Our database now contains whois records of 575 Million (575,719,539) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1573 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [575 Million Domains] $10,000 Details

Keyword: JEFFREYEPSTEIN

Reverse Whois » KEYWORD [jeffreyepstein ]  { 88 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1jeffreyepstein.orgNameCheap, Inc.16 Jun 201631 Jul 202416 Jun 2025
2jeffreyepstein.mobiNameCheap, Inc.24 Dec 202329 Dec 202324 Dec 2024
3jeffreyepstein.netTurnCommerce, Inc. DBA NameBright.com26 May 201620 May 202126 May 2024
4jeffreyepstein.comGoDaddy.com, LLC16 May 200024 Jun 202416 May 2026
5jeffreyepstein.websiteNameCheap, Inc.23 Jan 201723 Jan 201723 Jan 2018
6jeffreyepstein.infoNameCheap, Inc.19 Apr 202019 Apr 202019 Apr 2021
7jeffreyepstein.sucksRebel.com Corp.18 Mar 20201 Jul 202018 Mar 2021
8jeffreyepstein.storeTucows Domains Inc.12 Aug 201916 Aug 202012 Aug 2021
9jeffreyepstein.onlineCrazy Domains FZ-LLC7 Jul 20222 Jul 20237 Jul 2023
10jeffreyepstein.wtfNameCheap, Inc.15 Sep 202127 Oct 202315 Sep 2023
11jeffreyepstein.co.uk-15 Sep 202216 Sep 202415 Sep 2025
12jeffreyepstein.liveGoogle, Inc.9 Mar 20218 May 20249 Mar 2024
13jeffreyepstein.newsGoDaddy.com, LLC15 Aug 202315 Aug 202415 Aug 2025
14jeffreyepstein.bioName.com, Inc.1 Jan 20246 Jan 20241 Jan 2025
15jeffreyepstein.rocksName.com, Inc.22 Jan 202427 Jan 202422 Jan 2025
16jeffreyepstein.appCloudFlare, Inc.26 Mar 202431 Mar 202426 Mar 2025
17jeffreyepstein.coCrazy Domains FZ-LLC7 Jul 202212 Jul 20247 Jul 2024
18jeffreyepsteinfoundation.comNetwork Solutions, LLC27 Nov 202323 Dec 202327 Nov 2024
19jeffreyepsteininternational.comGoDaddy.com, LLC3 Mar 20237 Mar 20243 Mar 2025
20jeffreyepsteinnewyork.comNameCheap, Inc.24 Dec 202324 Dec 202324 Dec 2024
21jeffreyepsteineducation.comGoDaddy.com, LLC3 Mar 20237 Mar 20243 Mar 2025
22jeffreyepsteinscience.comNameCheap, Inc.9 Nov 202010 Oct 20239 Nov 2024
23jeffreyepsteinblog.comGoDaddy.com, LLC11 Jul 201222 Aug 202411 Jul 2024
24jeffreyepsteinusvi.comGoDaddy.com, LLC3 Mar 20237 Mar 20243 Mar 2025
25jeffreyepsteindershowitztrumpacosta.comGoDaddy.com, LLC26 Feb 201926 Feb 201926 Feb 2020
26jeffreyepsteinsucks.comGoDaddy.com, LLC8 Jul 20198 Jul 20248 Jul 2025
27jeffreyepsteinscandal.comGoDaddy.com, LLC9 Jul 201910 Jul 20249 Jul 2025
28jeffreyepsteinsexscandal.comGoDaddy.com, LLC10 Jul 201911 Jul 202410 Jul 2025
29jeffreyepsteinlawsuit.comGoDaddy.com, LLC12 Jul 201912 Jul 201912 Jul 2020
30jeffreyepsteinvictims.comGoDaddy.com, LLC22 Jul 201922 Jul 201922 Jul 2020
31jeffreyepsteinnews.comGoDaddy.com, LLC24 Jul 201925 Jul 202424 Jul 2025
32jeffreyepsteinforum.comGoDaddy.com, LLC3 Mar 20237 Mar 20243 Mar 2025
33jeffreyepsteincase.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
34jeffreyepsteindeath.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
35jeffreyepsteinsuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
36jeffreyepsteinexposed.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
37jeffreyepsteinfounddead.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2021
38jeffreyepsteinssuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
39jeffreyepsteindead.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
40jeffreyepsteindied.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
41jeffreyepsteinconspiracy.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
42jeffreyepsteincommittedsuicide.comGoDaddy.com, LLC10 Aug 201910 Aug 201910 Aug 2020
43jeffreyepsteinobituary.comNameCheap, Inc.10 Aug 2019-10 Aug 2020
44jeffreyepsteinthemovie.comHiChina Zhicheng Technology Limited11 Aug 201911 Aug 201911 Aug 2020
45jeffreyepsteinisdead.comTucows Domains Inc.10 Aug 20197 Aug 202410 Aug 2025
46jeffreyepsteinmovie.comGoogle, Inc.13 Aug 201913 Aug 202413 Aug 2024
47jeffreyepsteinblackbook.comGoDaddy.com, LLC15 Aug 201915 Aug 201915 Aug 2020
48jeffreyepsteinmurder.comGoDaddy.com, LLC17 Aug 201918 Aug 202417 Aug 2025
49jeffreyepsteinwasmurdered.comGoDaddy.com, LLC17 Aug 201917 Aug 201917 Aug 2020
50jeffreyepsteinclaims.comGoDaddy.com, LLC23 Aug 201923 Aug 201923 Aug 2020
51jeffreyepsteindidntkillhimself.comNameCheap, Inc.30 Oct 20193 Nov 202330 Oct 2024
52jeffreyepsteindidntkillhimself.fyiNameCheap, Inc.4 Nov 20194 Nov 20194 Nov 2020
53jeffreyepsteindidntcommitsuicide.comGoDaddy.com, LLC4 Nov 20194 Nov 20194 Nov 2020
54jeffreyepsteindidnotkillhimself.comFastDomain Inc.9 Nov 20199 Nov 20199 Nov 2020
55jeffreyepsteindidntkillhimself.netCrazy Domains FZ-LLC11 Jul 20229 Jul 202411 Jul 2026
56jeffreyepsteindidnthanghimself.comFastDomain Inc.18 Nov 201918 Nov 201918 Nov 2020
57jeffreyepsteindidnothanghimself.comGoDaddy.com, LLC8 Dec 20198 Dec 20198 Dec 2020
58jeffreyepsteinmobile.comGoDaddy.com, LLC7 Jan 20207 Jan 20207 Jan 2021
59jeffreyepsteinbook.comTucows Domains Inc.15 Jan 20202 Jan 202415 Jan 2025
60jeffreyepsteinpodcast.comAutomattic Inc.14 Mar 202027 Feb 202414 Mar 2025
61jeffreyepsteindidntkillhimself.inforegister.com, Inc.13 Dec 201911 Feb 202013 Dec 2020
62jeffreyepsteinslittleblackbook.comKey-Systems GmbH1 Jun 20201 Jun 20201 Jun 2021
63jeffreyepsteingop.comGoDaddy.com, LLC12 Jul 202012 Jul 202012 Jul 2021
64jeffreyepsteinclaim.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
65jeffreyepsteinsettlements.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
66jeffreyepsteinsettlement.comGoDaddy.com, LLC14 Aug 202015 Aug 202314 Aug 2026
67jeffreyepsteinismybestfriend.comGoDaddy.com, LLC16 Sep 202016 Sep 202016 Sep 2021
68jeffreyepsteinlives.comGoDaddy.com, LLC22 Nov 202022 Nov 202022 Nov 2021
69jeffreyepsteinsfriends.comGoDaddy.com, LLC5 Aug 20216 Aug 20245 Aug 2025
70jeffreyepsteindidntkillhimselfcoin.comInternet Domain Services BS Corp10 Aug 202110 Aug 202110 Aug 2022
71jeffreyepsteinisntdead.loveGoDaddy.com, LLC9 Oct 20219 Oct 20219 Oct 2022
72jeffreyepsteinlinens.comGoDaddy.com, LLC15 Oct 202116 Oct 202315 Oct 2024
73jeffreyepsteinfanclub.comGoDaddy.com, LLC4 Jan 202217 Mar 20244 Jan 2024
74jeffreyepsteindidntkillhimself.onlineCrazy Domains FZ-LLC7 Jul 20227 Jul 20237 Jul 2024
75jeffreyepsteindidntkillhimself.orgCrazy Domains FZ-LLC7 Jul 202221 Aug 20247 Jul 2026
76jeffreyepsteinsblacklist.comEpik Inc.12 Jul 202223 Aug 202312 Jul 2023
77jeffreyepsteinhotel.comGoDaddy.com, LLC8 Jul 202219 Sep 20238 Jul 2023
78jeffreyepsteinblacklist.comNameKing.com Inc.14 Jul 202227 Aug 202314 Jul 2023
79jeffreyepsteinlist.comSquarespace Domains LLC23 Dec 202329 Dec 202323 Dec 2024
80jeffreyepsteinslist.comSquarespace Domains LLC23 Dec 202327 Dec 202323 Dec 2024
81jeffreyepsteincommunication.comNameCheap, Inc.24 Dec 202324 Dec 202324 Dec 2024
82jeffreyepsteinceleblist.com-1 Jan 20241 Jan 20241 Jan 2025
83jeffreyepsteinceleblist.online-5 Jan 20241 Aug 20245 Jan 2025
84jeffreyepsteinclientlist.online-5 Jan 20241 Aug 20245 Jan 2025
85jeffreyepsteindocuments.online-5 Jan 20241 Aug 20245 Jan 2025
86jeffreyepsteinjimmykimmel.comDynadot, LLC10 Jan 202416 Jul 202410 Jan 2025
87jeffreyepsteinsisland.comNetwork Solutions, LLC21 Apr 202421 Apr 202421 Apr 2025
88jeffreyepsteinyearbook.comGoDaddy.com, LLC31 Aug 202431 Aug 202431 Aug 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=jeffreyepstein

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now