2025 |
| 218 | janesvoice.com | DROPCATCH.COM 782 LLC | 13 Apr 2023 | 13 Apr 2023 | 13 Apr 2024 |
| 219 | janeswayliving.com | GoDaddy.com, LLC | 12 Jan 2015 | 13 Jan 2024 | 12 Jan 2025 |
| 220 | janesmithsocialsecurity.com | eNom, Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 221 | janesfootprintski.com | Namesilo, LLC | 9 Jun 2019 | 9 Jun 2019 | 9 Jun 2020 |
| 222 | janeschlossberg.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2016 |
| 223 | janesoneyeargoal.com | eNom, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 224 | janesplayground.com | GoDaddy.com, LLC | 21 Aug 2014 | 16 Sep 2022 | 8 Mar 2027 |
| 225 | janestotalfitness.com | GoDaddy.com, LLC | 10 May 2015 | 10 May 2015 | 10 May 2017 |
| 226 | janesvillecarereview.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 227 | janesvillediesel.com | GoDaddy.com, LLC | 7 Feb 2015 | 15 Nov 2022 | 15 Nov 2027 |
| 228 | janeslombardo.com | RegistryGate GmbH | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 229 | janeseskin.com | GoDaddy.com, LLC | 28 Feb 2015 | 10 Jul 2024 | 28 Feb 2026 |
| 230 | janeskidmore.com | GoDaddy.com, LLC | 23 Aug 2014 | 23 Aug 2014 | 23 Aug 2015 |
| 231 | janesteindesign.com | Gandi SAS | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 232 | janeslifestyle.org | Tucows Domains Inc. | 23 Aug 2014 | 27 Aug 2015 | 23 Aug 2016 |
| 233 | janestrangeways.com | GoDaddy.com, LLC | 12 Aug 2014 | 13 Aug 2024 | 12 Aug 2026 |
| 234 | janestreetwr.com | Wild West Domains, LLC | 12 Aug 2014 | 23 Jun 2016 | 12 Aug 2017 |
| 235 | janestattoo.com | GoDaddy.com, LLC | 8 Nov 2014 | 9 Nov 2022 | 8 Nov 2024 |
| 236 | janessabrizil.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 237 | janesellshouse.com | GoDaddy.com, LLC | 13 Aug 2014 | 14 Aug 2016 | 13 Aug 2018 |
| 238 | janeshobbyblogg.com | Wild West Domains, LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 239 | janespetsitting.com | GoDaddy.com, LLC | 13 Jul 2016 | 21 Aug 2024 | 13 Jul 2025 |
| 240 | janesheart.org | eNom, Inc. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 241 | janespearkingart.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2016 |
| 242 | janesilcock.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 243 | janesantucci.com | GoDaddy.com, LLC | 15 Aug 2014 | 16 Sep 2022 | 15 Aug 2025 |
| 244 | janescpa.com | register.com, Inc. | 14 Aug 2014 | 15 Aug 2024 | 14 Aug 2025 |
| 245 | janescakecreations.com | - | 23 Jul 2022 | 24 Jul 2023 | 23 Jul 2024 |
| 246 | janesellsaustinhomes.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2019 |
| 247 | janeshuffer.com | Network Solutions, LLC | 27 Aug 2014 | 28 Jun 2024 | 27 Aug 2025 |
| 248 | janesnyman.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 249 | janesvillenerd.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2016 |
| 250 | janese.org | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 251 | janesisco.com | Tucows Domains Inc. | 23 Oct 2003 | 8 Oct 2023 | 23 Oct 2024 |
| 252 | janespuppiesandkittens.com | Domain.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 253 | janespilsbury.com | Launchpad, Inc. | 10 Nov 2014 | 25 Oct 2017 | 10 Nov 2018 |
| 254 | janescleaning.com | TurnCommerce, Inc. DBA NameBright.com | 23 Jan 2016 | 17 Jan 2021 | 23 Jan 2025 |
| 255 | janesenglish.com | GoDaddy.com, LLC | 19 Jul 2017 | 20 Jul 2023 | 19 Jul 2025 |
| 256 | janesarchet.com | Webfusion Ltd. | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2016 |
| 257 | janesson.com | Tucows Domains Inc. | 16 Aug 2014 | 20 Aug 2015 | 16 Aug 2016 |
| 258 | janesa.net | Beijing Lanhai Jiye Technology Co., Ltd | 13 Jul 2021 | 14 Jul 2023 | 13 Jul 2024 |
| 259 | janeshemis.com | Register NV dba Register.eu | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 260 | janesvillehomeremodelers.com | GoDaddy.com, LLC | 29 Aug 2014 | 25 Aug 2016 | 29 Aug 2017 |
| 261 | janeshomestead.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 262 | janesboypress.com | TLDs LLC dba SRSplus | 2 Dec 2021 | 2 Dec 2021 | 2 Dec 2022 |
| 263 | janesgardendesign.com | Tucows Domains Inc. | 11 Sep 2006 | 13 Sep 2023 | 11 Sep 2024 |
| 264 | janesparade.com | GoDaddy.com, LLC | 12 Sep 2014 | 16 Sep 2022 | 12 Sep 2024 |
| 265 | janesvillecriminaldefenselawyer.com | Tucows Domains Inc. | 9 Sep 2010 | 13 Sep 2014 | 9 Sep 2015 |
| 266 | janesparade.net | GoDaddy.com, LLC | 12 Sep 2014 | 16 Sep 2022 | 12 Sep 2024 |
| 267 | janestevendesign.com | GoDaddy.com, LLC | 13 Sep 2014 | 14 Sep 2016 | 13 Sep 2018 |
| 268 | janestevendesign.net | GoDaddy.com, LLC | 13 Sep 2014 | 14 Sep 2016 | 13 Sep 2018 |
| 269 | janessa-woolverton.us | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 12 Sep 2015 |
| 270 | janestevendesign.org | GoDaddy.com, LLC | 13 Sep 2014 | 14 Sep 2016 | 13 Sep 2018 |
| 271 | janesellsfloridahouses.com | GoDaddy.com, LLC | 15 Sep 2014 | 17 Sep 2022 | 15 Sep 2025 |
| 272 | janesgiftwrapping.info | 1&1 Internet AG | 15 Sep 2014 | - | 15 Sep 2015 |
| 273 | janesgiftwrapping.net | 1&1 Internet AG | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 274 | janesgiftwrapping.org | 1&1 Internet AG | 15 Sep 2014 | - | 15 Sep 2015 |
| 275 | janesvillechurch.org | DreamHost, LLC | 5 Sep 2009 | 10 Aug 2024 | 5 Sep 2025 |
| 276 | janeskigroup.com | Google, Inc. | 15 Nov 2014 | 1 Jun 2024 | 15 Nov 2024 |
| 277 | janesfashionista.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 278 | janesgiftwrapping.us | 1&1 Internet AG | 15 Sep 2014 | - | 14 Sep 2015 |
| 279 | janessa-vrooman.us | eNom, Inc. | 2 Sep 2014 | 2 Sep 2014 | 1 Sep 2015 |
| 280 | janesscienceplace.com | Tucows Domains Inc. | 29 Aug 2013 | 2 Sep 2014 | 29 Aug 2015 |
| 281 | janesgiftwrapping.biz | 1&1 Internet AG | 15 Sep 2014 | - | 14 Sep 2015 |
| 282 | janesgiftwrapping.com | 1&1 Internet AG | 15 Sep 2014 | 16 Sep 2016 | 15 Sep 2017 |
| 283 | janespuppies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 284 | janescupcakeshop.net | Domain.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 285 | janesellsvegas.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2016 |
| 286 | janesgiftideas.com | Tucows Domains Inc. | 3 Sep 2014 | 7 Sep 2015 | 3 Sep 2016 |
| 287 | janesia.net | Tucows Domains Inc. | 3 Sep 2014 | 7 Sep 2015 | 3 Sep 2016 |
| 288 | janesjam.com | GoDaddy.com, LLC | 23 Nov 2021 | 23 Nov 2023 | 23 Nov 2025 |
| 289 | janessaftupas.com | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2016 | 4 Sep 2018 |
| 290 | janestreetgrill.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Nov 2022 | 27 Jun 2024 | 21 Nov 2024 |
| 291 | janesescorts.com | 1&1 Internet AG | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 292 | janesyogastudio.com | - | 29 Jul 2016 | 29 Jul 2016 | 29 Jul 2017 |
| 293 | janeschoonmakerrodgers.com | 1&1 Internet AG | 15 Nov 2014 | 17 May 2019 | 15 Nov 2024 |
| 294 | janesgoldleaf.com | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2016 |
| 295 | janessawilson.com | Bizcn.com, Inc. | 18 Apr 2019 | 17 Apr 2019 | 18 Apr 2020 |
| 296 | janesheba.com | eNom, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 297 | janespetcare.com | GoDaddy.com, LLC | 29 Mar 2023 | 29 Mar 2023 | 29 Mar 2025 |
| 298 | janesnaturalhouse.com | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 299 | janesnaturalhome.com | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 300 | janesoft.com | Dynadot, LLC | 2 Dec 2022 | 5 Jan 2024 | 2 Dec 2024 |
| 301 | janesellshouston.com | Domain.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2016 |
| 302 | janesaundersmedia.net | register.com, Inc. | 18 Sep 2014 | 3 Sep 2017 | 18 Sep 2018 |
| 303 | janescoolschool.com | Wild West Domains, LLC | 18 Sep 2014 | 18 Aug 2023 | 18 Sep 2024 |
| 304 | janesgrains.org | Network Solutions, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 305 | janesasansor.com | Nobel Networks | 27 Aug 2012 | 5 Sep 2014 | 27 Aug 2015 |
| 306 | janescrib.com | GoDaddy.com, LLC | 12 Jul 2019 | 12 Jul 2019 | 12 Jul 2020 |
| 307 | janeshore.org | - | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2017 |
| 308 | janesmell.com | FBS Inc. | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 309 | janesoon.com | HiChina Zhicheng Technology Limited | 5 Sep 2014 | 27 Aug 2017 | 5 Sep 2018 |
| 310 | janesvintagecreations.com | register.com, Inc. | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 311 | janesyarnpatternscom.com | GoDaddy.com, LLC | 5 Sep 2014 | 6 Sep 2016 | 5 Sep 2018 |
| 312 | janessery.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Sep 2014 | 1 Sep 2016 | 6 Sep 2017 |
| 313 | janesrews.com | eNom, Inc. | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 314 | janeshsports.com | Network Solutions, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 315 | janeshortallwriter.com | Wild West Domains, LLC | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 316 | janesmithart.com | register.com, Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 317 | janesstage.com | GoDaddy.com, LLC | 16 Oct 2019 | 16 Oct 2019 | 16 Oct 2020 |
| 318 | janesudano.com | FastDomain Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 319 | janesjewellery.com | TurnCommerce, Inc. DBA NameBright.com | 6 Mar 2019 | 28 Feb 2021 | 6 Mar 2024 |
| 320 | janesayz.com | GoDaddy.com, LLC | 19 Nov 2014 | 12 Apr 2024 | 31 Mar 2025 |
| 321 | janessacuba.com | GoDaddy.com, LLC | 26 Jul 2017 | 25 Jul 2024 | 26 Jul 2025 |
| 322 | janes-haven.com | GoDaddy.com, LLC | 31 Oct 2019 | 31 Oct 2019 | 31 Oct 2020 |
| 323 | janesvillewisconsinclassifieds.com | Wild West Domains, LLC | 2 Oct 2014 | 4 Aug 2016 | 2 Oct 2017 |
| 324 | janescontracting.net | easyDNS Technologies, Inc. | 29 Sep 2013 | 3 Oct 2014 | 29 Sep 2015 |
| 325 | janesenterprises.org | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 326 | janesandbankgroup.com | FastDomain Inc. | 10 Sep 2014 | 27 Aug 2023 | 10 Sep 2024 |
| 327 | janeshottheapple.com | Gandi SAS | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 328 | janesvillelocksmith.com | GoDaddy.com, LLC | 28 Aug 2016 | 29 Sep 2022 | 28 Aug 2026 |
| 329 | janessanichole.com | Tucows Domains Inc. | 1 Oct 2014 | 5 Oct 2019 | 1 Oct 2019 |
| 330 | janesrealtysc.com | Tucows Domains Inc. | 1 Oct 2009 | 5 Oct 2014 | 1 Oct 2015 |
| 331 | janesplacezh.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 8 Sep 2011 | 10 Jun 2017 | 8 Sep 2017 |
| 332 | janesorganicbeauty.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2016 |
| 333 | janeswearingin.com | GoDaddy.com, LLC | 2 Oct 2014 | 27 Sep 2016 | 2 Oct 2017 |
| 334 | janesenterprises.info | GoDaddy.com, LLC | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 335 | janesoap.com | Century Oriental International Co., Ltd. | 27 Apr 2015 | 28 Apr 2021 | 27 Apr 2025 |
| 336 | janesutcliffe.info | GoDaddy.com, LLC | 22 Sep 2014 | 4 Jul 2024 | 22 Sep 2024 |
| 337 | janesaysdiy.com | GoDaddy.com, LLC | 22 Sep 2014 | 23 Sep 2023 | 22 Sep 2025 |
| 338 | janesoulwellness.com | 1&1 Internet AG | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 339 | janesutcliffe.net | GoDaddy.com, LLC | 22 Sep 2014 | 23 Sep 2023 | 22 Sep 2024 |
| 340 | janeswar.com | GoDaddy.com, LLC | 22 Sep 2014 | 15 Sep 2016 | 22 Sep 2018 |
| 341 | janesgold.com | Beijing Lanhai Jiye Technology Co., Ltd | 10 Dec 2021 | 11 Dec 2023 | 10 Dec 2024 |
| 342 | janescherrn.com | GoDaddy.com, LLC | 6 Oct 2014 | 6 Oct 2022 | 6 Oct 2024 |
| 343 | janescox.com | Launchpad, Inc. | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 344 | janesdarkestsecrets.com | Tucows Domains Inc. | 10 Jun 2004 | 11 May 2024 | 10 Jun 2025 |
| 345 | janessa-lawley.us | eNom, Inc. | 22 Sep 2014 | 22 Sep 2014 | 21 Sep 2015 |
| 346 | janesclosets.com | GoDaddy.com, LLC | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 347 | janespiers.com | NameCheap, Inc. | 20 Nov 2014 | 26 Nov 2023 | 20 Nov 2026 |
| 348 | janesmeubels.com | Cronon AG | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 349 | janesbeautyshop.com | 1&1 Internet AG | 7 Oct 2014 | 7 Oct 2016 | 7 Oct 2017 |
| 350 | janesgallerie.com | GoDaddy.com, LLC | 24 Nov 2023 | 24 Nov 2023 | 24 Nov 2024 |
| 351 | janesvillemn.com | TurnCommerce, Inc. DBA NameBright.com | 6 Oct 2014 | 6 Apr 2020 | 6 Oct 2024 |
| 352 | janeswift.com | - | 18 Dec 2023 | 18 Dec 2023 | 18 Dec 2024 |
| 353 | janesay.com | Metaregistrar BV Applications | 12 Jun 2023 | 26 Jun 2024 | 12 Jun 2024 |
| 354 | janeskinny.com | Tucows Domains Inc. | 7 Oct 2014 | 11 Oct 2015 | 7 Oct 2016 |
| 355 | janespups.com | LiteDomains LLC | 27 Sep 2014 | 28 Sep 2017 | 27 Sep 2018 |
| 356 | janestormwalker.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2016 | 28 Sep 2017 |
| 357 | janeseymourhealth.com | register.com, Inc. | 29 May 2017 | 4 Dec 2017 | 29 May 2018 |
| 358 | janesiz.com | PSI-USA, Inc. dba Domain Robot | 1 Sep 2020 | 2 Sep 2020 | 1 Sep 2021 |
| 359 | janesparango.com | register.com, Inc. | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 360 | janestray.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2017 |
| 361 | janesvillewi.org | Namesilo, LLC | 30 Aug 2012 | 27 Sep 2017 | 30 Aug 2018 |
| 362 | janesvilleusedautos.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 363 | janesvillewi.net | Omnis Network, LLC | 30 Aug 2012 | 27 Sep 2017 | 30 Aug 2018 |
| 364 | janesvillewisconsin.net | Omnis Network, LLC | 30 Aug 2012 | 27 Sep 2017 | 30 Aug 2018 |
| 365 | janestinn.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 366 | janesuniverse.com | NameCheap, Inc. | 25 Feb 2018 | 25 Feb 2018 | 25 Feb 2019 |
| 367 | janesorensen.com | DropCatch.com 560 LLC | 2 Jul 2022 | 12 Sep 2023 | 2 Jul 2023 |
| 368 | janessa-fritsch.us | eNom, Inc. | 10 Oct 2014 | 10 Oct 2014 | 9 Oct 2015 |
| 369 | janescouture.com | TurnCommerce, Inc. DBA NameBright.com | 9 Dec 2013 | 3 Dec 2020 | 9 Dec 2024 |
| 370 | janesquare.info | GoDaddy.com, LLC | 16 Oct 2014 | 17 Oct 2014 | 16 Oct 2015 |
| 371 | janestravel.com | TurnCommerce, Inc. DBA NameBright.com | 11 Mar 2013 | 27 Aug 2021 | 11 Mar 2024 |
| 372 | janesvillewiflorist.com | Interweb Advertising D.B.A. Profile Builder | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 373 | janesstitches.com | DropCatch.com 482 LLC | 11 Jul 2016 | 12 Jul 2017 | 11 Jul 2018 |
| 374 | janesmt-win.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2017 |
| 375 | janesmarketing.com | GoDaddy.com, LLC | 23 Aug 2022 | 23 Aug 2024 | 23 Aug 2025 |
| 376 | janeseccombe.com | eNom, Inc. | 24 Nov 2014 | 26 Oct 2016 | 24 Nov 2017 |
| 377 | janesquilting.com | Network Solutions, LLC | 19 Sep 2023 | 26 Sep 2023 | 19 Sep 2024 |
| 378 | janesutanto.com | Key-Systems GmbH | 15 Jul 2021 | 8 Jul 2022 | 15 Jul 2022 |
| 379 | janesianphotography.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 380 | janesian.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 381 | janesexy.com | Domain.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2016 |
| 382 | janesandhartonlaw.com | Tucows Domains Inc. | 17 Oct 2014 | 21 Oct 2017 | 17 Oct 2017 |
| 383 | janesazykina.com | Name.com, Inc. | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 384 | janesuji.com | GoDaddy.com, LLC | 14 Oct 2014 | 11 Sep 2023 | 14 Oct 2024 |
| 385 | janescarousel.org | Google, Inc. | 14 Oct 2008 | 17 May 2024 | 14 Oct 2024 |
| 386 | janesbeautyavenue.com | Mesh Digital Limited | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 387 | janesvillerelayforlife.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 388 | janesbarbershop.com | GoDaddy.com, LLC | 14 Oct 2008 | 6 Feb 2024 | 14 Oct 2024 |
| 389 | janescotinc.org | Tucows Domains Inc. | 15 Oct 2014 | 19 Oct 2015 | 15 Oct 2016 |
| 390 | janesyoghurt.com | Tucows Domains Inc. | 15 Oct 2014 | 19 Oct 2015 | 15 Oct 2016 |
| 391 | janesvillestorage.com | eNom, Inc. | 26 Nov 2014 | 30 Oct 2017 | 26 Nov 2018 |
| 392 | janestroschin.com | Xin Net Technology Corporation | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 393 | janesessentials.com | Domain.com, LLC | 26 Feb 2020 | 11 Apr 2023 | 26 Feb 2023 |
| 394 | janesguitar.com | Gabia, Inc. | 28 Nov 2014 | 23 Nov 2023 | 28 Nov 2024 |
| 395 | janessa-anson.us | eNom, Inc. | 26 Nov 2014 | 26 Nov 2014 | 25 Nov 2015 |
| 396 | janessajohnsrude.com | Tucows Domains Inc. | 28 Nov 2014 | 2 Dec 2017 | 28 Nov 2017 |
| 397 | janessaharmon.com | Google, Inc. | 28 Nov 2014 | 28 Jun 2024 | 28 Nov 2024 |
| 398 | janesfavorite.com | - | 20 Feb 2021 | 20 Feb 2021 | 20 Feb 2022 |
| 399 | janeschleppenbachart.com | Global Domain Name Trading Center Ltd | 1 Nov 2021 | 1 Nov 2021 | 1 Nov 2022 |
| 400 | janestain.com | Tucows Domains Inc. | 1 Dec 2014 | 30 Nov 2023 | 1 Dec 2024 |
| 401 | janeseilts.com | 1&1 Internet AG | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 402 | janesvilletech.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2023 | 2 Dec 2024 |
| 403 | janessoftware.com | Tucows Domains Inc. | 1 Dec 2014 | 5 Dec 2018 | 1 Dec 2018 |
| 404 | janesvilleteachers.org | GMO Internet Inc. | 30 Nov 2014 | 17 Jul 2015 | 30 Nov 2015 |
| 405 | janeserene.com | Dynadot, LLC | 18 Feb 2023 | 19 Feb 2024 | 18 Feb 2025 |
| 406 | janeshe.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2017 |
| 407 | janesafarian.com | NameBake LLC | 20 Feb 2024 | 21 Feb 2024 | 20 Feb 2025 |
| 408 | janesacchi.org | Tucows Domains Inc. | 2 Dec 2014 | 23 Nov 2023 | 2 Dec 2024 |
| 409 | janes-addiction.info | Dynadot, LLC | 6 Dec 2014 | 10 Oct 2017 | 6 Dec 2018 |
| 410 | janeswhatnots.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2016 |
| 411 | janeso.com | TurnCommerce, Inc. DBA NameBright.com | 25 Feb 2017 | 19 Feb 2021 | 25 Feb 2025 |
| 412 | janestraley.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 413 | janestiger.com | Network Solutions, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 414 | janesmellsgreat.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2016 |
| 415 | janeseafood.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Mar 2022 | 22 Aug 2024 | 3 Mar 2025 |
| 416 | janesboudoir.com | GoDaddy.com, LLC | 11 Oct 2015 | 11 Oct 2015 | 11 Oct 2016 |
| 417 | janesvillecollisioncenter.com | Network Solutions, LLC | 9 Dec 2014 | 28 Sep 2020 | 9 Dec 2025 |
| 418 | janesvillebodyshop.com | Network Solutions, LLC | 9 Dec 2014 | 28 Sep 2020 | 9 Dec 2025 |
| 419 | janesvilleautobody.com | Network Solutions, LLC | 9 Dec 2014 | 28 Sep 2020 | 9 Dec 2025 |
| 420 | janeslakellc.com | register.com, Inc. | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 421 | janesjourneys.com | Domain.com, LLC | 23 Mar 2003 | 12 May 2023 | 23 Mar 2028 |
| 422 | janeswebdeals.com | eNom, Inc. | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 423 | janessglobal.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2019 |
| 424 | janesseglobal.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2019 |
| 425 | janesheehanco.com | Marcaria.com International, Inc. | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 426 | janesglobal.com | GoDaddy.com, LLC | 10 Dec 2014 | 26 Jan 2024 | 10 Dec 2024 |
| 427 | janeshelly.com | register.com, Inc. | 11 Dec 2014 | 11 Nov 2023 | 11 Dec 2024 |
| 428 | janescounselling.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 429 | janesvillewebsites.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 430 | janeschreiner.us | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2016 | 11 Dec 2017 |
| 431 | janesoftware.com | 1API GmbH | 15 Dec 2014 | 4 Apr 2023 | 15 Dec 2024 |
| 432 | janesnowmd.com | Tucows Domains Inc. | 16 Dec 2014 | 20 Dec 2015 | 16 Dec 2016 |
| 433 | janessawalters.com | GoDaddy.com, LLC | 16 Dec 2014 | 23 Dec 2016 | 16 Dec 2017 |
| 434 | janesartisanjewelry.com | GoDaddy.com, LLC | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 435 | janessa-holm.us | eNom, Inc. | 16 Dec 2014 | 16 Dec 2014 | 15 Dec 2015 |
| 436 | janesvilletowing.com | Namesilo, LLC | 26 May 2021 | 29 Jun 2023 | 26 May 2023 |
| 437 | janesdecorations.com | Tucows Domains Inc. | 16 Dec 2009 | 20 Dec 2014 | 16 Dec 2015 |
| 438 | janesclothing.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Aug 2022 | 4 Aug 2024 | 3 Aug 2025 |
| 439 | janesneha.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 440 | janesvillesmokeshop.com | GoDaddy.com, LLC | 23 Dec 2014 | 29 Nov 2023 | 23 Dec 2026 |
| 441 | janesterntarot.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Nov 2013 | 23 Dec 2014 | 22 Nov 2015 |
| 442 | janespetcareservice.com | Tucows Domains Inc. | 24 Dec 2014 | 28 Dec 2015 | 24 Dec 2016 |
| 443 | janeshjolapeshbi.com | GoDaddy.com, LLC | 29 Jun 2019 | 29 Jun 2019 | 29 Jun 2020 |
| 444 | janesbaking.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2016 |
| 445 | janesweetbaking.com | Tucows Domains Inc. | 27 Dec 2014 | 31 Dec 2019 | 27 Dec 2019 |
| 446 | janestopthiscrazything.net | Tucows Domains Inc. | 26 Dec 2014 | 25 Dec 2023 | 26 Dec 2024 |
| 447 | janeschrader.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 448 | janestopthiscrazything.org | Tucows Domains Inc. | 26 Dec 2014 | 30 Dec 2023 | 26 Dec 2024 |
| 449 | janesvillests.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 450 | janeseandmckenzi.com | GoDaddy.com, LLC | 29 Dec 2014 | 30 Dec 2023 | 29 Dec 2024 |
| 451 | janesomers.net | Tucows Domains Inc. | 28 Dec 2014 | 21 Dec 2023 | 28 Dec 2024 |
| 452 | janestrisikstudio.com | Namesilo, LLC | 1 Jan 2015 | 13 Jan 2016 | 1 Jan 2017 |
| 453 | janesocialmediamarketing.com | register.com, Inc. | 31 Dec 2014 | 1 Dec 2018 | 31 Dec 2024 |
| 454 | janesystems.com | TurnCommerce, Inc. DBA NameBright.com | 22 Mar 2018 | 16 Mar 2021 | 22 Mar 2024 |
| 455 | janesapoms.com | GoDaddy.com, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2017 |
| 456 | janestine.com | Wild West Domains, LLC | 2 Jan 2015 | 2 Dec 2023 | 2 Jan 2025 |
| 457 | janeskipper.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 458 | janesjems.com | GoDaddy.com, LLC | 4 Jan 2015 | 10 Jul 2024 | 9 Jul 2025 |
| 459 | janesalmondmilk.com | eNom, Inc. | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 460 | janestartzproductions.xyz | Network Solutions, LLC | 12 Jul 2014 | 12 Jul 2014 | 12 Jul 2015 |
| 461 | janeschmidtparentcoach.xyz | Network Solutions, LLC | 19 Jul 2014 | 21 Jul 2014 | 19 Jul 2015 |
| 462 | janespuppyplace.xyz | Network Solutions, LLC | 23 Jul 2014 | 23 Jul 2014 | 23 Jul 2015 |
| 463 | janescakes.xyz | Network Solutions, LLC | 22 Jul 2014 | 23 Jul 2014 | 22 Jul 2015 |
| 464 | janesbrews.guru | GoDaddy.com, LLC | 25 Jul 2014 | 6 Jan 2017 | 25 Jul 2017 |
| 465 | janesbrews.expert | GoDaddy.com, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 466 | janesbrew.guru | GoDaddy.com, LLC | 25 Jul 2014 | 6 Jan 2017 | 25 Jul 2017 |
| 467 | janesbrew.expert | GoDaddy.com, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 468 | janeskitchen.guru | GoDaddy.com, LLC | 18 Aug 2014 | 29 Sep 2017 | 18 Aug 2018 |
| 469 | janesville.blackfriday | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 470 | janessa.hiphop | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 471 | janesville.christmas | Uniregistrar Corp | 30 Sep 2014 | 1 Oct 2014 | 30 Sep 2015 |
| 472 | janesvillefirst.church | GoDaddy.com, LLC | 9 Oct 2014 | 14 Oct 2018 | 9 Oct 2020 |
| 473 | janestreet.london | MarkMonitor Inc. | 16 Oct 2014 | 31 Aug 2023 | 16 Oct 2024 |
| 474 | janessabrazil.pics | 1API GmbH | 21 Oct 2014 | 9 Feb 2024 | 21 Oct 2024 |
| 475 | janestreet.nyc | Hello Internet Corp. | 8 Oct 2014 | 12 Oct 2019 | 7 Oct 2020 |
| 476 | janeshao.com | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Jul 2018 | 14 Aug 2024 | 1 Jul 2024 |
| 477 | janesville.webcam | Alpnames Limited | 28 Oct 2014 | - | 27 Oct 2015 |
| 478 | janesville.trade | Alpnames Limited | 28 Oct 2014 | - | 27 Oct 2015 |
| 479 | janestreet.capital | MarkMonitor Inc. | 18 Jun 2020 | 22 May 2024 | 18 Jun 2026 |
| 480 | janesville.healthcare | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2016 |
| 481 | janesstudio.gallery | GoDaddy.com, LLC | 17 Nov 2014 | 5 Jul 2024 | 17 Nov 2024 |
| 482 | janesimmons.expert | Melbourne IT, Ltd | 22 Nov 2014 | 19 Nov 2023 | 22 Nov 2024 |
| 483 | janestory.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 28 Nov 2014 | 28 Nov 2014 | 28 Oct 2016 |
| 484 | janescakes.menu | Network Solutions, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 485 | janeswalk.nyc | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 10 Dec 2015 |
| 486 | janeshilton.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Jan 2015 | 5 Jan 2015 | 5 Nov 2018 |
| 487 | janesvillegazette.news | GoDaddy.com, LLC | 12 Aug 2015 | 1 Aug 2024 | 12 Aug 2025 |
| 488 | janesville.news | Network Solutions, LLC | 12 Aug 2015 | 18 Jun 2017 | 12 Aug 2018 |
| 489 | janescanvas.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 490 | janesarmy.guru | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2017 |
| 491 | janesville.help | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 492 | janesville.diet | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 493 | janeseymour.club | eNom, Inc. | 3 Feb 2015 | 26 Jan 2017 | 2 Feb 2018 |
| 494 | janesville.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 495 | janesville.work | GoDaddy.com, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 496 | janesaddiction.band | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 497 | janesimmonds.photography | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 14 Feb 2014 | 5 Feb 2017 | 14 Feb 2018 |
| 498 | janescarduce.science | Alpnames Limited | 23 Mar 2015 | - | 22 Mar 2016 |
| 499 | janesinger.realtor | Name Share, Inc. | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 500 | janeschiff.realtor | Name Share, Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 501 | janesville.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 502 | janesparks.work | Tucows Domains Inc. | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 503 | janestuart.com | Crazy Domains FZ-LLC | 6 Aug 2011 | 11 Sep 2024 | 6 Aug 2024 |
| 504 | janesternbach.com | 1API GmbH | 13 Aug 2015 | 22 Sep 2015 | 13 Aug 2017 |
| 505 | janeseodom.com | NameCheap, Inc. | 23 Feb 2019 | 23 Feb 2019 | 23 Feb 2020 |
| 506 | janeswanson.realtor | Name Share, Inc. | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 507 | janesville.science | Alpnames Limited | 24 Feb 2015 | 25 Apr 2015 | 23 Feb 2016 |
| 508 | janesweekend.com | Wild West Domains, LLC | 6 Jan 2015 | 11 Apr 2024 | 6 Jan 2025 |
| 509 | janespottedbird.com | Tucows Domains Inc. | 3 Jan 2011 | 7 Jan 2015 | 3 Jan 2016 |
| 510 | janeshk.com | GoDaddy.com, LLC | 20 Oct 2019 | 21 Oct 2023 | 20 Oct 2025 |
| 511 | janescrivnerstone.com | Tucows Domains Inc. | 3 Jan 2008 | 7 Jan 2015 | 3 Jan 2016 |
| 512 | janessa-tew.us | eNom, Inc. | 5 Jan 2015 | 5 Jan 2015 | 4 Jan 2016 |
| 513 | janesqualityproducts.info | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 514 | janessatew.com | GoDaddy.com, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 515 | janescreations.com | TurnCommerce, Inc. DBA NameBright.com | 7 Jan 2015 | 1 Jan 2021 | 7 Jan 2025 |
| 516 | janesstrains.com | Amazon Registrar, Inc. | 13 Dec 2023 | 13 Dec 2023 | 13 Dec 2024 |
| 517 | janesaundersblogsite.com | Xin Net Technology Corporation | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 518 | janes-shop.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Nov 2021 | 24 Nov 2021 | 24 Nov 2022 |
| 519 | janesvilleschools.com | Google, Inc. | 28 Mar 2023 | 28 May 2024 | 28 Mar 2024 |
| 520 | janescanlan.com | GoDaddy.com, LLC | 23 Jun 2020 | 24 Jun 2024 | 23 Jun 2026 |
| 521 | janesgreen.com | GoDaddy.com, LLC | 11 Jan 2015 | 17 Sep 2022 | 11 Jan 2025 |
| 522 | janeschaaf.com | Name.com, Inc. | 11 Jan 2015 | 19 Dec 2023 | 11 Jan 2025 |
| 523 | janestrain.com | GoDaddy.com, LLC | 13 Jan 2015 | 7 Jan 2024 | 13 Jan 2025 |
| 524 | janesstrain.com | GoDaddy.com, LLC | 13 Jan 2015 | 7 Jan 2024 | 13 Jan 2025 |
| 525 | janesigal.com | DreamHost, LLC | 11 Jan 2006 | 7 Dec 2023 | 11 Jan 2025 |
| 526 | janeschulz-event.com | 1&1 Internet AG | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 527 | janesblog2015.com | FastDomain Inc. | 14 Jan 2015 | 16 Feb 2018 | 14 Jan 2018 |
| 528 | janesworld.mobi | GoDaddy.com, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 529 | janesworld.info | GoDaddy.com, LLC | 14 Jan 2015 | - | 14 Jan 2016 |
| 530 | janesvilleppa.org | GoDaddy.com, LLC | 14 Jan 2015 | 8 Jul 2024 | 14 Jan 2026 |
| 531 | janestantonshowreel.com | Webfusion Ltd. | 17 Jan 2015 | 10 Jan 2017 | 17 Jan 2019 |
| 532 | janesharpington.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 533 | janescarduce.webcam | Alpnames Limited | 21 May 2015 | - | 20 May 2016 |
| 534 | janesummer.rocks | united-domains AG | 24 May 2015 | 8 Jul 2017 | 24 May 2018 |
| 535 | janesexygirl.casa | Minds + Machines Registrar Limited | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 536 | janesara.casa | Minds + Machines Registrar Limited | 6 Jun 2015 | 6 Jun 2015 | 6 Jun 2016 |
| 537 | janesfreesamples.website | Global Domains International, Inc. DBA DomainCostC… | 22 Apr 2015 | 6 Jun 2015 | 22 Apr 2016 |
| 538 | janesko.photography | Tucows Domains Inc. | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2017 |
| 539 | janessa.website | Key-Systems, LLC | 25 Jun 2015 | 30 Jun 2015 | 25 Jun 2016 |
| 540 | janessa.space | Key-Systems, LLC | 25 Jun 2015 | 30 Jun 2015 | 25 Jun 2016 |
| 541 | janesvillehotels.review | Alpnames Limited | 3 Jul 2015 | - | 2 Jul 2016 |
| 542 | janess.one | Namesilo, LLC | 2 Jul 2015 | 16 Aug 2024 | 2 Jul 2025 |
| 543 | janeson.xyz | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Jul 2015 | - | 2 Jul 2016 |
| 544 | janesvilleautocredit.com | GoDaddy.com, LLC | 15 Aug 2015 | 15 Aug 2015 | 15 Aug 2016 |
| 545 | janestoys.com | Google, Inc. | 15 Apr 2019 | 15 Apr 2019 | 15 Apr 2020 |
| 546 | janeseymourfan.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 547 | janesomerville.one | One.com A/S | 16 Jul 2015 | - | 16 Jul 2016 |
| 548 | janessa.rocks | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 549 | janeshouseparty.estate | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2017 | 27 Jul 2018 |
| 550 | janeshouse.party | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2017 | 26 Jul 2019 |
| 551 | janesmith.tokyo | GMO Internet Inc. | 9 Aug 2015 | 5 Sep 2023 | 9 Aug 2024 |
| 552 | janessacorso.com | GoDaddy.com, LLC | 17 Jan 2015 | 18 Jan 2023 | 17 Jan 2025 |
| 553 | janeshawsculpture.com | Tucows Domains Inc. | 17 Jan 2015 | 18 Dec 2023 | 17 Jan 2027 |
| 554 | janesvilleonline.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jan 2015 | 10 May 2024 | 15 Jan 2025 |
| 555 | janesanaschool.com | register.com, Inc. | 18 Jan 2015 | 18 Jan 2015 | 18 Jan 2016 |
| 556 | janessasiegel.com | GoDaddy.com, LLC | 22 Feb 2021 | 23 Feb 2023 | 22 Feb 2025 |
| 557 | janespalette.com | eNom, Inc. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 558 | janesincometax.com | GoDaddy.com, LLC | 19 Jan 2015 | 7 Jan 2024 | 19 Jan 2025 |
| 559 | janesolar1.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2017 |
| 560 | janesmoments.com | Gransy s.r.o. d/b/a subreg.cz | 17 Aug 2015 | 9 Aug 2024 | 18 Aug 2025 |
| 561 | janesdesigns.com | NameCheap, Inc. | 24 Jun 2020 | 25 May 2024 | 24 Jun 2025 |
| 562 | janessa-brodbeck.us | eNom, Inc. | 20 Jan 2015 | 20 Jan 2015 | 19 Jan 2016 |
| 563 | janeshouseofhair.com | Network Solutions, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 564 | janesewit.com | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2017 |
| 565 | janesdesigns.net | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 566 | janesarmy.com | HiChina Zhicheng Technology Limited | 13 Apr 2018 | 13 Apr 2018 | 13 Apr 2019 |
| 567 | janes5erservices.com | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 568 | janesewit.org | GoDaddy.com, LLC | 22 Jan 2015 | 23 Jan 2017 | 22 Jan 2018 |
| 569 | janesewit.net | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 570 | janesewit.info | GoDaddy.com, LLC | 22 Jan 2015 | 23 Jan 2017 | 22 Jan 2018 |
| 571 | janesdesigns.org | GoDaddy.com, LLC | 22 Jan 2015 | 22 Jan 2015 | 22 Jan 2016 |
| 572 | janesarmy.org | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2017 |
| 573 | janesarmy.net | GoDaddy.com, LLC | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2017 |
| 574 | janestockdale.com | GoDaddy.com, LLC | 17 Nov 2020 | 18 Nov 2022 | 17 Nov 2024 |
| 575 | janespiration.com | Wild West Domains, LLC | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 576 | janesol.com | Hosting Concepts B.V. dba Openprovider | 4 May 2023 | 14 Jul 2024 | 4 May 2024 |
| 577 | janesiena.com | - | 14 Apr 2022 | 15 Apr 2023 | 14 Apr 2024 |
| 578 | janescreativesewing.com | Tucows Domains Inc. | 26 Jan 2015 | 30 Jan 2016 | 26 Jan 2017 |
| 579 | janesvillesnowplowing.com | Google, Inc. | 5 Dec 2022 | 14 Jun 2024 | 5 Dec 2024 |
| 580 | janessaandmike.com | eNom, Inc. | 27 Jan 2015 | 29 Dec 2016 | 27 Jan 2018 |
| 581 | janescottagesoaps.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 582 | janesweinstein.com | Tucows Domains Inc. | 19 Aug 2015 | 4 Aug 2024 | 19 Aug 2025 |
| 583 | janeswalk5280.com | Domain.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 584 | janeslemeckdesignuk.com | Tucows Domains Inc. | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2016 |
| 585 | janeshonfeld.com | NameCheap, Inc. | 28 Jan 2015 | 29 Dec 2023 | 28 Jan 2025 |
| 586 | janesalzanotherapy.com | Tucows Domains Inc. | 27 Jan 2015 | 31 Jan 2017 | 27 Jan 2017 |
| 587 | janesvilleauto.com | GoDaddy.com, LLC | 13 May 2020 | 13 May 2024 | 13 May 2025 |
| 588 | janeshaven.com | GoDaddy.com, LLC | 28 Jan 2015 | 28 Nov 2016 | 28 Jan 2025 |
| 589 | janesandersfitness.com | eNom, Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 590 | janeswalk5280.org | Domain.com, LLC | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 591 | janesomerville.net | eNom, Inc. | 28 Jan 2015 | 29 Jan 2024 | 28 Jan 2025 |
| 592 | janessaandkurt.com | eNom, Inc. | 30 Jan 2015 | 30 Jan 2015 | 30 Jan 2016 |
| 593 | janespuppets.com | Gandi SAS | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 594 | janesprofessionals.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 29 Jan 2015 | 29 Jan 2015 | 29 Jan 2016 |
| 595 | janessa.link | NameCheap, Inc. | 7 May 2015 | 12 Apr 2024 | 7 May 2025 |
| 596 | janesride.com | GoDaddy.com, LLC | 8 Aug 2019 | 9 Aug 2024 | 8 Aug 2025 |
| 597 | janesmakeupobsession.com | GoDaddy.com, LLC | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2016 |
| 598 | janesedonaen.net | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 599 | janesedonaen.info | GoDaddy.com, LLC | 20 Aug 2015 | 21 Aug 2019 | 20 Aug 2020 |
| 600 | janesedonaen.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2024 | 20 Aug 2025 |
| 601 | janeswolfe.com | Domain.com, LLC | 2 Feb 2015 | 18 Jan 2017 | 2 Feb 2018 |
| 602 | janesvilletherapy.com | GoDaddy.com, LLC | 25 Oct 2017 | 26 Oct 2023 | 25 Oct 2024 |
| 603 | janesplacenowandthen.com | FastDomain Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 604 | janesplacennowandthen.com | FastDomain Inc. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 605 | janesapron.com | TurnCommerce, Inc. DBA NameBright.com | 12 Nov 2018 | 6 Nov 2020 | 12 Nov 2024 |
| 606 | janesmaker.com | Namesilo, LLC | 8 May 2017 | 4 Apr 2024 | 8 May 2025 |
| 607 | janesellsdemo.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Feb 2015 | 4 Feb 2015 | 4 Feb 2016 |
| 608 | janeswolfe.org | Domain.com, LLC | 2 Feb 2015 | 18 Jan 2017 | 2 Feb 2018 |
| 609 | janeswolfe.net | Domain.com, LLC | 2 Feb 2015 | 18 Jan 2017 | 2 Feb 2018 |
| 610 | janessa.info | GoDaddy.com, LLC | 2 Feb 2015 | 7 Jul 2024 | 2 Feb 2025 |
| 611 | janeswank.com | GMO Internet Inc. | 5 Oct 2021 | 8 Oct 2021 | 5 Oct 2022 |
| 612 | janeschina.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Apr 2022 | 1 Jul 2023 | 30 Apr 2023 |
| 613 | janespreciousgems.com | Tucows Domains Inc. | 2 Feb 2010 | 6 Feb 2015 | 2 Feb 2016 |
| 614 | janesimons.com | Namesilo, LLC | 19 Aug 2020 | 20 Aug 2020 | 19 Aug 2021 |
| 615 | janestonetextiledesign.com | Wild West Domains, LLC | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 616 | janesgreatdane.com | Network Solutions, LLC | 8 Feb 2015 | 15 Dec 2023 | 8 Feb 2025 |
| 617 | janeselewis.com | GoDaddy.com, LLC | 6 May 2019 | 6 May 2019 | 6 May 2021 |
| 618 | janesvillebars.com | GoDaddy.com, LLC | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 619 | janeserrandservices.com | Google, Inc. | 20 Aug 2015 | 15 Aug 2016 | 20 Aug 2017 |
| 620 | janeslegal.com | eNom, Inc. | 11 Feb 2015 | 13 Jan 2017 | 11 Feb 2018 |
| 621 | janes-cleaning.com | - | 1 Jun 2020 | 2 May 2022 | 1 Jun 2023 |
| 622 | janesearth.info | GoDaddy.com, LLC | 9 Feb 2015 | - | 9 Feb 2017 |
| 623 | janesearth.org | GoDaddy.com, LLC | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2017 |
| 624 | janesearth.net | GoDaddy.com, LLC | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2017 |
| 625 | janesvillewinair.com | NameCheap, Inc. | 12 Feb 2015 | 13 Jan 2024 | 12 Feb 2025 |
| 626 | janestadermann.com | Network Solutions, LLC | 13 Feb 2015 | 6 Jun 2024 | 13 Feb 2025 |
| 627 | janesvillehotelspy.com | - | - | - | - |
| 628 | janessawest.com | register.com, Inc. | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2016 |
| 629 | janesjoys.com | Launchpad, Inc. | 13 Feb 2015 | 15 Apr 2015 | 13 Feb 2018 |
| 630 | janesjohn.com | Namesilo, LLC | 5 May 2023 | 6 May 2024 | 5 May 2025 |
| 631 | janeswebsites.com | TurnCommerce, Inc. DBA NameBright.com | 29 Jul 2021 | 30 Aug 2024 | 29 Jul 2024 |
| 632 | janessa-mcgann.us | eNom, Inc. | 13 Feb 2015 | 13 Feb 2015 | 12 Feb 2016 |
| 633 | janesvilleinsuranceagents.com | GoDaddy.com, LLC | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 634 | janesville-salesitems.com | Register.it SPA | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 635 | janeshomesearch.com | GoDaddy.com, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 636 | janesvillebobandbrian.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 637 | janespanties.com | GoDaddy.com, LLC | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 638 | janesellsnova.com | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 639 | janessabrazil.org | GoDaddy.com, LLC | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 640 | janesinspiredbeauty.com | GoDaddy.com, LLC | 20 Feb 2015 | 21 Feb 2024 | 20 Feb 2026 |
| 641 | janessa-darst.us | eNom, Inc. | 19 Feb 2015 | 19 Feb 2015 | 18 Feb 2016 |
| 642 | janeslegal.org | eNom, Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 643 | janesville-income.com | eNom, Inc. | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 644 | janestreetdental.net | GoDaddy.com, LLC | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 645 | janesinspiredbeauty.net | GoDaddy.com, LLC | 20 Feb 2015 | 20 Feb 2015 | 20 Feb 2016 |
| 646 | janesolofitness.com | GoDaddy.com, LLC | 22 Feb 2015 | 22 Feb 2015 | 22 Feb 2016 |
| 647 | janeshawsculptures.com | Tucows Domains Inc. | 22 Feb 2015 | 23 Jan 2023 | 22 Feb 2025 |
| 648 | janeshotel.com | OVH sas | 17 Jan 2024 | 17 Jan 2024 | 17 Jan 2025 |
| 649 | janessabelliveau.com | eNom, Inc. | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 650 | janeshelbymeyer.com | GoDaddy.com, LLC | 23 Feb 2015 | 24 Feb 2024 | 23 Feb 2025 |
| 651 | janeshwarmishramemorialtrust.org | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 652 | janespencerinteriordesign.com | Synergy Wholesale Pty Ltd | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2017 |
| 653 | janesatel.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2017 |
| 654 | janeshairshack.net | register.com, Inc. | 18 Mar 2015 | 8 Apr 2015 | 18 Mar 2018 |
| 655 | janesvillehearingcare.com | Tucows Domains Inc. | 27 Feb 2015 | 3 Mar 2018 | 27 Feb 2018 |
| 656 | janesvillechiropractors.com | eNom, Inc. | 27 Feb 2015 | 24 May 2024 | 27 Feb 2025 |
| 657 | janessamckell.com | Namesilo, LLC | 20 Aug 2021 | 21 Aug 2024 | 20 Aug 2025 |
| 658 | janespastelportraits.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 659 | janesayssew.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2017 |
| 660 | janesvilleareaforeclosures.com | GoDaddy.com, LLC | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 661 | janesvilleroofing.com | GoDaddy.com, LLC | 3 Aug 2019 | 1 Nov 2022 | 3 Aug 2025 |
| 662 | janescupcakes.com | Annulet LLC | 2 Mar 2015 | 19 Apr 2024 | 2 Mar 2025 |
| 663 | janesvillemnfuneralhome.com | eNom, Inc. | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 664 | janesnewsreview.com | GoDaddy.com, LLC | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 665 | janesneedle.com | Tucows Domains Inc. | 3 Mar 2015 | 7 Mar 2016 | 3 Mar 2017 |
| 666 | janeslessonslearnt.com | Wild West Domains, LLC | 3 Mar 2015 | 3 Mar 2015 | 3 Mar 2016 |
| 667 | janesatow.com | Launchpad, Inc. | 3 Mar 2015 | 16 Feb 2017 | 3 Mar 2018 |
| 668 | janeswan.net | Moniker Online Services LLC | 6 Jun 2024 | 21 Jun 2024 | 6 Jun 2025 |
| 669 | janesellidecori.biz | Register.it SPA | 4 Mar 2015 | 18 Apr 2016 | 3 Mar 2017 |
| 670 | janesvilleautorentals.com | eNom, Inc. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 671 | janescosmetics.com | GoDaddy.com, LLC | 7 Feb 2023 | 7 Feb 2023 | 7 Feb 2024 |
| 672 | janesvilleprestigedental.com | Domain.com, LLC | 5 Mar 2015 | 19 Feb 2024 | 5 Mar 2025 |
| 673 | janesvillebiz.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 674 | janespamperedpet.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 675 | janesironingservice.org | Tucows Domains Inc. | 4 Mar 2015 | 8 Mar 2016 | 4 Mar 2017 |
| 676 | janesgrainsandgranola.com | Tucows Domains Inc. | 2 Mar 2014 | 6 Mar 2015 | 2 Mar 2016 |
| 677 | janesellidecori.org | Register.it SPA | 4 Mar 2015 | - | 4 Mar 2016 |
| 678 | janesellidecori.net | Register.it SPA | 4 Mar 2015 | 4 Mar 2015 | 4 Mar 2016 |
| 679 | janeschuck.com | Key-Systems GmbH | 29 Jan 2009 | 5 Mar 2015 | 29 Jan 2016 |
| 680 | janessaevristmusic.com | Gandi SAS | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 681 | janesofdigital.com | Nom-iq Ltd. dba COM LAUDE | 7 Mar 2015 | 3 May 2024 | 7 Mar 2025 |
| 682 | janessabrazzil.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 683 | janesofdigital.net | MarkMonitor Inc. | 7 Dec 2016 | 5 Nov 2023 | 7 Dec 2024 |
| 684 | janesdesignbait.com | GoDaddy.com, LLC | 7 Mar 2015 | 8 Mar 2023 | 7 Mar 2025 |
| 685 | janescher.com | GoDaddy.com, LLC | 7 Mar 2015 | 8 Mar 2024 | 7 Mar 2025 |
| 686 | janesinspirations.com | DropCatch.com 464 LLC | 11 Nov 2016 | 12 Nov 2016 | 11 Nov 2017 |
| 687 | janescleaningco.com | GoDaddy.com, LLC | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2017 |
| 688 | janesvillenissankiasubaru.com | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2024 | 9 Mar 2025 |
| 689 | janesvillenissan.com | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2024 | 9 Mar 2026 |
| 690 | janessleepeeze.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 691 | janessleepaid.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 692 | janessleep-eaze.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 693 | janesresorts.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 694 | janesnrgbrew.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 695 | janesebburn.com | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2024 | 9 Mar 2025 |
| 696 | janeschillmix.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 697 | janeschilllax.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 698 | janescannabis.com | GoDaddy.com, LLC | 27 Jul 2017 | 1 Sep 2023 | 27 Jul 2031 |
| 699 | janescakeandco.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 700 | janescafes.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2020 |
| 701 | janesbrewcrew.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2017 |
| 702 | janesofdigital.org | MarkMonitor Inc. | 7 Mar 2015 | 9 Feb 2024 | 7 Mar 2025 |
| 703 | janesvilleradio.com | GoDaddy.com, LLC | 10 Mar 2015 | 11 Mar 2024 | 10 Mar 2025 |
| 704 | janesiegalforschoolboard.com | register.com, Inc. | 14 Mar 2019 | 14 Mar 2019 | 14 Mar 2020 |
| 705 | janesaidwhat.com | GoDaddy.com, LLC | 9 Oct 2023 | 9 Oct 2023 | 9 Oct 2024 |
| 706 | janesvillesubaru.net | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2024 | 9 Mar 2025 |
| 707 | janesvillenissankiasubaru.net | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2024 | 9 Mar 2025 |
| 708 | janesvillenissan.net | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2024 | 9 Mar 2025 |
| 709 | janesvilleclinicia.org | GoDaddy.com, LLC | 9 Mar 2015 | 8 Jul 2024 | 9 Mar 2027 |
| 710 | janesvilleradio.info | Wild West Domains, LLC | 10 Mar 2015 | 8 Jun 2024 | 10 Mar 2025 |
| 711 | janesvillechimneyexperts.com | eNom, Inc. | 11 Mar 2015 | 10 Feb 2017 | 11 Mar 2018 |
| 712 | janesvilleradio.org | Wild West Domains, LLC | 10 Mar 2015 | 11 Jun 2024 | 10 Mar 2025 |
| 713 | janesvilleradio.net | Wild West Domains, LLC | 10 Mar 2015 | 11 Mar 2024 | 10 Mar 2025 |
| 714 | janeswarriors.com | GoDaddy.com, LLC | 12 Mar 2015 | 21 Mar 2023 | 12 Mar 2025 |
| 715 | janestebbinsgroup.com | Wild West Domains, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 716 | janessasmith.com | eNom, Inc. | 4 Jan 2019 | 30 Dec 2023 | 4 Jan 2025 |
| 717 | janeswalkphilly.org | eNom, Inc. | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 718 | janessaanderson.com | GoDaddy.com, LLC | 12 Sep 2023 | 12 Sep 2023 | 12 Sep 2026 |
| 719 | janeshomemade.com | Google, Inc. | 23 Mar 2022 | 17 May 2024 | 23 Mar 2025 |
| 720 | janesarosdylaw.com | DreamHost, LLC | 14 Mar 2015 | 14 Mar 2015 | 14 Mar 2018 |
| 721 | janescope.com | NameCheap, Inc. | 19 Aug 2021 | 22 Aug 2023 | 19 Aug 2024 |
| 722 | janesboxing.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2017 |
| 723 | janes-footwear.com | - | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2017 |
| 724 | janespicer.com | register.com, Inc. | 15 Mar 2015 | 4 Mar 2016 | 15 Mar 2018 |
| 725 | janestudio.com | GoDaddy.com, LLC | 16 Mar 2015 | 11 Apr 2024 | 16 Mar 2025 |
| 726 | janeshalam.com | GoDaddy.com, LLC | 16 Mar 2015 | 9 May 2024 | 16 Mar 2025 |
| 727 | janescuela.com | Dattatec.com SRL | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 728 | janesvillenks.com | eNom, Inc. | 17 Mar 2015 | 15 Feb 2016 | 17 Mar 2018 |
| 729 | janessa8.com | Gandi SAS | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 730 | janesl.com | GoDaddy.com, LLC | 6 Jul 2021 | 6 Jul 2021 | 6 Jul 2022 |
| 731 | janesindoorgardening.com | eNom, Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 732 | janestroschin.net | Tucows Domains Inc. | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2017 |
| 733 | janesvillelawyer.com | Epik Inc. | 27 Apr 2020 | 9 Jul 2023 | 27 Apr 2023 |
| 734 | janesoliman.com | GoDaddy.com, LLC | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 735 | janesummer.com | Key-Systems GmbH | 22 Mar 2015 | 26 Apr 2024 | 22 Mar 2025 |
| 736 | janeshake.com | Key-Systems GmbH | 22 Mar 2015 | 23 Mar 2015 | 22 Mar 2016 |
| 737 | janessalive.com | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 738 | janessalink.com | eNom, Inc. | 24 Mar 2015 | 23 Feb 2017 | 24 Mar 2018 |
| 739 | janessabrazilwebcam.com | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 740 | janessabrazillive.com | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 741 | janessavageline.com | Tucows Domains Inc. | 21 Mar 2014 | 25 Mar 2015 | 21 Mar 2016 |
| 742 | janestravelsite.com | GoDaddy.com, LLC | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 743 | janeshomecreations.com | GoDaddy.com, LLC | 25 Mar 2015 | 25 Mar 2015 | 16 Feb 2017 |
| 744 | janesdating.com | Hosting Concepts B.V. dba Openprovider | 19 Nov 2019 | 19 Nov 2019 | 19 Nov 2020 |
| 745 | janesflaive.com | GoDaddy.com, LLC | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 746 | janesantoso.com | GoDaddy.com, LLC | 27 Aug 2015 | 28 Aug 2024 | 27 Aug 2025 |
| 747 | janeshairbraiding.com | register.com, Inc. | 27 Mar 2015 | 8 Dec 2016 | 27 Mar 2018 |
| 748 | janesharp.net | eNom, Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2017 |
| 749 | janesvillepa.com | Domain.com, LLC | 29 Mar 2015 | 14 Mar 2024 | 29 Mar 2025 |
| 750 | janesteelemason.com | GoDaddy.com, LLC | 30 Mar 2015 | 30 Mar 2024 | 30 Mar 2025 |
| 751 | janescort.com | eNom, Inc. | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 752 | janeszwajcer.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 9 Sep 2023 | 9 Sep 2023 | 9 Sep 2024 |
| 753 | janestancliffe.com | Tucows Domains Inc. | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2017 |
| 754 | janessadress.com | eName Technology Co., Ltd. | 30 Mar 2015 | 1 Mar 2017 | 30 Mar 2018 |
| 755 | janescruisestravels.com | FastDomain Inc. | 31 Mar 2015 | 31 Mar 2017 | 31 Mar 2018 |
| 756 | janessalsmith.com | GoDaddy.com, LLC | 1 Apr 2015 | 1 Apr 2024 | 1 Apr 2025 |
| 757 | janespringerhaddock.com | GoDaddy.com, LLC | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2017 |
| 758 | janesbeautyworld.com | Network Solutions, LLC | 31 Mar 2015 | 31 Mar 2015 | 31 Mar 2016 |
| 759 | janes-world.net | FastDomain Inc. | 29 Mar 2015 | 14 Mar 2024 | 29 Mar 2025 |
| 760 | janesweekly.com | GoDaddy.com, LLC | 21 Aug 2019 | 22 Aug 2023 | 21 Aug 2025 |
| 761 | janessapires.com | GoDaddy.com, LLC | 1 Apr 2015 | 2 Apr 2024 | 1 Apr 2025 |
| 762 | janesteagarden.com | Xin Net Technology Corporation | 22 Nov 2021 | 22 Nov 2021 | 22 Nov 2022 |
| 763 | janestrenda.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 764 | janesteven.com | DNSPod, Inc. | 22 Jun 2022 | 22 Aug 2023 | 22 Jun 2023 |
| 765 | janescraftbarn.com | Wild West Domains, LLC | 3 Apr 2015 | 3 Mar 2024 | 3 Apr 2025 |
| 766 | janesvillebusinesses.org | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2017 |
| 767 | janessa-witman.biz | eNom, Inc. | 4 Apr 2015 | 4 Apr 2015 | 3 Apr 2016 |
| 768 | janeskang.com | Tucows Domains Inc. | 5 Apr 2015 | 21 Mar 2024 | 5 Apr 2025 |
| 769 | janesleight-leach.com | Crazy Domains FZ-LLC | 7 Apr 2015 | 18 Apr 2019 | 7 Apr 2019 |
| 770 | janesimingtonbooks.com | Wild West Domains, LLC | 6 Apr 2015 | 6 Apr 2015 | 6 Apr 2016 |
| 771 | janeshuttleworth.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Sep 2023 | 9 Oct 2023 | 24 Sep 2024 |
| 772 | janes-way.net | GMO Internet Inc. | 30 Mar 2020 | 30 Mar 2020 | 30 Mar 2021 |
| 773 | janessagoode.com | Google, Inc. | 11 Mar 2021 | 23 Apr 2024 | 11 Mar 2025 |
| 774 | janesmedleyjumpers.com | GoDaddy.com, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2017 |
| 775 | janesjb.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 8 Oct 2021 | 9 Oct 2021 | 8 Oct 2022 |
| 776 | janesinteriordesign.com | GoDaddy.com, LLC | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 777 | janesvillefencing.com | GoDaddy.com, LLC | 3 May 2018 | 15 Jul 2024 | 3 May 2024 |
| 778 | janesvillecraigslist.org | Key-Systems GmbH | 31 Aug 2015 | - | 31 Aug 2016 |
| 779 | janesia.com | eName Technology Co., Ltd. | 1 Sep 2015 | 5 Nov 2017 | 1 Sep 2025 |
| 780 | janesvillegrocerydelivery.com | register.com, Inc. | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2016 |
| 781 | janesvillelimo.com | Tucows Domains Inc. | 26 Aug 2010 | 30 Aug 2015 | 26 Aug 2016 |
| 782 | janessabookout.com | Tucows Domains Inc. | 5 Sep 2005 | 22 Aug 2024 | 5 Sep 2025 |
| 783 | janesmithsjazzercise.com | Tucows Domains Inc. | 30 Aug 2010 | 3 Sep 2015 | 30 Aug 2016 |
| 784 | janesumc-brooklyn.org | GoDaddy.com, LLC | 2 Sep 2015 | 3 Sep 2016 | 2 Sep 2017 |
| 785 | janesspace.com | Google, Inc. | 1 Sep 2022 | 28 Sep 2023 | 1 Sep 2023 |
| 786 | janesecurtis.com | Network Solutions, LLC | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 787 | janesamuel.com | GoDaddy.com, LLC | 9 Apr 2015 | 10 Apr 2023 | 9 Apr 2025 |
| 788 | janesub.com | HiChina Zhicheng Technology Limited | 3 Oct 2018 | 3 Oct 2018 | 3 Oct 2019 |
| 789 | janesdish.com | TurnCommerce, Inc. DBA NameBright.com | 9 Apr 2015 | 29 May 2020 | 9 Apr 2024 |
| 790 | janesvillelawyers.com | Porkbun, LLC | 21 Oct 2018 | 21 Oct 2018 | 21 Oct 2019 |
| 791 | janesvillebusinessbrokers.com | Domain.com, LLC | 3 Sep 2015 | 19 Aug 2024 | 3 Sep 2025 |
| 792 | janesshop.net | GoDaddy.com, LLC | 3 Sep 2015 | 3 Sep 2015 | 3 Sep 2016 |
| 793 | janespowerrocksorgonite.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2015 | 3 Sep 2017 | 3 Sep 2018 |
| 794 | janesmanagement.com | GoDaddy.com, LLC | 3 Sep 2015 | 4 Sep 2024 | 3 Sep 2025 |
| 795 | janescottlife.com | eNom, Inc. | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 796 | janesbeachsurfhostel.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 797 | janessachambers.com | NameCheap, Inc. | 22 Feb 2021 | 23 Jan 2023 | 22 Feb 2024 |
| 798 | janesladethedesigner.com | Tucows Domains Inc. | 8 Apr 2011 | 12 Apr 2015 | 8 Apr 2016 |
| 799 | janesbathtimebakery.com | Tucows Domains Inc. | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2017 |
| 800 | janessasenn.info | Domain.com, LLC | 10 Apr 2015 | - | 10 Apr 2017 |
| 801 | janesweden.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 12 Apr 2015 | 12 Apr 2015 | 12 Apr 2016 |
| 802 | janesleight.com | Domain.com, LLC | 12 Apr 2015 | 28 Mar 2024 | 12 Apr 2025 |
| 803 | janesewell.com | register.com, Inc. | 13 Apr 2015 | 31 Mar 2024 | 13 Apr 2026 |
| 804 | janestinythings.com | GoDaddy.com, LLC | 6 Apr 2020 | 6 Apr 2020 | 6 Apr 2021 |
| 805 | janessasong.com | Domain.com, LLC | 15 Apr 2015 | 15 Apr 2015 | 15 Apr 2016 |
| 806 | janeslatter.com | GoDaddy.com, LLC | 14 Apr 2015 | 3 Oct 2023 | 14 Apr 2025 |
| 807 | janeschooler.com | Wild West Domains, LLC | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 808 | janespyder.com | GoDaddy.com, LLC | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 809 | janestyledstock.com | eNom, Inc. | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 810 | janesbeadske.com | NameCheap, Inc. | 19 Apr 2015 | 8 Apr 2024 | 19 Apr 2025 |
| 811 | janessajanessa.net | Wild West Domains, LLC | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2016 |
| 812 | janesonlineshop.com | GoDaddy.com, LLC | 6 Sep 2015 | 6 Sep 2015 | 6 Sep 2017 |
| 813 | janessa-winborne.biz | eNom, Inc. | 21 Apr 2015 | 21 Apr 2015 | 20 Apr 2016 |
| 814 | janesjewelssparkle.com | Tucows Domains Inc. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2017 |
| 815 | janeseymour.biz | eNom, Inc. | 22 Apr 2015 | 31 Mar 2024 | 21 Apr 2025 |
| 816 | janesyoga.com | CloudFlare, Inc. | 22 Apr 2015 | 23 Mar 2024 | 22 Apr 2025 |
| 817 | janesweilert.com | Wild West Domains, LLC | 22 Apr 2015 | 23 Apr 2024 | 22 Apr 2025 |
| 818 | janesteinsnyder.com | GoDaddy.com, LLC | 12 Oct 2020 | 12 Oct 2020 | 12 Oct 2021 |
| 819 | janesbeachsurfhouse.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Apr 2015 | 27 Jun 2016 | 22 Apr 2019 |
| 820 | janesbistro.com | DreamHost, LLC | 23 Apr 2015 | 25 Apr 2017 | 23 Apr 2018 |
| 821 | janesprimal.com | GoDaddy.com, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 822 | janes-closet.com | Xin Net Technology Corporation | 7 Aug 2018 | 7 Aug 2018 | 7 Aug 2019 |
| 823 | janesquilting.net | Tucows Domains Inc. | 20 Apr 2011 | 24 Apr 2015 | 20 Apr 2016 |
| 824 | janesvilleram.com | GoDaddy.com, LLC | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 825 | janesvillenisson.com | GoDaddy.com, LLC | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 826 | janesvillechevy.com | GoDaddy.com, LLC | 15 Dec 2022 | 16 Dec 2023 | 15 Dec 2024 |
| 827 | janescobieeventplanning.com | Tucows Domains Inc. | 26 Apr 2015 | 12 Apr 2024 | 26 Apr 2025 |
| 828 | janesclub.com | GoDaddy.com, LLC | 26 Apr 2015 | 27 Apr 2024 | 26 Apr 2025 |
| 829 | janesser.com | Mesh Digital Limited | 27 Apr 2015 | 26 Apr 2024 | 27 Apr 2025 |
| 830 | janesvilleimports.com | GoDaddy.com, LLC | 28 Apr 2015 | 29 Apr 2024 | 28 Apr 2025 |
| 831 | janeshoney.com | Key-Systems GmbH | 16 May 2018 | 1 Apr 2022 | 16 May 2025 |
| 832 | janesville.us | GoDaddy.com, LLC | 27 Apr 2015 | 27 Apr 2015 | 26 Apr 2018 |
| 833 | janesvilleimports.net | GoDaddy.com, LLC | 28 Apr 2015 | 29 Apr 2024 | 28 Apr 2025 |
| 834 | janesvilleimports.info | GoDaddy.com, LLC | 28 Apr 2015 | - | 28 Apr 2016 |
| 835 | janesdani.com | GoDaddy.com, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 836 | janesvilleimports.org | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 837 | janesy.win | Chengdu West Dimension Digital Technology Co., Ltd… | 9 Sep 2015 | - | 8 Sep 2016 |
| 838 | janessaco.com | Google, Inc. | 1 Jan 2019 | 1 Jan 2019 | 1 Jan 2020 |
| 839 | janesycarballo.com | Launchpad, Inc. | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 840 | janestentcircle.com | eNom, Inc. | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 841 | janestent.com | eNom, Inc. | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 842 | janesaullphotography.com | GoDaddy.com, LLC | 30 Apr 2015 | 1 May 2024 | 30 Apr 2027 |
| 843 | janesv1lle.com | Tucows Domains Inc. | 1 May 2015 | 1 May 2015 | 1 May 2017 |
| 844 | janeshead.com | One.com A/S | 4 Oct 2018 | 4 Oct 2018 | 4 Oct 2019 |
| 845 | janesgatleycakes.com | GoDaddy.com, LLC | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 846 | janesuperstars.com | GoDaddy.com, LLC | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 847 | janesoil.com | GoDaddy.com, LLC | 4 May 2015 | 7 Jan 2024 | 4 May 2025 |
| 848 | janesden.com | GoDaddy.com, LLC | 4 May 2015 | 7 Jan 2024 | 4 May 2025 |
| 849 | janescave.com | GoDaddy.com, LLC | 4 May 2015 | 7 Jan 2024 | 4 May 2025 |
| 850 | janesattic.com | GoDaddy.com, LLC | 4 May 2015 | 7 Jan 2024 | 4 May 2025 |
| 851 | janestees.org | GoDaddy.com, LLC | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 852 | janeshiddenbeauty.com | Network Solutions, LLC | 9 Sep 2015 | 7 Sep 2016 | 9 Sep 2017 |
| 853 | janesawinner.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 854 | janesales.com | Name.com, Inc. | 9 Sep 2015 | 1 Sep 2024 | 9 Sep 2025 |
| 855 | janesitaliankitchen.com | eNom, Inc. | 5 May 2015 | 5 May 2017 | 5 May 2018 |
| 856 | janesplanb.net | Google, Inc. | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 857 | janestubberfield.com | Mesh Digital Limited | 7 May 2015 | 7 May 2024 | 7 May 2025 |
| 858 | janessonomacottage.com | GoDaddy.com, LLC | 8 May 2015 | 18 May 2024 | 8 May 2027 |
| 859 | janesianxiong.com | Launchpad, Inc. | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 860 | janesianjanesian.com | Launchpad, Inc. | 8 May 2015 | 8 May 2015 | 8 May 2016 |
| 861 | janesaubert.com | 1&1 Internet AG | 7 May 2015 | 12 Mar 2018 | 7 May 2025 |
| 862 | janesvilleweb.com | Slow Motion Domains LLC | 28 Jan 2024 | 28 Jan 2024 | 28 Jan 2025 |
| 863 | janeskydesign.com | GoDaddy.com, LLC | 9 May 2015 | 10 May 2023 | 9 May 2025 |
| 864 | janesings.com | GoDaddy.com, LLC | 11 Nov 2020 | 12 Nov 2023 | 11 Nov 2024 |
| 865 | janeslacksmith.net | NetRegistry Pty Ltd. | 10 Sep 2015 | 10 Aug 2016 | 10 Sep 2017 |
| 866 | janesejean.com | GoDaddy.com, LLC | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 867 | janesvilleapartments.com | Wild West Domains, LLC | 11 Feb 2016 | 15 Jan 2024 | 11 Feb 2025 |
| 868 | janesroadhouse.com | Domain.com, LLC | 9 May 2015 | 9 May 2015 | 9 May 2016 |
| 869 | janesproduce.com | GoDaddy.com, LLC | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 870 | janesanden.com | Tucows Domains Inc. | 10 May 2015 | 25 Apr 2024 | 10 May 2025 |
| 871 | janestebbinsboulder.com | GoDaddy.com, LLC | 12 May 2015 | 24 Jul 2023 | 12 May 2023 |
| 872 | janestastynsweet.com | Tucows Domains Inc. | 9 May 2014 | 13 May 2015 | 9 May 2016 |
| 873 | janesafricanhairbraids.com | 1&1 Internet AG | 21 Nov 2022 | 21 Nov 2022 | 21 Nov 2024 |
| 874 | janeskids.org | GoDaddy.com, LLC | 11 May 2015 | 22 Jun 2017 | 11 May 2018 |
| 875 | janesusan.com | Network Solutions, LLC | 13 May 2015 | 6 Jun 2024 | 13 May 2025 |
| 876 | janesheng.com | TurnCommerce, Inc. DBA NameBright.com | 14 May 2015 | 1 May 2020 | 14 May 2024 |
| 877 | janeshah.com | DropCatch.com 368 LLC | 31 Jul 2018 | 31 Jul 2018 | 31 Jul 2019 |
| 878 | janesu.net | - | 13 Dec 2023 | 18 Dec 2023 | 13 Dec 2024 |
| 879 | janespost.com | GoDaddy.com, LLC | 12 Dec 2023 | 12 Dec 2023 | 12 Dec 2024 |
| 880 | janessery.net | FBS Inc. | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 881 | janesgreens.org | - | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2017 |
| 882 | janescakery.com | GoDaddy.com, LLC | 12 Sep 2015 | 12 Sep 2015 | 12 Sep 2016 |
| 883 | janessen.com | GoDaddy.com, LLC | 24 Mar 2017 | 25 Mar 2024 | 24 Mar 2025 |
| 884 | janesnotables.com | Automattic Inc. | 18 May 2015 | 28 Apr 2024 | 18 May 2025 |
| 885 | janeshengstudio.com | GoDaddy.com, LLC | 18 May 2015 | 18 May 2015 | 18 May 2016 |
| 886 | janesblog.info | NameCheap, Inc. | 21 Aug 2022 | 2 Oct 2023 | 21 Aug 2023 |
| 887 | janestevendesigns.com | Network Solutions, LLC | 19 May 2015 | 1 Jul 2024 | 19 May 2024 |
| 888 | janesnetwork.com | GoDaddy.com, LLC | 21 May 2015 | 21 May 2015 | 21 May 2016 |
| 889 | janeshaskygallery.com | Beijing Lanhai Jiye Technology Co., Ltd | 10 Aug 2021 | 11 Aug 2023 | 10 Aug 2024 |
| 890 | janesallyshop.com | Tucows Domains Inc. | 19 May 2014 | 7 May 2024 | 19 May 2025 |
| 891 | janessatamez.com | Tucows Domains Inc. | 7 May 2019 | 11 May 2021 | 7 May 2021 |
| 892 | janessaonline.com | DropCatch.com 559 LLC | 13 Sep 2015 | 14 Sep 2016 | 13 Sep 2017 |
| 893 | janesmkt.com | GoDaddy.com, LLC | 24 May 2015 | 25 May 2024 | 24 May 2026 |
| 894 | janescuteanimals.com | FastDomain Inc. | 25 May 2015 | 25 May 2016 | 25 May 2017 |
| 895 | janescove.com | Domain.com, LLC | 7 Sep 2002 | 21 Dec 2022 | 7 Sep 2027 |
| 896 | janessweettreats.com | GoDaddy.com, LLC | 26 May 2015 | 27 May 2023 | 26 May 2025 |
| 897 | janeslussler.com | 1&1 Internet AG | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 898 | janestrawberry.com | GoDaddy.com, LLC | 27 May 2015 | 18 Sep 2022 | 27 May 2025 |
| 899 | janestontricot.com | DropCatch.com 1123 LLC | 4 Nov 2017 | 4 Nov 2017 | 4 Nov 2018 |
| 900 | janesugruemua.com | Tucows Domains Inc. | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2016 |
| 901 | janeshands.com | HiChina Zhicheng Technology Limited | 11 Nov 2018 | 11 Nov 2018 | 11 Nov 2019 |
| 902 | janeschenckandassoc.com | register.com, Inc. | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2018 |
| 903 | janesummersartist.com | Tucows Domains Inc. | 6 Apr 2018 | 22 Mar 2024 | 6 Apr 2025 |
| 904 | janestravelandcruisesllc.com | Tucows Domains Inc. | 28 May 2015 | 1 Jun 2017 | 28 May 2017 |
| 905 | janespelledjane.com | Tucows Domains Inc. | 29 May 2015 | 14 May 2024 | 29 May 2025 |
| 906 | janesang.com | eNom, Inc. | 28 May 2015 | 28 May 2015 | 28 May 2016 |
| 907 | janestrawberry.net | GoDaddy.com, LLC | 27 May 2015 | 18 Sep 2022 | 27 May 2025 |
| 908 | janestontricot.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 909 | janestontricot.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 910 | janessa-blind.biz | eNom, Inc. | 29 May 2015 | 29 May 2015 | 28 May 2016 |
| 911 | janesheavenlyfood.com | Domain.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 912 | janeshatrainings.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 913 | janesbox.com | GMO Internet Inc. | 30 May 2015 | 21 May 2017 | 30 May 2018 |
| 914 | janesvillephonerepair.com | GoDaddy.com, LLC | 31 May 2015 | 31 May 2015 | 31 May 2017 |
| 915 | janessaharris.com | Network Solutions, LLC | 11 Sep 2017 | 11 Sep 2017 | 11 Sep 2018 |
| 916 | janescookies.org | GoDaddy.com, LLC | 29 May 2015 | 30 May 2015 | 29 May 2016 |
| 917 | janesusannmaccarter.com | Network Solutions, LLC | 31 May 2015 | 13 Jul 2024 | 31 May 2024 |
| 918 | janesstoreltd.com | Wild West Domains, LLC | 31 May 2015 | 31 May 2015 | 31 May 2016 |
| 919 | janesmythe.com | GoDaddy.com, LLC | 31 May 2015 | 1 Jun 2024 | 31 May 2027 |
| 920 | janesroom.com | GoDaddy.com, LLC | 1 Jun 2015 | 5 Jun 2024 | 1 Jun 2025 |
| 921 | janesuwalsky.com | Automattic Inc. | 15 Sep 2015 | 26 Aug 2023 | 15 Sep 2024 |
| 922 | janestelecom.net | GoDaddy.com, LLC | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 923 | janestelecom.com | Beijing Lanhai Jiye Technology Co., Ltd | 4 Dec 2023 | 2 Jan 2024 | 4 Dec 2024 |
| 924 | janesfamilyvacation.com | Domain.com, LLC | 15 Sep 2015 | 31 Aug 2016 | 15 Sep 2017 |
| 925 | janesellshomesforyou.com | Wild West Domains, LLC | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 926 | janesholistictherapies.com | Wild West Domains, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 927 | janesbirds.com | GoDaddy.com, LLC | 6 Apr 2018 | 18 Apr 2020 | 6 Apr 2021 |
| 928 | janespartyproductions.com | eNom, Inc. | 3 Jun 2015 | 27 May 2024 | 3 Jun 2025 |
| 929 | janespass.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 930 | janessa-mahaffey.biz | eNom, Inc. | 5 Jun 2015 | 5 Jun 2015 | 4 Jun 2016 |
| 931 | janesatchar.com | eNom, Inc. | 5 Jun 2015 | 17 Jul 2017 | 5 Jun 2017 |
| 932 | janessa.review | Key-Systems, LLC | 16 Sep 2015 | 17 Sep 2015 | 15 Sep 2016 |
| 933 | janesplan.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Dec 2023 | 1 Jan 2024 | 5 Dec 2024 |
| 934 | janescookbooks.com | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 935 | janesdick.org | GoDaddy.com, LLC | 5 Jun 2015 | 17 Jul 2017 | 5 Jun 2018 |
| 936 | janesmerlindreamweaver.com | Network Solutions, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2018 |
| 937 | janesicle.com | Internet.bs Corp. | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 938 | janesmithwrites.com | GoDaddy.com, LLC | 10 Jun 2015 | 14 Jun 2024 | 10 Jun 2025 |
| 939 | janeskead.com | Easyspace LTD | 9 Jun 2015 | 10 Jun 2024 | 9 Jun 2026 |
| 940 | janescookiejar.com | TLDs LLC dba SRSplus | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 941 | janesicle.org | Internet.bs Corp. | 7 Jun 2014 | 8 Jun 2015 | 7 Jun 2016 |
| 942 | janesthaispa.com | DreamHost, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2016 |
| 943 | janessa.faith | Key-Systems, LLC | 16 Sep 2015 | 18 Sep 2015 | 15 Sep 2016 |
| 944 | janescience.com | GoDaddy.com, LLC | 4 Jun 2022 | 4 Jun 2024 | 4 Jun 2025 |
| 945 | janesvillegarden.com | 1API GmbH | 10 Jun 2015 | 27 Mar 2017 | 10 Jun 2018 |
| 946 | janessaolsen.com | Network Solutions, LLC | 11 Jun 2015 | 14 Jul 2017 | 10 Jun 2017 |
| 947 | janesprivatehome.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 948 | janeshlive.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 949 | janesgastropub.com | GoDaddy.com, LLC | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 950 | janescookingblog.com | Wild West Domains, LLC | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2016 |
| 951 | janescakeandchef.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 952 | janesullivanphotography.com | Xin Net Technology Corporation | 22 Sep 2021 | 4 Feb 2022 | 22 Sep 2022 |
| 953 | janesinclair.com | GoDaddy.com, LLC | 30 Aug 2020 | 29 Dec 2023 | 30 Aug 2025 |
| 954 | janescatch.com | GoDaddy.com, LLC | 13 Jun 2015 | 13 Jun 2015 | 13 Jun 2017 |
| 955 | janesloven.net | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2016 |
| 956 | janesloven.info | GoDaddy.com, LLC | 19 Sep 2015 | - | 19 Sep 2016 |
| 957 | janesloven.com | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2022 | 19 Sep 2024 |
| 958 | janesvillerealestateagent.com | eNom, Inc. | 15 Jun 2015 | 15 Jun 2015 | 15 Jun 2016 |
| 959 | janescraftsupplies.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Jun 2015 | 22 Jul 2017 | 16 Jun 2017 |
| 960 | janessa-byford.biz | NameCheap, Inc. | 16 Jun 2015 | 16 Jun 2015 | 15 Jun 2016 |
| 961 | janesbeautyclinic.com | Tucows Domains Inc. | 17 Jun 2015 | 2 Jun 2024 | 17 Jun 2025 |
| 962 | janesloven.org | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2016 |
| 963 | janesheartsstitches.com | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2016 |
| 964 | janesenaphotography.com | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2017 |
| 965 | janesena.com | GoDaddy.com, LLC | 19 Sep 2015 | 19 Sep 2015 | 19 Sep 2017 |
| 966 | janesselections.info | GoDaddy.com, LLC | 27 Nov 2020 | 27 Nov 2020 | 27 Nov 2021 |
| 967 | janesimpsonconsulting.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 968 | janescheinmannn.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 969 | janesaccesorios.com | Dattatec.com SRL | 11 Nov 2023 | 11 Nov 2023 | 9 Nov 2024 |
| 970 | janessewingcorner.com | GoDaddy.com, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2017 |
| 971 | janestudent.com | Tucows Domains Inc. | 18 Jun 2013 | 22 Jun 2015 | 18 Jun 2016 |
| 972 | janescambridgekitchen.com | Automattic Inc. | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 973 | janesaddictionsale.com | GoDaddy.com, LLC | 21 Sep 2015 | 22 Sep 2015 | 21 Sep 2016 |
| 974 | janeswirled.com | GKG.NET, INC. | 22 Jun 2015 | 5 Jul 2017 | 22 Jun 2017 |
| 975 | janesimperfectlybeautiful.com | eNom, Inc. | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 976 | janesheadquarters.com | eNom, Inc. | 22 Jun 2015 | 27 May 2017 | 22 Jun 2018 |
| 977 | janesguitarstore.com | Gabia, Inc. | 23 Jun 2015 | 22 Jun 2024 | 23 Jun 2026 |
| 978 | janesvilleinsuranceagency.com | - | - | - | - |
| 979 | janestic.com | Xin Net Technology Corporation | 23 Jun 2015 | 27 Jun 2023 | 23 Jun 2027 |
| 980 | janesawyerromance.com | GoDaddy.com, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2017 |
| 981 | janesawyerbooks.com | GoDaddy.com, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2017 |
| 982 | janessa-lombard.biz | NameCheap, Inc. | 24 Jun 2015 | 24 Jun 2015 | 23 Jun 2016 |
| 983 | janesproperties.com | DropCatch.com 432 LLC | 14 Sep 2017 | 14 Sep 2017 | 14 Sep 2018 |
| 984 | janesleepandplay.com | eNom, Inc. | 26 Jun 2015 | 19 Jun 2024 | 26 Jun 2025 |
| 985 | janeshealthyrecipes.com | eNom, Inc. | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 986 | janesworldentertainment.com | Domain.com, LLC | 22 Jul 2012 | 4 Sep 2024 | 22 Jul 2024 |
| 987 | janesvillebusinessdirectory.com | NameCheap, Inc. | 11 Jun 2022 | 22 Aug 2023 | 11 Jun 2023 |
| 988 | janessa.date | Key-Systems, LLC | 22 Sep 2015 | 22 Sep 2015 | 21 Sep 2016 |
| 989 | janesartroom.com | Webfusion Ltd. | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2017 |
| 990 | janesgallery.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 991 | janesvilleautoinsurance.com | - | - | - | - |
| 992 | janesjungle.com | TurnCommerce, Inc. DBA NameBright.com | 16 Sep 2017 | 10 Sep 2020 | 16 Sep 2024 |
| 993 | janesattheheights.com | eNom1012, Inc. | 15 Sep 2019 | 16 Sep 2019 | 15 Sep 2020 |
| 994 | janesjunglesafari.net | GoDaddy.com, LLC | 28 Jun 2015 | 28 Jun 2015 | 28 Jun 2016 |
| 995 | janesjungle.net | GoDaddy.com, LLC | 28 Jun 2015 | 28 Jun 2015 | 28 Jun 2016 |
| 996 | janes40thingstodo.com | Wild West Domains, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 997 | janes-apparel.com | - | - | - | - |
| 998 | janesville-roofing.com | GoDaddy.com, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 999 | janespetcareservices.com | Tucows Domains Inc. | 1 Jul 2015 | 5 Jul 2018 | 1 Jul 2018 |
| 1000 | janescurtains.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
Displaying 1,000 out of 9,168 domains starting with the keyword "JANES". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=janes
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |