With support for 
Keyword: KELLER
Reverse Whois » KEYWORD [keller ] { 15,347 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | keller.edu | - | 23 Apr 1997 | 11 Apr 2016 | 31 Jul 2018 |
| 2 | keller.com | Gandi SAS | 11 Apr 1991 | 9 Apr 2024 | 11 Apr 2033 |
| 3 | keller.info | - | 18 Mar 2024 | 29 Mar 2024 | 18 Mar 2025 |
| 4 | keller.media | - | 26 Feb 2024 | 23 Oct 2024 | 26 Feb 2025 |
| 5 | keller.wtf | Key-Systems, LLC | 7 Aug 2014 | 21 Sep 2024 | 7 Aug 2025 |
| 6 | keller.rocks | CloudFlare, Inc. | 29 Nov 2024 | 29 Nov 2024 | 29 Nov 2025 |
| 7 | keller.pub | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 18 Sep 2014 | 24 Aug 2024 | 18 Sep 2025 |
| 8 | keller.blackfriday | Uniregistrar Corp | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2015 |
| 9 | keller.christmas | Uniregistrar Corp | 30 Sep 2014 | 1 Oct 2014 | 30 Sep 2015 |
| 10 | keller.bike | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 6 Feb 2014 | 16 May 2024 | 6 Feb 2025 |
| 11 | keller.fund | Tucows Domains Inc. | 30 Oct 2014 | 6 Oct 2024 | 30 Oct 2025 |
| 12 | keller.photo | 1API GmbH | 28 Feb 2023 | 5 Mar 2023 | 28 Feb 2024 |
| 13 | keller.financial | Gandi SAS | 12 Apr 2023 | 17 Mar 2024 | 12 Apr 2025 |
| 14 | keller.trade | Alpnames Limited | 27 Nov 2014 | 27 Nov 2014 | 26 Nov 2015 |
| 15 | keller.voting | RegistryGate GmbH | 4 Dec 2014 | - | 4 Dec 2015 |
| 16 | keller.immo | 1API GmbH | 10 Dec 2014 | 10 Dec 2024 | 10 Dec 2025 |
| 17 | keller.koeln | Dynadot, LLC | 16 Jan 2015 | 7 May 2024 | 16 Jan 2026 |
| 18 | keller.work | united-domains AG | 10 Feb 2015 | - | 10 Feb 2016 |
| 19 | keller.red | Tucows Domains Inc. | 15 Feb 2015 | 3 May 2023 | 15 Feb 2026 |
| 20 | keller.auction | GoDaddy.com, LLC | 13 Feb 2015 | 9 Jun 2024 | 13 Feb 2025 |
| 21 | keller.tokyo | GMO Internet Inc. | 4 Mar 2015 | - | 4 Mar 2016 |
| 22 | keller.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 23 | keller.construction | Webnames.ca Inc. | 7 Apr 2015 | 2 Oct 2024 | 7 Apr 2025 |
| 24 | keller.coach | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2017 | 16 May 2024 | 20 Jul 2025 |
| 25 | keller.business | PSI-USA, Inc. dba Domain Robot | 25 May 2018 | 9 Jul 2024 | 25 May 2025 |
| 26 | keller.events | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2017 | 16 May 2024 | 20 Jul 2025 |
| 27 | keller.college | CSC Corporate Domains, Inc. | 8 Apr 2015 | 7 Mar 2024 | 8 Apr 2025 |
| 28 | keller.physio | 1&1 Internet AG | 3 Jun 2015 | 18 Jul 2016 | 3 Jun 2017 |
| 29 | keller.nyc | eNom, Inc. | 10 Jun 2015 | 7 Jun 2024 | 9 Jun 2025 |
| 30 | keller.legal | GoDaddy.com, LLC | 10 Jun 2015 | 25 Jul 2024 | 10 Jun 2025 |
| 31 | keller.sucks | CSC Corporate Domains, Inc. | 20 Jun 2015 | 20 May 2024 | 20 Jun 2025 |
| 32 | keller.bayern | united-domains AG | 24 Jun 2015 | 5 Nov 2024 | 24 Jun 2025 |
| 33 | keller.consulting | GoDaddy.com, LLC | 25 Jun 2015 | 10 Jun 2024 | 25 Jun 2025 |
| 34 | keller.xyz | PSI-USA, Inc. dba Domain Robot | 13 Oct 2019 | 16 Aug 2024 | 13 Oct 2025 |
| 35 | keller.digital | 1API GmbH | 1 Jul 2015 | 15 Aug 2024 | 1 Jul 2025 |
| 36 | keller.one | GoDaddy.com, LLC | 8 Jul 2015 | 14 Jul 2024 | 8 Jul 2025 |
| 37 | keller.party | NameCheap, Inc. | 31 Oct 2023 | 5 Nov 2023 | 31 Oct 2025 |
| 38 | keller.realtor | Name Share, Inc. | 1 Apr 2023 | 2 May 2024 | 1 Apr 2025 |
| 39 | keller.network | united-domains AG | 13 Sep 2015 | 28 Oct 2024 | 13 Sep 2025 |
| 40 | keller.properties | GoDaddy.com, LLC | 8 Oct 2015 | 12 Jul 2024 | 8 Oct 2025 |
| 41 | keller.cologne | Dynadot, LLC | 12 Oct 2015 | 20 Apr 2024 | 12 Oct 2026 |
| 42 | keller.law | GoDaddy.com, LLC | 19 Mar 2021 | 26 Jan 2022 | 19 Mar 2031 |
| 43 | keller.town | Cronon AG | 24 Oct 2015 | 24 Oct 2024 | 24 Oct 2025 |
| 44 | keller.dance | eNom, Inc. | 20 Dec 2015 | 8 Aug 2017 | 20 Dec 2017 |
| 45 | keller.guitars | Gransy s.r.o. d/b/a subreg.cz | 26 Dec 2015 | 29 Dec 2016 | 26 Dec 2017 |
| 46 | keller.ninja | Name.com, Inc. | 14 Jan 2016 | 1 Feb 2017 | 14 Jan 2018 |
| 47 | keller.engineer | InterNetworX Ltd. & Co. KG | 13 Feb 2016 | 29 Mar 2024 | 13 Feb 2025 |
| 48 | keller.fit | united-domains AG | 17 Feb 2016 | 26 Oct 2024 | 17 Feb 2025 |
| 49 | keller.cloud | 1&1 Internet AG | 16 Feb 2016 | 1 Apr 2024 | 16 Feb 2025 |
| 50 | keller.wien | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Feb 2022 | 22 Feb 2023 | 22 Feb 2024 |
| 51 | keller.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 21 May 2019 | 22 Jul 2024 | 21 May 2025 |
| 52 | keller.world | - | 21 Nov 2023 | 21 Nov 2024 | 21 Nov 2025 |
| 53 | keller.insure | GoDaddy.com, LLC | 20 Apr 2016 | 16 Jul 2024 | 20 Apr 2026 |
| 54 | keller.ink | InterNetworX Ltd. & Co. KG | 29 Apr 2016 | 14 Jun 2024 | 29 Apr 2025 |
| 55 | keller.plus | Key-Systems, LLC | 5 Dec 2024 | 5 Dec 2024 | 5 Dec 2025 |
| 56 | keller.hosting | Key-Systems, LLC | 3 Jun 2016 | 28 Aug 2024 | 3 Jun 2025 |
| 57 | keller.gmbh | Cronon AG | 29 Jun 2016 | 13 Aug 2024 | 29 Jun 2025 |
| 58 | keller.group | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Apr 2023 | 14 Oct 2024 | 28 Apr 2025 |
| 59 | keller.ca | - | 20 Oct 2000 | 26 Mar 2018 | 8 Jun 2027 |
| 60 | keller.gallery | eNom, Inc. | 12 Feb 2014 | 14 Jul 2016 | 12 Feb 2017 |
| 61 | keller.graphics | eNom, Inc. | 12 Feb 2014 | 15 Jul 2016 | 12 Feb 2017 |
| 62 | keller.estate | GoDaddy.com, LLC | 21 Feb 2014 | 30 Jun 2024 | 21 Feb 2025 |
| 63 | keller.guru | Tucows Domains Inc. | 26 Jun 2020 | 30 Jun 2021 | 26 Jun 2022 |
| 64 | keller.equipment | GoDaddy.com, LLC | 21 Feb 2014 | 7 Apr 2017 | 21 Feb 2018 |
| 65 | keller.tattoo | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 66 | keller.lol | united-domains AG | 22 Aug 2018 | 11 Oct 2024 | 22 Aug 2025 |
| 67 | keller.email | Name.com, Inc. | 23 Mar 2014 | 6 Mar 2024 | 23 Mar 2025 |
| 68 | keller.company | GoDaddy.com, LLC | 4 Sep 2018 | 5 Aug 2024 | 4 Sep 2025 |
| 69 | keller.house | Go China Domains, LLC | 9 Apr 2014 | 6 Jun 2024 | 9 Apr 2025 |
| 70 | keller.management | Metaregistrar BV Applications | 21 May 2014 | 20 May 2023 | 21 May 2023 |
| 71 | keller.computer | InterNetworX Ltd. & Co. KG | 2 Apr 2014 | 17 May 2020 | 2 Apr 2021 |
| 72 | keller.photos | Infomaniak Network SA | 31 Aug 2023 | 4 Jul 2024 | 31 Aug 2025 |
| 73 | keller.international | united-domains AG | 19 Jul 2020 | 31 Oct 2024 | 19 Jul 2025 |
| 74 | keller.photography | InterNetworX Ltd. & Co. KG | 12 Feb 2014 | 28 Mar 2024 | 12 Feb 2025 |
| 75 | keller.jobs | Gandi SAS | 30 Mar 2023 | 28 Feb 2024 | 30 Mar 2025 |
| 76 | keller.solutions | GoDaddy.com, LLC | 26 Mar 2014 | 30 Jun 2024 | 26 Mar 2025 |
| 77 | keller.technology | GoDaddy.com, LLC | 21 Feb 2014 | 30 Jun 2024 | 21 Feb 2025 |
| 78 | keller.city | GoDaddy.com, LLC | 11 Feb 2022 | 4 Sep 2024 | 11 Feb 2025 |
| 79 | keller.church | 101domain, Inc. | 14 Sep 2014 | 22 Jul 2024 | 14 Sep 2025 |
| 80 | keller.agency | - | 17 Apr 2024 | 30 Aug 2024 | 17 Apr 2025 |
| 81 | keller.zone | Network Solutions, LLC | 6 May 2014 | 12 May 2024 | 6 May 2026 |
| 82 | keller.marketing | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 30 Apr 2024 | 5 May 2024 | 30 Apr 2025 |
| 83 | keller.pics | eNom, Inc. | 1 Jun 2014 | 14 Jul 2017 | 1 Jun 2017 |
| 84 | keller.link | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 85 | keller.productions | GoDaddy.com, LLC | 11 Jun 2014 | 26 Jul 2024 | 11 Jun 2025 |
| 86 | keller.biz | Cronon AG | 27 Mar 2002 | 11 May 2024 | 26 Mar 2025 |
| 87 | keller.swiss | 1API GmbH | 11 Dec 2015 | 30 Jan 2024 | 11 Dec 2025 |
| 88 | keller.codes | InterNetworX Ltd. & Co. KG | 31 Jul 2016 | 14 Sep 2024 | 31 Jul 2025 |
| 89 | keller.support | Infomaniak Network SA | 25 Sep 2016 | 12 Aug 2024 | 25 Sep 2025 |
| 90 | keller.engineering | 1API GmbH | 29 Sep 2016 | 2 Sep 2024 | 29 Sep 2025 |
| 91 | keller.mobi | united-domains AG | 20 Oct 2006 | 20 Oct 2024 | 20 Oct 2025 |
| 92 | keller.net | Tucows Domains Inc. | 7 Oct 1996 | 7 Sep 2024 | 6 Oct 2025 |
| 93 | keller.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 21 Dec 2024 | 21 Dec 2024 | 21 Dec 2025 |
| 94 | keller.org | Network Solutions, LLC | 19 Feb 1996 | 10 Jan 2024 | 20 Feb 2029 |
| 95 | keller.us | GoDaddy.com, LLC | 28 Apr 2004 | 3 May 2024 | 27 Apr 2025 |
| 96 | keller.xxx | - | 1 Dec 2011 | 30 Jan 2012 | 1 Dec 2021 |
| 97 | keller.be | - | 1 Apr 1999 | - | - |
| 98 | keller.de | - | - | 11 Aug 2020 | - |
| 99 | keller.co.uk | - | 12 Mar 1997 | 10 Feb 2024 | 12 Mar 2025 |
| 100 | keller.software | united-domains AG | 2 Nov 2016 | 2 Nov 2024 | 2 Nov 2025 |
| 101 | keller.mba | Name.com, Inc. | 11 Mar 2017 | 14 Dec 2017 | 11 Mar 2018 |
| 102 | keller.farm | CloudFlare, Inc. | 15 Mar 2017 | 19 Feb 2024 | 15 Mar 2025 |
| 103 | keller.expert | - | 25 Jun 2024 | 30 Sep 2024 | 25 Jun 2025 |
| 104 | keller.life | Hostinger, UAB | 8 Apr 2017 | 2 Apr 2024 | 8 Apr 2025 |
| 105 | keller.reisen | Key-Systems, LLC | 29 Dec 2018 | 12 Feb 2024 | 29 Dec 2024 |
| 106 | keller.fyi | Google, Inc. | 9 Apr 2022 | 1 Jul 2024 | 9 Apr 2025 |
| 107 | keller.limited | Key-Systems, LLC | 17 May 2017 | 1 Jul 2024 | 17 May 2025 |
| 108 | keller.deals | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 May 2017 | 16 May 2024 | 17 May 2025 |
| 109 | keller.saarland | united-domains AG | 20 May 2017 | 12 Jul 2017 | 20 May 2018 |
| 110 | keller.market | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2017 | 16 May 2024 | 20 Jul 2025 |
| 111 | keller.blue | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2017 | 16 May 2024 | 20 Jul 2025 |
| 112 | keller.black | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2017 | 16 May 2024 | 20 Jul 2025 |
| 113 | keller.style | united-domains AG | 1 Nov 2018 | 1 Nov 2024 | 1 Nov 2025 |
| 114 | keller.cool | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 25 Aug 2017 | 9 Oct 2024 | 25 Aug 2025 |
| 115 | keller.store | Key-Systems, LLC | 2 Dec 2019 | 3 Dec 2024 | 2 Dec 2025 |
| 116 | keller.care | Tucows Domains Inc. | 19 Sep 2017 | 23 Sep 2022 | 19 Sep 2023 |
| 117 | keller.pl | - | 24 Dec 1999 | 24 May 2022 | 23 Dec 2027 |
| 118 | keller.org.uk | - | 21 Jul 2004 | 20 Jul 2024 | 21 Jul 2026 |
| 119 | keller.me.uk | - | 27 Nov 2008 | 21 Oct 2022 | 27 Nov 2031 |
| 120 | keller.fish | NameCheap, Inc. | 24 Jan 2018 | 30 Dec 2023 | 24 Jan 2025 |
| 121 | keller.mortgage | GoDaddy.com, LLC | 9 Mar 2018 | 20 May 2024 | 9 Mar 2024 |
| 122 | keller.click | Gandi SAS | 30 Sep 2024 | 5 Oct 2024 | 30 Sep 2025 |
| 123 | keller.center | NameCheap, Inc. | 6 Dec 2023 | 6 Dec 2024 | 6 Dec 2025 |
| 124 | keller.works | 1API GmbH | 8 Aug 2020 | 20 Jul 2024 | 8 Aug 2025 |
| 125 | keller.pro | 1API GmbH | 22 Apr 2020 | 6 Jun 2024 | 22 Apr 2025 |
| 126 | keller.team | Tucows Domains Inc. | 30 Sep 2018 | 10 Nov 2024 | 30 Sep 2024 |
| 127 | keller.systems | Network Solutions, LLC | 18 Dec 2018 | 30 Jan 2024 | 18 Dec 2023 |
| 128 | keller.dev | Google, Inc. | 25 Feb 2019 | 1 Jul 2024 | 25 Feb 2025 |
| 129 | keller.industries | Cronon AG | 22 Feb 2019 | 7 Apr 2024 | 22 Feb 2025 |
| 130 | keller.ventures | Google, Inc. | 28 Feb 2019 | 17 May 2024 | 28 Feb 2025 |
| 131 | keller.wine | GoDaddy.com, LLC | 30 Oct 2020 | 30 Oct 2020 | 30 Oct 2021 |
| 132 | keller.services | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 17 Apr 2019 | 16 May 2024 | 17 Apr 2025 |
| 133 | keller.wang | Xin Net Technology Corporation | 14 Jun 2019 | - | 14 Jun 2027 |
| 134 | keller.community | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 135 | keller.direct | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 136 | keller.training | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 137 | keller.soccer | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 138 | keller.run | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 139 | keller.academy | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 140 | keller.repair | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 141 | keller.fitness | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 142 | keller.express | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 143 | keller.report | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 144 | keller.golf | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 145 | keller.guide | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 146 | keller.tennis | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 147 | keller.education | Tucows Domains Inc. | 12 Dec 2019 | 13 Dec 2024 | 12 Dec 2025 |
| 148 | keller.club | - | 15 Apr 2021 | 10 Mar 2024 | 15 Apr 2025 |
| 149 | keller.restaurant | Tucows Domains Inc. | 10 Jan 2020 | 14 Jan 2022 | 10 Jan 2023 |
| 150 | keller.foundation | - | 16 Jun 2024 | 24 Sep 2024 | 16 Jun 2025 |
| 151 | keller.xn--6frz82g | NameCheap, Inc. | 18 Jan 2020 | - | 18 Jan 2021 |
| 152 | keller.today | Infomaniak Network SA | 23 Mar 2020 | 4 Jul 2024 | 23 Mar 2025 |
| 153 | keller.cleaning | Google, Inc. | 1 Apr 2020 | 14 Jun 2024 | 1 Apr 2025 |
| 154 | keller.green | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2017 | 16 May 2024 | 20 Jul 2025 |
| 155 | keller.tirol | 1API GmbH | 27 Feb 2017 | 27 Feb 2024 | 27 Feb 2025 |
| 156 | keller.land | Tucows Domains Inc. | 20 May 2023 | 26 Apr 2024 | 20 May 2025 |
| 157 | keller.realestate | GoDaddy.com, LLC | 23 Aug 2021 | 24 Aug 2024 | 23 Aug 2025 |
| 158 | keller.co.nz | - | 21 Dec 2000 | 14 Jul 2024 | - |
| 159 | keller.homes | GoDaddy.com, LLC | 14 Jan 2019 | 12 Jun 2024 | 14 Jan 2025 |
| 160 | keller.gmx | PSI-USA, Inc. dba Domain Robot | 20 Apr 2018 | 4 Jun 2024 | 20 Apr 2025 |
| 161 | keller.ms | Network Solutions, LLC | 7 May 2004 | 8 Mar 2024 | 7 May 2025 |
| 162 | keller.shopping | Key-Systems, LLC | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 163 | keller.asia | Cronon AG | 7 Sep 2010 | 22 Oct 2024 | 7 Sep 2025 |
| 164 | keller.realty | Epik Inc. | 27 Sep 2020 | 14 Nov 2021 | 27 Sep 2022 |
| 165 | keller.host | NameCheap, Inc. | 26 Apr 2022 | 7 May 2024 | 26 Apr 2025 |
| 166 | keller.coffee | Google, Inc. | 27 Jan 2021 | 18 Apr 2024 | 27 Jan 2025 |
| 167 | keller.plumbing | Google, Inc. | 27 Feb 2021 | 5 Jun 2024 | 27 Feb 2025 |
| 168 | keller.vision | Google, Inc. | 3 Mar 2021 | 26 Apr 2024 | 3 Mar 2025 |
| 169 | keller.contact | Cronon AG | 8 Apr 2021 | 1 Jun 2024 | 8 Apr 2025 |
| 170 | keller.partners | Network Solutions, LLC | 10 Apr 2021 | 10 Apr 2021 | 10 Apr 2022 |
| 171 | keller.nrw | NETIM SARL | 12 Apr 2021 | 1 May 2024 | 12 Apr 2025 |
| 172 | keller.place | Google, Inc. | 26 May 2021 | 26 May 2023 | 26 May 2024 |
| 173 | keller.theater | Key-Systems, LLC | 24 Jul 2021 | 27 Sep 2024 | 24 Jul 2025 |
| 174 | keller.supply | Gandi SAS | 29 Mar 2023 | 3 Mar 2024 | 29 Mar 2025 |
| 175 | keller.school | GoDaddy.com, LLC | 23 Aug 2021 | 7 Oct 2024 | 23 Aug 2025 |
| 176 | keller.limo | register.com, Inc. | 13 Sep 2021 | 13 Sep 2021 | 13 Sep 2022 |
| 177 | keller.rest | NameKing.com Inc. | 24 Oct 2021 | 3 Jul 2022 | 24 Oct 2023 |
| 178 | keller.pm | - | 19 May 2021 | 19 May 2022 | 19 May 2023 |
| 179 | keller.finance | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 3 Jul 2024 | 8 Jul 2024 | 3 Jul 2025 |
| 180 | keller.wiki | Google, Inc. | 21 Mar 2022 | 1 Jul 2024 | 21 Mar 2025 |
| 181 | keller.fr | - | 2 Mar 2024 | 11 Apr 2024 | 2 Mar 2026 |
| 182 | keller.ooo | Google, Inc. | 9 Apr 2022 | 14 Jun 2024 | 9 Apr 2025 |
| 183 | keller.madrid | 10dencehispahard, S.L. | 18 Apr 2022 | 9 Jan 2024 | 19 Apr 2025 |
| 184 | keller.vin | Google, Inc. | 19 Apr 2022 | 6 Jun 2024 | 19 Apr 2025 |
| 185 | keller.ru.com | NameKing.com Inc. | 20 Mar 2022 | 28 Jun 2022 | 20 Mar 2023 |
| 186 | keller.ag | Key-Systems GmbH | 30 Sep 2013 | 14 Nov 2024 | 30 Sep 2025 |
| 187 | keller.ac | NameCheap, Inc. | 5 Oct 2022 | 10 Oct 2022 | 5 Oct 2025 |
| 188 | keller.com.au | - | - | 8 Sep 2024 | - |
| 189 | keller.haus | - | 26 Nov 2022 | 26 Nov 2022 | 26 Nov 2023 |
| 190 | keller.zuerich | 1API GmbH | 2 Dec 2021 | 3 Dec 2024 | 2 Dec 2025 |
| 191 | keller.surf | NameCheap, Inc. | 24 Dec 2021 | 8 Jan 2023 | 24 Dec 2022 |
| 192 | keller.best | - | 30 Mar 2024 | 2 Jul 2024 | 30 Mar 2025 |
| 193 | keller.beer | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 12 Jan 2015 | 18 Dec 2023 | 12 Jan 2025 |
| 194 | keller.chat | Key-Systems, LLC | 18 Jan 2023 | 3 Mar 2024 | 18 Jan 2025 |
| 195 | keller.associates | Google, Inc. | 1 Feb 2022 | 7 Jun 2024 | 1 Feb 2025 |
| 196 | keller.co | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Jul 2010 | 16 May 2024 | 19 Jul 2025 |
| 197 | keller.bar | united-domains AG | 1 Apr 2020 | 27 Nov 2024 | 1 Apr 2025 |
| 198 | keller.com.pl | Gandi SAS | 30 Jan 1998 | 16 Sep 2024 | 29 Jan 2025 |
| 199 | keller.hr | - | 26 Feb 2020 | 28 Feb 2023 | 26 Feb 2025 |
| 200 | keller.info.pl | - | 25 Jun 2008 | 23 Jun 2024 | 25 Jun 2025 |
| 201 | keller.capital | Mesh Digital Limited | 21 Apr 2017 | 25 Apr 2024 | 21 Apr 2025 |
| 202 | keller.career | Key-Systems, LLC | 2 Dec 2019 | 10 Dec 2024 | 2 Dec 2025 |
| 203 | keller.inc | Gandi SAS | 28 Feb 2020 | 15 Apr 2024 | 28 Feb 2025 |
| 204 | keller.by | - | 8 Mar 2022 | 14 Feb 2023 | 8 Mar 2025 |
| 205 | keller.bio | NameCheap, Inc. | 9 Mar 2023 | 3 Nov 2024 | 9 Mar 2025 |
| 206 | keller.holdings | Gandi SAS | 29 Mar 2023 | 3 Mar 2024 | 29 Mar 2025 |
| 207 | keller.investments | Gandi SAS | 29 Mar 2023 | 3 Mar 2024 | 29 Mar 2025 |
| 208 | keller.london | Gandi SAS | 29 Mar 2023 | 7 May 2024 | 29 Mar 2025 |
| 209 | keller.ceo | Gandi SAS | 29 Mar 2023 | 7 May 2024 | 29 Mar 2025 |
| 210 | keller.global | Gandi SAS | 29 Mar 2023 | 3 Mar 2024 | 29 Mar 2025 |
| 211 | keller.supplies | Gandi SAS | 29 Mar 2023 | 3 Mar 2024 | 29 Mar 2025 |
| 212 | keller.security | Gandi SAS | 29 Mar 2023 | 7 May 2024 | 29 Mar 2025 |
| 213 | keller.com.pe | - | - | - | - |
| 214 | keller.africa | Gandi SAS | 5 Apr 2023 | 5 Mar 2024 | 5 Apr 2025 |
| 215 | keller.schule | Google, Inc. | 5 Apr 2023 | 6 Jun 2024 | 5 Apr 2025 |
| 216 | keller.cpa | EnCirca, Inc. | 6 Nov 2020 | 14 Oct 2024 | 6 Nov 2025 |
| 217 | keller.sport | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 16 May 2024 | 2 Dec 2024 |
| 218 | keller.llc | Key-Systems, LLC | 29 Jun 2019 | 13 Aug 2024 | 29 Jun 2025 |
| 219 | keller.careers | Gandi SAS | 12 Apr 2023 | 17 Mar 2024 | 12 Apr 2025 |
| 220 | keller.markets | Gandi SAS | 12 Apr 2023 | 17 Mar 2024 | 12 Apr 2025 |
| 221 | keller.cx | - | 8 Mar 2010 | 11 Apr 2024 | 8 Mar 2026 |
| 222 | keller.earth | NameCheap, Inc. | 22 Feb 2018 | 28 Jan 2024 | 22 Feb 2025 |
| 223 | keller.family | InterNetworX Ltd. & Co. KG | 6 Nov 2020 | 6 Nov 2024 | 6 Nov 2025 |
| 224 | keller.fun | GoDaddy.com, LLC | 11 Apr 2017 | 10 Jun 2024 | 11 Apr 2025 |
| 225 | keller.games | InterNetworX Ltd. & Co. KG | 10 Mar 2021 | 24 Apr 2024 | 10 Mar 2025 |
| 226 | keller.hamburg | Cronon AG | 19 Sep 2020 | - | 19 Sep 2025 |
| 227 | keller.help | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 22 Apr 2024 | 2 Dec 2025 |
| 228 | keller.immobilien | united-domains AG | 9 Dec 2020 | 9 Dec 2024 | 9 Dec 2025 |
| 229 | keller.in | Key-Systems GmbH | 16 Feb 2005 | 1 Apr 2024 | 16 Feb 2025 |
| 230 | keller.io | Mesh Digital Limited | 13 Mar 2012 | 11 Mar 2024 | 13 Mar 2025 |
| 231 | keller.it | - | 29 Jul 2015 | 14 Aug 2024 | 29 Jul 2025 |
| 232 | keller.live | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 233 | keller.me | - | 28 Mar 2022 | 12 May 2024 | 28 Mar 2025 |
| 234 | keller.monster | NameCheap, Inc. | 15 Jul 2020 | 29 Jun 2024 | 15 Jul 2025 |
| 235 | keller.nl | - | 24 Dec 1997 | 27 Jul 2020 | - |
| 236 | keller.ovh | OVH sas | 14 Apr 2018 | 29 May 2024 | 14 Apr 2025 |
| 237 | keller.nz | - | 14 Mar 2023 | 29 Nov 2024 | - |
| 238 | keller.top | Key-Systems, LLC | 6 Sep 2018 | 6 Sep 2018 | 6 Sep 2028 |
| 239 | keller.vip | united-domains AG | 1 Sep 2021 | 16 Oct 2024 | 1 Sep 2025 |
| 240 | keller.ski | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 241 | keller.tools | Limited Liability Company "Registrar of domain nam… | 15 May 2023 | 23 Jul 2024 | 15 May 2024 |
| 242 | keller.sc | Key-Systems GmbH | 4 Apr 2013 | 4 Apr 2023 | 4 Apr 2024 |
| 243 | keller.lc | OVH sas | 1 May 2013 | 15 Jun 2024 | 1 May 2025 |
| 244 | keller.gl | NETIM SARL | 16 Apr 2009 | 19 Feb 2024 | 1 Jun 2025 |
| 245 | keller.energy | Tucows Domains Inc. | 5 Jun 2023 | 12 May 2024 | 5 Jun 2025 |
| 246 | keller.ruhr | Global Village GmbH | 16 Nov 2016 | 17 Nov 2024 | 16 Nov 2025 |
| 247 | keller.reviews | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 248 | keller.ws | Global Domains International, Inc. DBA DomainCostC… | 1 Jun 2000 | 16 Apr 2023 | 1 Jun 2025 |
| 249 | keller.om | - | - | - | - |
| 250 | keller.com.pt | - | 8 Mar 2018 | - | 8 Feb 2025 |
| 251 | keller.qa | - | - | 21 Feb 2024 | - |
| 252 | keller.studio | Key-Systems, LLC | 2 Dec 2019 | 2 Dec 2024 | 2 Dec 2025 |
| 253 | keller.pe | - | - | - | - |
| 254 | keller.wedding | Tucows Domains Inc. | 12 Aug 2023 | 22 Sep 2024 | 12 Aug 2024 |
| 255 | keller.la | Porkbun, LLC | 27 Apr 2019 | 3 Nov 2021 | 27 Apr 2025 |
| 256 | keller.buzz | Namesilo, LLC | 29 Aug 2022 | 2 Oct 2023 | 29 Aug 2023 |
| 257 | keller.co.mz | - | 24 Sep 2020 | 3 Sep 2024 | 24 Sep 2025 |
| 258 | keller.au | - | - | 13 Oct 2024 | - |
| 259 | keller.co.in | Gandi SAS | 20 Dec 2017 | 30 Mar 2023 | 20 Dec 2024 |
| 260 | keller.co.mu | Gandi SAS | 16 Sep 2020 | 14 Aug 2024 | 15 Sep 2025 |
| 261 | keller.mu | Gandi SAS | 16 Sep 2020 | 14 Aug 2024 | 15 Sep 2025 |
| 262 | keller.org.mz | - | 7 Apr 2023 | 12 Apr 2023 | 7 Apr 2025 |
| 263 | keller.ke | - | 16 Sep 2020 | 8 Jul 2024 | 16 Sep 2025 |
| 264 | keller.band | Key-Systems, LLC | 29 Sep 2023 | 13 Nov 2024 | 29 Sep 2025 |
| 265 | keller.uk | - | 3 Jun 2019 | 3 May 2024 | 3 Jun 2025 |
| 266 | keller.com.co | Gandi SAS | 24 Jul 2018 | 28 Jun 2024 | 24 Jul 2025 |
| 267 | keller.news | Gandi SAS | 11 Dec 2023 | 15 Nov 2024 | 11 Dec 2025 |
| 268 | keller.pt | - | 3 Jul 2016 | - | 3 Jun 2025 |
| 269 | keller.yoga | Automattic Inc. | 16 Feb 2024 | 28 Apr 2024 | 16 Feb 2026 |
| 270 | keller.press | Hostinger, UAB | 8 Mar 2024 | 13 Mar 2024 | 8 Mar 2025 |
| 271 | keller.com.de | - | - | 1 Oct 2024 | - |
| 272 | keller.net.br | - | 1 Aug 2011 | 5 Jun 2024 | 1 Aug 2025 |
| 273 | keller.tax | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 Mar 2024 | 26 Mar 2024 | 19 Mar 2025 |
| 274 | keller.cat | 10dencehispahard, S.L. | 20 Mar 2024 | - | 20 Mar 2025 |
| 275 | keller.cl | - | 14 Jan 2022 | - | 14 Jan 2026 |
| 276 | keller.rent | Key-Systems, LLC | 2 Dec 2019 | 3 Dec 2024 | 2 Dec 2025 |
| 277 | keller.stream | Key-Systems, LLC | 19 Dec 2019 | 2 Feb 2024 | 19 Dec 2024 |
| 278 | keller.uno | Dynadot, LLC | 13 May 2019 | 8 May 2024 | 13 May 2026 |
| 279 | keller.cc | NameCheap, Inc. | 15 Dec 2019 | 15 Dec 2024 | 15 Dec 2025 |
| 280 | keller.ru | - | 1 Feb 2004 | - | 1 Feb 2025 |
| 281 | keller.sk | - | 4 Sep 2003 | 9 Sep 2024 | 4 Sep 2025 |
| 282 | keller.su | - | 30 Jun 2008 | - | 30 Jun 2025 |
| 283 | keller.at | - | - | 25 Mar 2019 | - |
| 284 | keller.ma | - | 10 Sep 2019 | 9 Aug 2024 | 10 Sep 2025 |
| 285 | keller.vc | Epik Inc. | 4 Nov 2024 | 9 Nov 2024 | 4 Nov 2025 |
| 286 | keller.co.id | - | 1 Dec 2021 | - | 1 Dec 2025 |
| 287 | keller.co.ke | - | 16 Sep 2020 | 8 Jul 2024 | 16 Sep 2025 |
| 288 | keller.im | - | - | - | - |
| 289 | keller.casa | CloudFlare, Inc. | 5 Nov 2024 | 5 Nov 2024 | 5 Nov 2025 |
| 290 | keller.se | Gandi SAS | 12 Jun 2023 | 3 Nov 2024 | 12 Jun 2025 |
| 291 | keller.my.id | - | 21 Nov 2024 | - | 21 Nov 2025 |
| 292 | keller-sports.de | - | - | 17 May 2024 | - |
| 293 | keller-sports.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 12 Feb 2005 | 25 Jan 2024 | 12 Feb 2026 |
| 294 | kellerfahnen.ch | - | 2 Jul 1997 | - | - |
| 295 | keller-sports.fr | Acens Technologies, S.L.U. | 23 Apr 2008 | 17 May 2024 | 20 Feb 2025 |
| 296 | kellerquotes.com | - | 18 Sep 2022 | 1 Nov 2024 | 18 Sep 2024 |
| 297 | kellerbude.de | - | - | 2 Jun 2024 | - |
| 298 | keller-druck.ch | - | - | - | - |
| 299 | keller-kalmbach.de | - | - | 23 Aug 2019 | - |
| 300 | kellerjochbahn.at | - | - | 29 Sep 2011 | - |
| 301 | keller-kalmbach.com | PSI-USA, Inc. dba Domain Robot | 23 Jun 1997 | 11 Aug 2024 | 22 Jun 2025 |
| 302 | keller-sports.ch | - | - | - | - |
| 303 | keller-sports.it | Acens Technologies, S.L.U. | 9 Jul 2007 | 17 May 2024 | 26 Apr 2025 |
| 304 | keller-verlag.de | - | - | 15 Mar 2021 | - |
| 305 | kellerencompass.com | Network Solutions, LLC | 26 Oct 2009 | 19 Sep 2024 | 26 Oct 2026 |
| 306 | kellerink.com | GoDaddy.com, LLC | 14 Dec 2007 | 2 Apr 2023 | 2 Apr 2025 |
| 307 | kellerisd.net | Network Solutions, LLC | 3 Mar 1998 | 15 Nov 2022 | 2 Mar 2025 |
| 308 | kellerkind.org | PSI-USA, Inc. dba Domain Robot | 17 Mar 2010 | 1 May 2024 | 17 Mar 2025 |
| 309 | kellerlawoffices.com | GoDaddy.com, LLC | 11 May 2007 | 20 Feb 2024 | 11 May 2029 |
| 310 | kellerreflex.com | Ilait AB | 14 Apr 2010 | 13 Feb 2014 | 14 Apr 2015 |
| 311 | kellerwilliamsaustin.com | GoDaddy.com, LLC | 5 Jul 2000 | 6 Jul 2024 | 5 Jul 2029 |
| 312 | kellerlaw.org | 1&1 Internet AG | 19 Oct 2014 | 20 Oct 2017 | 19 Oct 2018 |
| 313 | kellerschachtabdeckungen.com | PSI-USA, Inc. dba Domain Robot | 22 Oct 2014 | 23 Oct 2024 | 22 Oct 2025 |
| 314 | kellermachine.com | TurnCommerce, Inc. DBA NameBright.com | 22 Oct 2014 | 1 Dec 2024 | 22 Oct 2024 |
| 315 | keller-sports.nl | - | 4 Jul 2007 | 15 Jan 2024 | - |
| 316 | keller-sports.se | - | 19 Apr 2012 | 14 Apr 2024 | 19 Apr 2025 |
| 317 | kellerjo.net | Tucows Domains Inc. | 18 Oct 2009 | 22 Oct 2014 | 18 Oct 2015 |
| 318 | keller-sports.es | - | - | - | - |
| 319 | kelleronline.com | Network Solutions, LLC | 5 Dec 1998 | 10 Dec 2024 | 4 Dec 2025 |
| 320 | kellerwilliamslittleton.com | GoDaddy.com, LLC | 22 Sep 2020 | 3 Oct 2024 | 22 Sep 2025 |
| 321 | kellerwilliamslegacyinternational.com | GoDaddy.com, LLC | 23 Oct 2014 | 19 Oct 2016 | 23 Oct 2017 |
| 322 | kellerwilliamslancaster.com | GoDaddy.com, LLC | 23 Oct 2014 | 24 Oct 2024 | 23 Oct 2025 |
| 323 | kellerwilliamsharvard.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 324 | kellerwilliamschelmsford.com | GoDaddy.com, LLC | 20 Jun 2018 | 20 Jun 2018 | 20 Jun 2019 |
| 325 | kellerwilliamsboxboro.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 326 | kellerwilliamsbostonma.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 327 | kellerwilliamsbillerica.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 328 | kellerwilliamsbedford.com | GoDaddy.com, LLC | 23 Oct 2014 | 24 Oct 2024 | 23 Oct 2025 |
| 329 | kellerwilliamsarlington.com | GoDaddy.com, LLC | 26 Jan 2017 | 27 Jan 2024 | 26 Jan 2025 |
| 330 | kellerwilliamsacton.com | GoDaddy.com, LLC | 20 Jun 2018 | 20 Jun 2018 | 20 Jun 2019 |
| 331 | kellersupply.com | Network Solutions, LLC | 8 May 1996 | 11 Mar 2023 | 9 May 2028 |
| 332 | kellerschacht.info | PSI-USA, Inc. dba Domain Robot | 22 Oct 2014 | 22 Oct 2024 | 22 Oct 2025 |
| 333 | kellerheartt.com | GoDaddy.com, LLC | 8 Jul 2011 | 11 Feb 2024 | 8 Jul 2033 |
| 334 | kellerwilliamsasheville.com | GoDaddy.com, LLC | 14 Jul 2000 | 17 Jul 2024 | 14 Jul 2026 |
| 335 | kellerwilliamsseaisle.com | GoDaddy.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2016 |
| 336 | kelleritaly.it | - | 4 Jul 2008 | 14 Jan 2024 | 29 Dec 2024 |
| 337 | kellerhouses.com | GoDaddy.com, LLC | 9 Feb 2017 | 9 Feb 2017 | 9 Feb 2018 |
| 338 | kellerwilliamslegacyrealtyinc.com | GoDaddy.com, LLC | 27 May 2014 | 27 May 2015 | 27 May 2016 |
| 339 | kellerwilliamsbali.com | GoDaddy.com, LLC | 27 May 2013 | 28 May 2015 | 27 May 2016 |
| 340 | kellerwilliamsfortmyersbeach.com | Wild West Domains, LLC | 25 Oct 2014 | 26 Oct 2016 | 25 Oct 2017 |
| 341 | kelleroralsurgeon.com | GoDaddy.com, LLC | 25 Oct 2014 | 26 Oct 2024 | 25 Oct 2025 |
| 342 | kellerguitarshop.com | Domain.com, LLC | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 343 | kellerunited.com | GoDaddy.com, LLC | 30 May 2011 | 31 May 2015 | 30 May 2016 |
| 344 | kellerwilliamsapartments.com | GoDaddy.com, LLC | 31 May 2014 | 1 Jun 2015 | 31 May 2016 |
| 345 | kellerwilliamswestborough.com | GoDaddy.com, LLC | 26 Oct 2014 | 27 Oct 2016 | 26 Oct 2018 |
| 346 | kellerwilliamscornerstonerealty.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2024 | 27 Oct 2025 |
| 347 | kellerlindler.com | register.com, Inc. | 26 Oct 2014 | 11 Oct 2016 | 26 Oct 2018 |
| 348 | kellerwilliamsperth.com | GoDaddy.com, LLC | 3 Jun 2013 | 4 Jun 2015 | 3 Jun 2016 |
| 349 | kellerwilliamsnz.com | GoDaddy.com, LLC | 3 Jun 2013 | 4 Jun 2015 | 3 Jun 2016 |
| 350 | kellerwilliamsnewzealand.com | GoDaddy.com, LLC | 3 Jun 2013 | 4 Jun 2015 | 3 Jun 2016 |
| 351 | kellerwilliamsoceania.com | GoDaddy.com, LLC | 3 Jun 2013 | 4 Jun 2015 | 3 Jun 2016 |
| 352 | kellerwilliamsbrisbane.com | GoDaddy.com, LLC | 3 Jun 2013 | 4 Jun 2015 | 3 Jun 2016 |
| 353 | kellerwilliamssydney.com | GoDaddy.com, LLC | 3 Jun 2013 | 4 Jun 2015 | 3 Jun 2016 |
| 354 | kellerwilliams4sale.com | Wild West Domains, LLC | 8 Mar 2010 | 29 Apr 2014 | 8 Mar 2016 |
| 355 | kellerwilliamsforsale.com | Wild West Domains, LLC | 8 Mar 2010 | 29 Apr 2014 | 8 Mar 2016 |
| 356 | kellerforsale.com | GoDaddy.com, LLC | 19 Jul 2024 | 19 Jul 2024 | 19 Jul 2025 |
| 357 | kellermanseventcenter.info | GoDaddy.com, LLC | 21 May 2014 | 21 May 2015 | 21 May 2016 |
| 358 | kellersellsaz.com | GoDaddy.com, LLC | 23 May 2013 | 3 Jun 2015 | 23 May 2016 |
| 359 | kellerwilliamsrealtyhomesandestates.com | GoDaddy.com, LLC | 22 May 2012 | 22 May 2015 | 22 May 2016 |
| 360 | kellerwilliamshomesandestatesny.com | GoDaddy.com, LLC | 22 May 2012 | 22 May 2015 | 22 May 2016 |
| 361 | kellerwilliamssuffolk.com | GoDaddy.com, LLC | 22 May 2012 | 22 May 2015 | 22 May 2016 |
| 362 | kellerelectronicaccessorys.com | GoDaddy.com, LLC | 5 Jun 2013 | 6 Jun 2015 | 5 Jun 2016 |
| 363 | keller-agency.com | GoDaddy.com, LLC | 21 Sep 2023 | 21 Sep 2023 | 21 Sep 2025 |
| 364 | kellerandassociates.com | Dynadot, LLC | 24 Aug 2020 | 3 Nov 2024 | 24 Aug 2024 |
| 365 | kellergeschoss.com | eNom, Inc. | 24 Sep 2009 | 21 Dec 2016 | 24 Sep 2017 |
| 366 | kellerwilliamscoralgables.com | Acens Technologies, S.L.U. | 29 Nov 2016 | 13 Oct 2018 | 29 Nov 2018 |
| 367 | kellerwilliamsroundrock.com | GoDaddy.com, LLC | 18 Jan 2012 | 19 Jan 2015 | 18 Jan 2016 |
| 368 | kellerandsadler.com | GoDaddy.com, LLC | 16 Nov 2013 | 7 Nov 2014 | 16 Nov 2015 |
| 369 | kellerandsadlercpa.com | GoDaddy.com, LLC | 16 Nov 2013 | 7 Nov 2014 | 16 Nov 2015 |
| 370 | kellertxbabyphotography.com | GoDaddy.com, LLC | 3 Feb 2012 | 28 Apr 2015 | 15 Sep 2015 |
| 371 | kellerbabyphotography.com | GoDaddy.com, LLC | 6 May 2012 | 28 Apr 2015 | 15 Sep 2015 |
| 372 | kellerwilliamsluxurydtc.com | GoDaddy.com, LLC | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 373 | kellerwilliamsluxuryhomesdtc.com | GoDaddy.com, LLC | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 374 | kellermcgraw.com | GoDaddy.com, LLC | 28 Oct 2014 | 29 Oct 2024 | 28 Oct 2025 |
| 375 | kellerdevelopment.com | GoDaddy.com, LLC | 26 Feb 2004 | 15 Mar 2023 | 26 Feb 2025 |
| 376 | kellerhschoir.com | GoDaddy.com, LLC | 13 Jan 2016 | 13 Jan 2016 | 13 Jan 2017 |
| 377 | kellerwilliamsrealestate.net | GoDaddy.com, LLC | 28 Dec 1999 | 28 Dec 2023 | 28 Dec 2024 |
| 378 | kellerwilliamsrealestate.com | GoDaddy.com, LLC | 28 Dec 1999 | 28 Dec 2023 | 28 Dec 2024 |
| 379 | keller-appliance.net | GoDaddy.com, LLC | 28 Sep 2023 | 29 Sep 2024 | 28 Sep 2025 |
| 380 | kellertv.com | GoDaddy.com, LLC | 12 Sep 2018 | 12 Sep 2024 | 12 Sep 2025 |
| 381 | kellerwilliamsre.com | GoDaddy.com, LLC | 1 Nov 2022 | 2 Nov 2024 | 1 Nov 2026 |
| 382 | kellerwilliamslanierpartners.com | GoDaddy.com, LLC | 11 May 2017 | 12 May 2024 | 11 May 2025 |
| 383 | kellerwilliamsgainesvillegeorgia.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 384 | kellerwilliamscommercialdivision.com | GoDaddy.com, LLC | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2015 |
| 385 | kellerurgentcare.com | TierraNet Inc. d/b/a DomainDiscover | 28 Oct 2014 | 13 Aug 2024 | 28 Oct 2025 |
| 386 | kellerwilliamshomesearch.com | GoDaddy.com, LLC | 18 Oct 2004 | 14 Apr 2015 | 18 Oct 2015 |
| 387 | kellerwilliamshomesforsale.com | GoDaddy.com, LLC | 18 Oct 2004 | 14 Apr 2015 | 18 Oct 2015 |
| 388 | kellerwilliamspremier.com | Web Commerce Communications Limited dba WebNic.cc | 5 Jan 2024 | 26 Oct 2022 | 5 Jan 2025 |
| 389 | kellerwilliamspremierproperties.com | GoDaddy.com, LLC | 26 Aug 2022 | 27 Aug 2024 | 26 Aug 2025 |
| 390 | kellerwilliamsrochester.com | Web Commerce Communications Limited dba WebNic.cc | 5 Jan 2024 | 26 Oct 2022 | 5 Jan 2025 |
| 391 | kellersprinklerrepair.com | GoDaddy.com, LLC | 24 Apr 2010 | 9 Mar 2024 | 24 Apr 2025 |
| 392 | kellerhomepricereport.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 393 | keller76248.com | 1&1 Internet AG | 31 Oct 2014 | 13 Mar 2018 | 31 Oct 2025 |
| 394 | keller76244.com | 1&1 Internet AG | 31 Oct 2014 | 31 Oct 2024 | 31 Oct 2025 |
| 395 | kellerwilliamsrelo.com | GoDaddy.com, LLC | 5 May 2005 | 14 Apr 2015 | 31 Dec 2015 |
| 396 | kellerwilliamsaubrey.com | GoDaddy.com, LLC | 16 Jul 2010 | 29 Jan 2015 | 16 Jul 2015 |
| 397 | kellertxoverheadgaragedoorservicecompany.com | GoDaddy.com, LLC | 31 Oct 2014 | 11 Oct 2023 | 31 Oct 2028 |
| 398 | kellersenterprises.com | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 399 | kelleroverheadgaragedoorrepairserviceco.com | GoDaddy.com, LLC | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 400 | kellerlumbercompany.com | NameCheap, Inc. | 31 Oct 2014 | 4 Oct 2021 | 31 Oct 2026 |
| 401 | kellerlawllc.com | GoDaddy.com, LLC | 31 Oct 2014 | 1 Nov 2024 | 31 Oct 2026 |
| 402 | keller-game.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Nov 2014 | 1 Jan 2015 | 1 Nov 2018 |
| 403 | kellersfarmstores.com | Tucows Domains Inc. | 9 Jun 2004 | 11 May 2024 | 9 Jun 2025 |
| 404 | kellerwilliamswestfieldnj.com | GoDaddy.com, LLC | 18 Mar 2013 | 19 Mar 2023 | 18 Mar 2025 |
| 405 | kellercustomsigns.com | Network Solutions, LLC | 16 Nov 2000 | 18 Nov 2022 | 16 Nov 2027 |
| 406 | kellerlab.com | GoDaddy.com, LLC | 1 Jul 1996 | 28 May 2024 | 30 Jun 2026 |
| 407 | kellerbuildersroofing.com | NameCheap, Inc. | 26 Aug 2011 | 27 Jul 2024 | 26 Aug 2025 |
| 408 | kellermanvintage.com | Namesilo, LLC | 26 Jan 2021 | 19 Dec 2023 | 26 Jan 2025 |
| 409 | kellerwillams.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Dec 2002 | 30 Aug 2024 | 10 Dec 2025 |
| 410 | kellerstudio.de | - | - | 27 Dec 2007 | - |
| 411 | kellerandwilliams.com | GoDaddy.com, LLC | 26 Jan 2003 | 25 Apr 2024 | 26 Jan 2025 |
| 412 | kellerwilliamsgr.com | GoDaddy.com, LLC | 27 Dec 2001 | 2 Dec 2024 | 27 Dec 2025 |
| 413 | kellerhousevalues.net | 1&1 Internet AG | 30 Oct 2014 | 31 Oct 2016 | 30 Oct 2017 |
| 414 | kellerfarmsinc.com | Tucows Domains Inc. | 4 Jun 2004 | 20 May 2024 | 4 Jun 2025 |
| 415 | kellerman.info | Google, Inc. | 17 Jul 2021 | 8 Jul 2024 | 17 Jul 2025 |
| 416 | kellerwilliamsomaha.com | GoDaddy.com, LLC | 12 Jun 2017 | 12 Jun 2017 | 12 Jun 2022 |
| 417 | kellerwilliamhomes.com | Wild West Domains, LLC | 16 Sep 2013 | 17 Sep 2014 | 16 Sep 2015 |
| 418 | kellermanwildlifephoto.com | Go France Domains, LLC | 13 Dec 2014 | 18 Apr 2015 | 13 Dec 2015 |
| 419 | kellersaws.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jun 2002 | 9 Feb 2024 | 25 Jun 2025 |
| 420 | kellerhomesforsale.com | GoDaddy.com, LLC | 4 Dec 2010 | 2 Dec 2024 | 4 Dec 2025 |
| 421 | kellerappliance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jun 2006 | 9 May 2017 | 9 Jun 2018 |
| 422 | kellerwiliamsrealty.com | eNom, Inc. | 30 Jun 2018 | 30 Jun 2018 | 30 Jun 2019 |
| 423 | kellerpropertymgt.com | NameCheap, Inc. | 12 Jul 2004 | 16 Jul 2024 | 12 Jul 2025 |
| 424 | kellermeyerbuildingservices.com | - | - | - | - |
| 425 | kellergreenhouse.com | !#No1Registrar, LLC | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 426 | kellerfootball.com | TurnCommerce, Inc. DBA NameBright.com | 1 Nov 2014 | 1 Mar 2024 | 1 Nov 2025 |
| 427 | keller-david.com | Cronon AG | 1 Nov 2014 | 2 Nov 2024 | 1 Nov 2025 |
| 428 | kellerwilliamslongmont.com | FastDomain Inc. | 6 Feb 2004 | 21 Jan 2024 | 6 Feb 2025 |
| 429 | kellerbros.com | Network Solutions, LLC | 3 Dec 1996 | 4 Jan 2018 | 2 Dec 2025 |
| 430 | kellertheater.com | eNom, Inc. | 3 Dec 2009 | 7 Dec 2024 | 3 Dec 2025 |
| 431 | kellerandwilliamsrealestate.com | eNom, Inc. | 18 Oct 2021 | 18 Oct 2021 | 18 Oct 2022 |
| 432 | kellercinema.com | EuroDNS S.A. | 10 Jun 2005 | 9 Jan 2015 | 10 Dec 2015 |
| 433 | kellerwilliamsinternational.com | GoDaddy.com, LLC | 30 Mar 2022 | 10 Apr 2023 | 30 Mar 2024 |
| 434 | kellertxrealestate.com | Wild West Domains, LLC | 15 May 2007 | 26 Jun 2015 | 15 May 2016 |
| 435 | kellermachining.net | - | - | - | - |
| 436 | kellerauto.com | GoDaddy.com, LLC | 19 Dec 2006 | 26 Sep 2024 | 19 Dec 2024 |
| 437 | kellerproservices.us | GoDaddy.com, LLC | 9 Jun 2014 | 9 Jun 2014 | 8 Jun 2015 |
| 438 | kellerhsathletics.mobi | GoDaddy.com, LLC | 19 Jul 2012 | 13 Aug 2024 | 19 Jul 2025 |
| 439 | kellerknapprealty.com | Melbourne IT, Ltd | 3 Dec 2005 | 3 Dec 2024 | 3 Dec 2025 |
| 440 | kellertransmissionservice.com | GoDaddy.com, LLC | 29 May 2012 | 30 May 2024 | 29 May 2025 |
| 441 | kellerwilliamscitylife.com | GoDaddy.com, LLC | 6 Jun 2013 | 7 Jun 2015 | 6 Jun 2016 |
| 442 | kellerwilliamshobokencitylife.com | GoDaddy.com, LLC | 6 Jun 2013 | 7 Jun 2015 | 6 Jun 2016 |
| 443 | kellerwilliamscarolinas.com | GoDaddy.com, LLC | 6 Jun 2003 | 7 Jun 2015 | 6 Jun 2016 |
| 444 | kellers3dmascara.com | GoDaddy.com, LLC | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 445 | kellertaxi.us | GoDaddy.com, LLC | 9 Jun 2014 | 1 Dec 2014 | 8 Jun 2015 |
| 446 | kellerinternational.com | GoDaddy.com, LLC | 10 Apr 2001 | 3 Sep 2022 | 10 Apr 2030 |
| 447 | kellerwilliamsnashua.com | GoDaddy.com, LLC | 18 Jan 2007 | 19 Jan 2023 | 18 Jan 2025 |
| 448 | kellerwilliamsgreenbay.com | GoDaddy.com, LLC | 14 Sep 2021 | 26 Nov 2023 | 14 Sep 2023 |
| 449 | kellerscreamery.com | Brandsight, Inc. | 2 Jun 2000 | 5 May 2024 | 2 Jun 2025 |
| 450 | kellerclan.org | NameCheap, Inc. | 1 Nov 2014 | 7 Oct 2024 | 1 Nov 2025 |
| 451 | kellerwilliamsrealty.ca | - | 7 Dec 2009 | 2 Dec 2024 | 7 Dec 2025 |
| 452 | kellerwilliamsrealestateoffices.com | GoDaddy.com, LLC | 11 Jun 2013 | 12 Jun 2015 | 11 Jun 2016 |
| 453 | kellerglasscompany.com | GoDaddy.com, LLC | 11 Jun 2012 | 12 Jun 2015 | 11 Jun 2016 |
| 454 | kellerwilliamsrealty.com | DNC Holdings, Inc. | 7 May 2001 | 23 Mar 2024 | 7 May 2025 |
| 455 | kellerco.com | CSC Corporate Domains, Inc. | 21 Oct 2001 | 28 Sep 2023 | 21 Oct 2026 |
| 456 | kellerwilliamsrealtyinternational.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2016 | 4 Nov 2017 |
| 457 | kellerwilliamsrealtyinc.com | GoDaddy.com, LLC | 3 Nov 2014 | 4 Nov 2016 | 3 Nov 2017 |
| 458 | kellerwilliamselite.com | GoDaddy.com, LLC | 3 Nov 2014 | 4 Nov 2024 | 3 Nov 2025 |
| 459 | kellersbarbershop.com | GoDaddy.com, LLC | 16 Apr 2020 | 21 Apr 2024 | 16 Apr 2026 |
| 460 | kellerose.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 461 | kellerwillians.com | Above.com Pty Ltd. | 2 Sep 2009 | 13 Oct 2024 | 2 Sep 2024 |
| 462 | kellercofc.org | Amazon Registrar, Inc. | 18 Dec 2008 | 18 Nov 2024 | 18 Dec 2025 |
| 463 | kellerlandscapingtx.com | GoDaddy.com, LLC | 7 May 2012 | 8 May 2024 | 7 May 2026 |
| 464 | kellerchina.com | GoDaddy.com, LLC | 22 Mar 2005 | 3 Sep 2022 | 22 Mar 2026 |
| 465 | kellertechnology.com | Network Solutions, LLC | 1 Jun 1999 | 1 Jun 2024 | 1 Jun 2034 |
| 466 | kellerfordkia.com | FastDomain Inc. | 20 Jan 2024 | 29 Feb 2024 | 20 Jan 2025 |
| 467 | kellerf.com | FastDomain Inc. | 30 Apr 2003 | 14 Apr 2024 | 30 Apr 2025 |
| 468 | keller-koch-realtors.com | Network Solutions, LLC | 2 Sep 2000 | 3 Jul 2024 | 2 Sep 2025 |
| 469 | kellerladder.net | Network Solutions, LLC | 3 Nov 2005 | 4 Sep 2023 | 3 Nov 2028 |
| 470 | kellerandco.com | CSC Corporate Domains, Inc. | 6 Dec 1996 | 1 Dec 2024 | 5 Dec 2025 |
| 471 | kellerhousingcommunitiespa.com | GoDaddy.com, LLC | 9 Mar 2012 | 31 Jan 2024 | 9 Mar 2025 |
| 472 | kellerwilliamsbluebell.com | GoDaddy.com, LLC | 21 Oct 2010 | 22 Oct 2023 | 21 Oct 2026 |
| 473 | kellerbrosford.com | GoDaddy.com, LLC | 23 Jan 1998 | 12 Jun 2024 | 19 Jun 2025 |
| 474 | kellerwilliamstalentdevelopment.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2019 |
| 475 | kellermanlawoffice.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jul 2016 | 24 Aug 2017 | 13 Jul 2017 |
| 476 | kellerist.com | Domain.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 477 | kellereasterling.com | Tucows Domains Inc. | 4 Nov 2014 | 4 Oct 2024 | 4 Nov 2025 |
| 478 | kellercorealtors.com | Tucows Domains Inc. | 17 Aug 2014 | 16 Aug 2024 | 17 Aug 2025 |
| 479 | kellerreinert.com | GoDaddy.com, LLC | 11 May 2016 | 11 May 2016 | 11 May 2017 |
| 480 | kellerwilliamsspecialty.info | GoDaddy.com, LLC | 12 Jun 2014 | 12 Jun 2015 | 12 Jun 2016 |
| 481 | kellercheck.com | 1&1 Internet AG | 30 Jun 2016 | 16 Jul 2021 | 30 Jun 2025 |
| 482 | kellersconfections.com | GoDaddy.com, LLC | 14 Jun 2013 | 14 Jun 2015 | 14 Jun 2016 |
| 483 | kellerenterprises.info | 1&1 Internet AG | 29 Aug 2018 | 16 Sep 2018 | 29 Aug 2019 |
| 484 | kellercresent.com | GoDaddy.com, LLC | 16 Jun 2014 | 16 Jun 2015 | 16 Jun 2016 |
| 485 | keller817locksmith.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 486 | kellernewesthomes.com | Wild West Domains, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2017 |
| 487 | kellervip.com | HiChina Zhicheng Technology Limited | 24 Aug 2016 | 8 Aug 2017 | 24 Aug 2018 |
| 488 | kellerwilliamshayesvillenc.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 489 | kellerwilliamshiawasseega.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 490 | kellerwilliamsmurphync.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 491 | kellerwilliamssylvanc.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 492 | kellerwilliamsmtbelvieu.com | GoDaddy.com, LLC | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 493 | kellersouthlakehomesforsale.com | Wild West Domains, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 494 | kellerpubliclibrary.com | Fabulous.com Pty Ltd. | 4 Apr 2005 | 3 Nov 2017 | 3 Oct 2018 |
| 495 | kellermsrasia.com | Network Solutions, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 496 | kelleralbums.com | GoDaddy.com, LLC | 19 Jun 2014 | 19 Jun 2015 | 19 Jun 2016 |
| 497 | keller-roofing.com | GoDaddy.com, LLC | 23 Nov 2022 | 24 Nov 2024 | 23 Nov 2025 |
| 498 | kellerdogpark.com | GoDaddy.com, LLC | 19 Jun 2013 | 19 Jun 2015 | 19 Jun 2016 |
| 499 | kelleralbum.com | GoDaddy.com, LLC | 19 Jun 2014 | 19 Jun 2015 | 19 Jun 2016 |
| 500 | kellercarpet.net | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 501 | kellercarpet.com | GoDaddy.com, LLC | 19 Jun 2013 | 30 May 2024 | 19 Jun 2025 |
| 502 | kellerwilliamslies.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 503 | kellerfloorstore.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 504 | kellerfloorstore.net | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 505 | kellerflooring.net | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 506 | kellertile.net | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 507 | kellerroofingcontractors.com | - | 8 Aug 2024 | 9 Aug 2024 | 8 Aug 2025 |
| 508 | kellerpaving.com | TurnCommerce, Inc. DBA NameBright.com | 19 Aug 2014 | 30 Sep 2024 | 19 Aug 2024 |
| 509 | kellerwilliamswyoming.com | GoDaddy.com, LLC | 24 Dec 2020 | 25 Dec 2023 | 24 Dec 2024 |
| 510 | kellerwilliamscedarrapids.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 511 | kellerwilliamscorridor.com | - | - | - | - |
| 512 | kellerwilliamsic.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 513 | kellerwilliamsiowacity.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 514 | kellerrealtypr.net | Wild West Domains, LLC | 28 Mar 2018 | 22 Mar 2024 | 28 Mar 2025 |
| 515 | kellerrivest.com | Network Solutions, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 516 | kellerwilliamsthousandoaks.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 517 | kellerwilliamssimi.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 518 | kellerwilliamsmoorpark.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 519 | kellerwilliamscalabasas.com | GoDaddy.com, LLC | 24 Jan 2017 | 16 Jan 2024 | 24 Jan 2025 |
| 520 | kellerwilliamsagoura.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 521 | kellerwaylogistics.com | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 522 | kellerknife.com | GoDaddy.com, LLC | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 523 | kellerjuices.com | OnlineNIC, Inc. | 6 Nov 2014 | 27 Oct 2024 | 6 Nov 2025 |
| 524 | kellertaxicar.com | Launchpad, Inc. | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 525 | kellerwilliamsnwmt.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Aug 2024 | 21 Aug 2025 |
| 526 | kellerconsulting.org | Network Solutions, LLC | 6 Feb 2015 | 12 Dec 2024 | 6 Feb 2030 |
| 527 | kellerimagingpdx.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 528 | kellerwilliamsatasehir.com | IHS Telekom, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 529 | kellerwilliamscareer.com | GoDaddy.com, LLC | 23 May 2023 | 23 May 2023 | 23 May 2025 |
| 530 | kellerwilliamscasagrande.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2016 |
| 531 | kellerwilliamskartal.com | IHS Telekom, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 532 | kellerwilliamskavacik.com | IHS Telekom, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 533 | kellerwilliamskozyatagi.com | IHS Telekom, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 534 | kellerwilliamsrealestatecuba.org | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 535 | kellercrush.com | DomainPeople, Inc. | 1 Mar 2015 | 1 Mar 2015 | 1 Mar 2016 |
| 536 | kellerkollektion.com | GoDaddy.com, LLC | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 537 | kellerroofingsd.com | GoDaddy.com, LLC | 18 Apr 2019 | 18 Apr 2019 | 18 Apr 2020 |
| 538 | kellerhomesellingteam.com | GoDaddy.com, LLC | 30 Apr 2019 | 30 Apr 2019 | 30 Apr 2020 |
| 539 | kellerina.com | TurnCommerce, Inc. DBA NameBright.com | 24 Nov 2018 | 18 Nov 2020 | 24 Nov 2024 |
| 540 | kellerwilliamsinfo.com | GoDaddy.com, LLC | 23 Mar 2021 | 3 May 2024 | 23 Mar 2024 |
| 541 | kellerwilliamsistheplacetobe.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2016 |
| 542 | kellerwilliamsjoin.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2016 |
| 543 | kellervictor.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Nov 2014 | 2 Nov 2024 | 7 Nov 2025 |
| 544 | kellerclinicsd.com | DNSPod, Inc. | 11 Feb 2022 | 11 Feb 2022 | 11 Feb 2023 |
| 545 | keller-ic.com | MAFF Inc. | 26 Jan 2021 | 5 Mar 2024 | 26 Jan 2024 |
| 546 | kellerembroidery.net | GoDaddy.com, LLC | 14 Apr 2015 | 15 Apr 2024 | 14 Apr 2025 |
| 547 | kellerwilliamsemeraldcoast.net | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2024 | 6 Nov 2025 |
| 548 | kellerelectrician.com | Sugar Cube Domains, LLC | 21 Aug 2024 | 24 Oct 2024 | 21 Aug 2025 |
| 549 | kellerit.net | NameCheap, Inc. | 8 Apr 2019 | 8 Apr 2019 | 8 Apr 2020 |
| 550 | kellerscape.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 551 | kellerwilliamsconroe.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 552 | kellerwilliamsthewoodlands.com | GoDaddy.com, LLC | 21 Feb 2016 | 21 Feb 2016 | 21 Feb 2017 |
| 553 | kellertaxiservice.com | Domain.com, LLC | 8 Nov 2014 | 24 Oct 2017 | 8 Nov 2018 |
| 554 | kellerpeirce.com | Name.com, Inc. | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 555 | kellerwilliamsrealtychapelhill.com | DropCatch.com 408 LLC | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 556 | keller-bautenschutz.com | 1&1 Internet AG | 26 Aug 2014 | 13 Mar 2018 | 26 Aug 2025 |
| 557 | kellergroup.us | Google, Inc. | 26 Aug 2014 | 26 Aug 2017 | 25 Aug 2018 |
| 558 | kellermaquinas.com | eNom, Inc. | 25 Aug 2014 | 25 Aug 2014 | 25 Aug 2015 |
| 559 | kellertoothdoctordfw.com | GoDaddy.com, LLC | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 560 | kellerwilliamsnow.com | GoDaddy.com, LLC | 26 Aug 2014 | 27 Sep 2024 | 26 Aug 2024 |
| 561 | kellerwilliamsyuma.com | GoDaddy.com, LLC | 26 Aug 2014 | 27 Aug 2024 | 26 Aug 2025 |
| 562 | kellerstroud.com | register.com, Inc. | 9 Nov 2014 | 7 Sep 2015 | 9 Nov 2017 |
| 563 | kellermoebel.com | 1&1 Internet AG | 14 Aug 2014 | 12 Oct 2020 | 14 Aug 2025 |
| 564 | kellerpremiersports.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 565 | kellerstaxidermy.com | Hongkong Domain Name Information Management Co., L… | 1 Nov 2022 | 11 Jan 2024 | 1 Nov 2023 |
| 566 | kellerwilliamsrealestateutah.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 567 | kellerwilliamsrealtyutah.net | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2016 |
| 568 | kellercityguide.com | GoDaddy.com, LLC | 27 Aug 2014 | 8 Oct 2024 | 27 Aug 2024 |
| 569 | kellerisolierung.com | - | 19 Apr 2024 | 28 Oct 2024 | 19 Apr 2025 |
| 570 | kellerwilliamsankenymetro.com | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2024 | 27 Aug 2026 |
| 571 | kellerwilliamsar.com | Tucows Domains Inc. | 27 Aug 2014 | 31 Aug 2015 | 27 Aug 2016 |
| 572 | kellerwilliamsmetronorth.com | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2024 | 27 Aug 2026 |
| 573 | kellermichael.com | CloudFlare, Inc. | 5 Nov 2020 | 6 Oct 2024 | 5 Nov 2025 |
| 574 | kellertxhomesysteminstaller.com | eNom, Inc. | 15 Aug 2014 | 16 Dec 2016 | 15 Aug 2017 |
| 575 | kellerwilliamscaliforniarealestate.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 576 | kellerwilliamscoastalvirginia.com | Wild West Domains, LLC | 15 Aug 2014 | 16 Sep 2022 | 15 Aug 2025 |
| 577 | kellerwilliamstexasrealestate.com | GoDaddy.com, LLC | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 578 | kellersteve.com | Dynamic Network Services, Inc. | 10 Nov 2014 | 10 Nov 2024 | 10 Nov 2025 |
| 579 | kellerland.com | TurnCommerce, Inc. DBA NameBright.com | 16 Nov 2015 | 10 Nov 2020 | 16 Nov 2025 |
| 580 | kellermeade.com | GoDaddy.com, LLC | 29 Aug 2014 | 3 Sep 2024 | 29 Aug 2025 |
| 581 | kellerwilliamswebrealty.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 582 | keller-reinert.com | Network Solutions, LLC | 16 Aug 2014 | 5 Mar 2017 | 16 Aug 2017 |
| 583 | kellerfirearms.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 584 | kellerreinertassociates.com | Network Solutions, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 585 | kellervideo.com | WhatIsYourDomain LLC | 12 Dec 2013 | 13 Dec 2017 | 12 Dec 2018 |
| 586 | kellerwilliamsmaliburealtor.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 587 | kellerwilliamspalisadesrealtor.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 588 | kellerwilliamsrealtortopangacanyon.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 589 | kellerwilliamsrealtorwoodlandhills.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 590 | kellerwilliamstopangacanyonrealtor.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 591 | kellerwilliamswoodlandhills.com | GoDaddy.com, LLC | 16 Aug 2014 | 17 Aug 2016 | 16 Aug 2017 |
| 592 | kellerwilliamsapts.com | GoDaddy.com, LLC | 12 Nov 2014 | 12 Nov 2014 | 12 Nov 2015 |
| 593 | kellerskatsrescue.org | GoDaddy.com, LLC | 10 Nov 2014 | 16 Nov 2024 | 10 Nov 2026 |
| 594 | keller-fencing.com | eNom, Inc. | 11 Sep 2014 | 23 Oct 2017 | 11 Sep 2018 |
| 595 | kellerfamilymichigan.com | GoDaddy.com, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 596 | kellerwilliamsrealtyidaho.com | GoDaddy.com, LLC | 12 May 2020 | 13 Nov 2022 | 12 May 2025 |
| 597 | kellerlifetimeengine.com | Tucows Domains Inc. | 13 Nov 2014 | 17 Nov 2017 | 13 Nov 2017 |
| 598 | kellerfinegoldandassoc.com | GoDaddy.com, LLC | 13 Nov 2014 | 13 Nov 2014 | 13 Nov 2015 |
| 599 | kellerdoctors.com | Epik Inc. | 1 Feb 2019 | 28 Nov 2021 | 1 Feb 2025 |
| 600 | kelleryourfreetrees.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 601 | kellerpetcare.com | GoDaddy.com, LLC | 13 Sep 2014 | 6 Sep 2016 | 13 Sep 2017 |
| 602 | kellerrealestateagency.com | eNom, Inc. | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 603 | kellerwilliamssandnsea.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2016 | 31 Aug 2017 |
| 604 | kellercryo.com | GoDaddy.com, LLC | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 605 | kellerwilliamsmontclairnj.com | GoDaddy.com, LLC | 14 Jan 2021 | 29 Oct 2022 | 14 Jan 2026 |
| 606 | kellerwilliamsportal.com | GoDaddy.com, LLC | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 607 | kellerknights.com | GoDaddy.com, LLC | 12 Nov 2019 | 13 Nov 2023 | 12 Nov 2025 |
| 608 | kellerwilliamsrealtyclarksville.com | GoDaddy.com, LLC | 30 Mar 2021 | 30 Mar 2021 | 30 Mar 2022 |
| 609 | kellerwilliamsrealtyclarksvilletn.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 610 | kellerwilliamsrealtyexit1.com | GoDaddy.com, LLC | 1 Mar 2019 | 2 Mar 2024 | 1 Mar 2025 |
| 611 | kellerwilliamsrealtyexitone.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 612 | kellerwilliamsrealtytinytownrd.com | GoDaddy.com, LLC | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 613 | kellerge.net | Name.com, Inc. | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 614 | kellerwilliamsrealtyboise.com | GoDaddy.com, LLC | 12 May 2020 | 13 Nov 2022 | 12 May 2025 |
| 615 | kellerconsultinginc.com | Google, Inc. | 7 Oct 2021 | 8 Oct 2023 | 7 Oct 2024 |
| 616 | keller-elastomere.com | RegistryGate GmbH | 15 Sep 2014 | 20 Oct 2024 | 15 Sep 2025 |
| 617 | keller-gmbh.com | united-domains AG | 15 Sep 2014 | 9 Nov 2024 | 15 Sep 2025 |
| 618 | kellerlimo.com | register.com, Inc. | 26 Mar 2021 | 25 Feb 2024 | 26 Mar 2025 |
| 619 | kellernyc.com | Google, Inc. | 15 Sep 2014 | 31 Aug 2024 | 15 Sep 2025 |
| 620 | kellertreeservice.com | GoDaddy.com, LLC | 20 Feb 2022 | 29 Jun 2024 | 29 Jul 2025 |
| 621 | kellerwebdesigner.com | Launchpad, Inc. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 622 | kellerwilliamsvalencia.com | GoDaddy.com, LLC | 15 Jul 2021 | 15 Jul 2023 | 15 Jul 2025 |
| 623 | kellerwilliamstucson.com | GoDaddy.com, LLC | 9 Jul 2016 | 9 Jul 2016 | 9 Jul 2017 |
| 624 | kellerwilliamstacoma.com | GoDaddy.com, LLC | 19 Apr 2018 | 2 Jun 2024 | 19 Apr 2025 |
| 625 | kellerwilliamsstgeorge.com | GoDaddy.com, LLC | 28 Dec 2020 | 28 Dec 2020 | 28 Dec 2021 |
| 626 | kellerwilliamsreno.com | GoDaddy.com, LLC | 20 May 2020 | 21 May 2024 | 20 May 2025 |
| 627 | kellerwilliamspokane.com | - | 9 Sep 2016 | 9 Sep 2016 | 9 Sep 2018 |
| 628 | kellerwilliamsoklahomacity.com | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 629 | kellerwilliamsmiamibeach.com | GoDaddy.com, LLC | 14 Aug 2018 | 15 Aug 2024 | 14 Aug 2025 |
| 630 | kellerwilliamsirvine.com | Google, Inc. | 2 Jul 2020 | 17 Jun 2024 | 2 Jul 2025 |
| 631 | kellerwilliamsexecutiveteam.com | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 632 | kellerwilliamsbethesda.com | GoDaddy.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 633 | kellerwilliamsaskewteam.com | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 634 | keller-williams-the-woodlands.com | GoDaddy.com, LLC | 15 Nov 2014 | 16 Nov 2018 | 15 Nov 2020 |
| 635 | keller-williams-houston.com | GoDaddy.com, LLC | 15 Nov 2014 | 16 Nov 2018 | 15 Nov 2020 |
| 636 | kellerbabies.com | FastDomain Inc. | 23 Sep 2019 | 23 Sep 2019 | 23 Sep 2020 |
| 637 | kellerengraving.com | Name.com, Inc. | 4 Sep 2014 | 26 Aug 2024 | 4 Sep 2025 |
| 638 | kellerhomevalue.info | GoDaddy.com, LLC | 5 Jun 2017 | 4 Aug 2017 | 5 Jun 2018 |
| 639 | kellerwilliamsagentnaples.com | GoDaddy.com, LLC | 3 Sep 2014 | 4 Sep 2016 | 3 Sep 2017 |
| 640 | kellerwilliamsluxuryagent.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2019 |
| 641 | kellerwilliamsluxuryinternational.com | Rebel.com Corp. | 30 Jan 2021 | 15 Dec 2023 | 30 Jan 2025 |
| 642 | kellerwilliamsluxuryrealtor.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2017 |
| 643 | kellerwilliamsmarcorealtor.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2017 |
| 644 | kellerwilliamsnaplesfl.com | GoDaddy.com, LLC | 3 Sep 2014 | 11 Feb 2016 | 3 Sep 2019 |
| 645 | kellerwilliamsrealtornaples.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2017 |
| 646 | kellerwilliamsrealtynaples.com | GoDaddy.com, LLC | 3 Sep 2014 | 11 Feb 2016 | 3 Sep 2019 |
| 647 | kellermeister.biz | Uniregistrar Corp | 17 Sep 2014 | 17 Sep 2014 | 16 Sep 2015 |
| 648 | kellerinvestment.com | TurnCommerce, Inc. DBA NameBright.com | 29 Oct 2020 | 11 Dec 2024 | 29 Oct 2024 |
| 649 | kellerwilliamshighlandsranch.com | GoDaddy.com, LLC | 22 Sep 2020 | 3 Oct 2024 | 22 Sep 2025 |
| 650 | kellerti.com | Google, Inc. | 11 Jan 2020 | 11 Jan 2020 | 11 Jan 2021 |
| 651 | kellerautoaccidentattorney.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2016 | 5 Sep 2018 |
| 652 | kellercentralband.mobi | GoDaddy.com, LLC | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 653 | kellerwilliamsdentonvideo.com | Instra Corporation Pty Ltd. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 654 | kellerpropertysearch.com | GoDaddy.com, LLC | 17 Nov 2014 | 17 Nov 2016 | 17 Nov 2017 |
| 655 | kellerbollmanlaw.com | Domain.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2016 |
| 656 | kellerbollman.com | Domain.com, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2016 |
| 657 | kelleramos.com | FastDomain Inc. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 658 | keller-ing.com | Cronon AG | 16 Nov 2014 | 5 Mar 2024 | 16 Nov 2025 |
| 659 | kellerwilliams-jacksonville.com | GoDaddy.com, LLC | 19 Sep 2014 | 19 Sep 2016 | 19 Sep 2018 |
| 660 | kellersigns.com | GoDaddy.com, LLC | 20 Feb 2019 | 20 Feb 2019 | 20 Feb 2020 |
| 661 | keller-cloud-income.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2015 |
| 662 | kellerwilliamsrealtynyc.com | GoDaddy.com, LLC | 17 Nov 2014 | 18 Nov 2024 | 17 Nov 2025 |
| 663 | kellerssigns.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2016 |
| 664 | kellersblog.com | Launchpad, Inc. | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 665 | kellerwilliamsdenver.com | GoDaddy.com, LLC | 10 Jan 2020 | 10 Jan 2024 | 10 Jan 2025 |
| 666 | kellerpianos.com | GoDaddy.com, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 667 | kellertreenlandscaping.com | Tucows Domains Inc. | 4 Sep 2013 | 7 Sep 2014 | 4 Sep 2015 |
| 668 | kellerwilliamsdanville.com | GoDaddy.com, LLC | 22 Sep 2020 | 3 Nov 2023 | 22 Sep 2023 |
| 669 | kellerwilliamssignatureculture.com | GoDaddy.com, LLC | 7 Sep 2014 | 7 Sep 2014 | 7 Sep 2015 |
| 670 | kellertreenlandscaping.net | Tucows Domains Inc. | 4 Sep 2013 | 7 Sep 2014 | 4 Sep 2015 |
| 671 | kellersinafrica.com | eNom, Inc. | 7 Jan 2017 | 24 Dec 2017 | 7 Jan 2019 |
| 672 | kelleranalytics.com | NameCheap, Inc. | 9 Jan 2018 | 10 Dec 2024 | 9 Jan 2026 |
| 673 | kellerwilliamstravissenenfelder.com | GoDaddy.com, LLC | 8 Sep 2014 | 9 Sep 2016 | 8 Sep 2018 |
| 674 | kellerwilliamsrivnor.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 675 | kellerwilliamsrivenord.com | GoDaddy.com, LLC | 18 Nov 2014 | 30 Nov 2024 | 18 Nov 2025 |
| 676 | kellerecology.com | GoDaddy.com, LLC | 18 Nov 2014 | 19 Nov 2023 | 18 Nov 2025 |
| 677 | kellerbomb.com | Tucows Domains Inc. | 18 Nov 2014 | 23 Nov 2020 | 18 Nov 2020 |
| 678 | kellerallcreaturesanimalclinic.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2024 | 19 Nov 2029 |
| 679 | kellerhexen-neckartailfingen.com | 1&1 Internet AG | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 680 | kellerwilliamsdistinction.com | GoDaddy.com, LLC | 9 Sep 2014 | 10 Sep 2024 | 9 Sep 2029 |
| 681 | kellerwilliamshollywoodhills.com | GoDaddy.com, LLC | 21 Aug 2019 | 21 Aug 2019 | 21 Aug 2020 |
| 682 | kellerwilliamsportaransasrealestate.com | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2024 | 10 Sep 2026 |
| 683 | kellerwilliamsrockportrealestate.com | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2024 | 10 Sep 2026 |
| 684 | kellerandgeorgeweb.com | eNom, Inc. | 2 Oct 2014 | 3 Sep 2024 | 2 Oct 2025 |
| 685 | kellerstrings.info | GoDaddy.com, LLC | 10 Sep 2014 | 25 Oct 2024 | 10 Sep 2025 |
| 686 | kellerstrings.net | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2024 | 10 Sep 2025 |
| 687 | kellerwilliamsgoleta.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 688 | kellerwilliamslosolivas.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 689 | kellersautorepair.com | Wild West Domains, LLC | 15 Jun 2016 | 22 Sep 2022 | 15 Jun 2026 |
| 690 | kellerwilliamsbuellton.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 691 | kellerwilliamshoperanch.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 692 | kellerwilliamssantaynez.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 693 | kellerwilliamssolvang.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 694 | kellerwilliamssummerland.com | GoDaddy.com, LLC | 3 Oct 2014 | 4 Oct 2024 | 3 Oct 2026 |
| 695 | kellerwilliamsmobileapp.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2016 | 10 Sep 2017 |
| 696 | kellerrealtygroup.com | GoDaddy.com, LLC | 22 Dec 2020 | 22 Dec 2020 | 22 Dec 2021 |
| 697 | kellerwho.com | GoDaddy.com, LLC | 24 Feb 2017 | 5 Mar 2023 | 28 Feb 2025 |
| 698 | kellerwilliamsbuda.com | GoDaddy.com, LLC | 1 Oct 2014 | 2 Oct 2024 | 1 Oct 2025 |
| 699 | kellerwilliamscashiers.com | GoDaddy.com, LLC | 14 Jun 2017 | 3 Oct 2022 | 14 Jun 2027 |
| 700 | kellerwiilliiams.com | Tucows Domains Inc. | 19 Nov 2014 | 23 Nov 2015 | 19 Nov 2016 |
| 701 | kellerchiropracticcare.com | eNom, Inc. | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 702 | kellermortuary.com | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2024 | 5 Oct 2029 |
| 703 | kellercooperative.com | Marcaria.com International, Inc. | 4 Oct 2014 | 4 Oct 2014 | 4 Oct 2015 |
| 704 | kellerfloors.net | Tucows Domains Inc. | 15 Nov 2013 | 19 Nov 2014 | 15 Nov 2015 |
| 705 | kellerwilliamsrtcommercial.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2015 |
| 706 | keller314.com | GoDaddy.com, LLC | 22 Sep 2014 | 23 Sep 2014 | 22 Sep 2015 |
| 707 | kellereibz.com | Register.it SPA | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 708 | kellerhayes.com | Hefei Juming Network Technology Co., Ltd | 23 Jan 2023 | 26 Mar 2024 | 23 Jan 2024 |
| 709 | kellermanwildlifephotos.info | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 710 | kellermanwildlifephotos.net | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 711 | kellermanwildlifephotos.org | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 712 | kellerwilliamspremiergroup.com | GoDaddy.com, LLC | 5 Oct 2014 | 6 Oct 2015 | 5 Oct 2017 |
| 713 | kellermanwildlifephotos.com | DropCatch.com 1223 LLC | 10 Mar 2018 | 10 Mar 2018 | 10 Mar 2019 |
| 714 | kellerwilliamspremierassociates.com | GoDaddy.com, LLC | 5 Oct 2014 | 6 Oct 2015 | 5 Oct 2017 |
| 715 | kellerwilliamspremierrealtors.com | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 716 | kellercollaborative.com | eNom, Inc. | 23 Sep 2014 | 28 Aug 2015 | 23 Sep 2017 |
| 717 | kellerqh.com | Network Solutions, LLC | 23 Sep 2014 | 4 Oct 2017 | 23 Sep 2020 |
| 718 | kellerusedengine.com | GoDaddy.com, LLC | 23 Sep 2014 | 20 Sep 2024 | 23 Sep 2025 |
| 719 | keller-apps.com | Porkbun, LLC | 5 Apr 2023 | 16 Jun 2024 | 5 Apr 2024 |
| 720 | kellertexasusedengine.com | GoDaddy.com, LLC | 23 Sep 2014 | 3 Sep 2024 | 23 Sep 2025 |
| 721 | keller-charles.com | Fabulous.com Pty Ltd. | 25 Mar 2005 | 4 Feb 2018 | 25 Sep 2018 |
| 722 | kellermanharris.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 6 Oct 2014 | 4 Oct 2017 | 6 Oct 2018 |
| 723 | kellerobgyn.net | Tucows Domains Inc. | 6 Oct 2014 | 10 Oct 2022 | 6 Oct 2023 |
| 724 | kellerwilliamsatthejerseyshore.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 725 | kellerwilliamsattheshore.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 726 | kellerwilliamsavalon.com | 1&1 Internet AG | 19 Apr 2018 | 19 Apr 2018 | 19 Apr 2019 |
| 727 | kellerwilliamsbullheadcity.com | GoDaddy.com, LLC | 6 Oct 2014 | 7 Oct 2016 | 6 Oct 2018 |
| 728 | kellerwilliamsoceancitynj.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 729 | kellerwilliamsseaislecity.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 730 | kellerwilliamsseaislse.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 731 | kellerwilliamssic.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2016 |
| 732 | kellerwilliamsstoneharbor.com | 1&1 Internet AG | 19 Apr 2018 | 19 Apr 2018 | 19 Apr 2019 |
| 733 | kellerlueftung24.com | Cronon AG | 23 Sep 2014 | 23 Sep 2014 | 23 Sep 2018 |
| 734 | kellerwilliamsfortmyers.com | NameCheap, Inc. | 29 Oct 2022 | 13 Oct 2024 | 29 Oct 2025 |
| 735 | kellerwilliamsbonitaspringsflorida.com | GoDaddy.com, LLC | 25 Sep 2014 | 1 Oct 2016 | 25 Sep 2017 |
| 736 | kellerwilliamsnaplesflorida.com | NameCheap, Inc. | 29 Oct 2022 | 13 Oct 2024 | 29 Oct 2025 |
| 737 | kellerwilliamscarolinahomes.com | GoDaddy.com, LLC | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 738 | kellerwilliamspalmdaleca.com | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2016 |
| 739 | kellerwilliamsantelopevalley.com | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 740 | kellershields.com | Network Solutions, LLC | 21 Nov 2014 | 19 Nov 2017 | 21 Nov 2018 |
| 741 | kellerrestaurant.com | Register.it SPA | 21 Nov 2014 | 5 Nov 2017 | 21 Nov 2018 |
| 742 | kellerandson.com | GoDaddy.com, LLC | 17 Dec 2024 | 17 Dec 2024 | 17 Dec 2025 |
| 743 | kellerdentalpractice.com | GoDaddy.com, LLC | 8 Oct 2014 | 9 Oct 2016 | 8 Oct 2017 |
| 744 | kellerkultur.com | TurnCommerce, Inc. DBA NameBright.com | 24 Dec 2015 | 18 Dec 2020 | 24 Dec 2024 |
| 745 | kelleryouthbasketball.net | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 746 | kellerwilliamspremierteam.com | GoDaddy.com, LLC | 29 Sep 2014 | 6 Oct 2015 | 29 Sep 2017 |
| 747 | kellerwilliamssmithville.com | GoDaddy.com, LLC | 28 Sep 2014 | 29 Sep 2016 | 28 Sep 2018 |
| 748 | kellerwilliamsgladstone.com | GoDaddy.com, LLC | 28 Sep 2014 | 29 Sep 2016 | 28 Sep 2018 |
| 749 | kellerwilliamsliberty.com | GoDaddy.com, LLC | 28 Sep 2014 | 29 Sep 2016 | 28 Sep 2018 |
| 750 | kellerwilliamsparkville.com | GoDaddy.com, LLC | 28 Sep 2014 | 29 Sep 2016 | 28 Sep 2018 |
| 751 | kellerwilliamssfbayarea.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 752 | kellerwilliamsnorcal.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2015 |
| 753 | kellerspiele.com | GoDaddy.com, LLC | 22 Nov 2014 | 23 Nov 2024 | 22 Nov 2025 |
| 754 | keller-spiele.com | GoDaddy.com, LLC | 22 Nov 2014 | 22 Nov 2014 | 22 Nov 2016 |
| 755 | kellerwillamsbocaraton.com | GoDaddy.com, LLC | 30 Sep 2014 | 30 Sep 2014 | 30 Sep 2015 |
| 756 | kellerwilliamssb.com | GoDaddy.com, LLC | 30 Sep 2014 | 1 Oct 2024 | 30 Sep 2025 |
| 757 | kellerwilliamscarpinteria.com | GoDaddy.com, LLC | 30 Sep 2014 | 1 Oct 2024 | 30 Sep 2025 |
| 758 | kellerbusinessnetwork.com | GoDaddy.com, LLC | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 759 | kellerfunerals.com | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 760 | kellermortgageloans.com | GoDaddy.com, LLC | 16 Oct 2014 | 11 Oct 2016 | 16 Oct 2018 |
| 761 | kellertxhomeloans.com | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2016 |
| 762 | kellerwilliamsbelair.com | GoDaddy.com, LLC | 2 May 2016 | 2 May 2016 | 2 May 2018 |
| 763 | kellerwilliamsdanapoint.com | GoDaddy.com, LLC | 1 Jul 2021 | 12 Aug 2024 | 1 Jul 2024 |
| 764 | kellerwilliamshollywood.com | Key-Systems GmbH | 9 Mar 2023 | 22 May 2024 | 9 Mar 2024 |
| 765 | kellerwilliamsnewyork.com | GoDaddy.com, LLC | 2 Apr 2023 | 4 Apr 2024 | 2 Apr 2025 |
| 766 | kellerwilliamsnewyorkcity.com | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 767 | kellerwilliamsnyhomes4sale.com | Wild West Domains, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 768 | kellerwilliamssaltlakecity.com | GoDaddy.com, LLC | 22 May 2020 | 23 May 2024 | 22 May 2025 |
| 769 | kellerwilliamswashingtondc.com | GoDaddy.com, LLC | 16 Oct 2014 | 16 Oct 2014 | 16 Oct 2015 |
| 770 | kellerwilliamswesthollywood.com | GoDaddy.com, LLC | 16 Oct 2014 | 17 Oct 2024 | 16 Oct 2025 |
| 771 | kellerwilliamslakeoftheozarksrealty.com | GoDaddy.com, LLC | 12 Oct 2014 | 12 Oct 2024 | 12 Oct 2025 |
| 772 | kellerwilliamsgreenvalley.com | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 773 | kellertank.com | united-domains AG | 25 Sep 2014 | 4 Dec 2024 | 25 Sep 2025 |
| 774 | kellerconstructionmn.com | GoDaddy.com, LLC | 6 Oct 2022 | 6 Oct 2022 | 6 Oct 2032 |
| 775 | kellerconcreteandpools.com | register.com, Inc. | 27 Sep 2014 | 11 Jan 2018 | 27 Sep 2018 |
| 776 | keller-williams-realty-new-tampa.com | 1&1 Internet AG | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 777 | kellerwilliamsagentindenver.com | 1&1 Internet AG | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 778 | kellertxrestaurants.com | GoDaddy.com, LLC | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2016 |
| 779 | keller-immo.com | Cronon AG | 13 Oct 2014 | 14 Oct 2024 | 13 Oct 2025 |
| 780 | kellerkoyu.net | Dynadot, LLC | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2016 |
| 781 | kellerlee.com | Squarespace Domains LLC | 21 Aug 2021 | 7 Aug 2024 | 21 Aug 2025 |
| 782 | kellermarketplace.com | GoDaddy.com, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 783 | kellerwilliamspasadena.com | GoDaddy.com, LLC | 5 Oct 2020 | 10 Oct 2022 | 5 Oct 2022 |
| 784 | kellerwilliamssocalpm.com | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 785 | kellervideos.com | DropCatch.com 1458 LLC | 25 Mar 2018 | 25 Mar 2018 | 25 Mar 2019 |
| 786 | kellercenter.com | TurnCommerce, Inc. DBA NameBright.com | 3 Jan 2017 | 28 Dec 2020 | 3 Jan 2025 |
| 787 | kellerexpresscarwash.com | 1&1 Internet AG | 15 Oct 2014 | 13 Mar 2018 | 15 Oct 2019 |
| 788 | kellerspawn.com | TLDs LLC dba SRSplus | 14 Oct 2014 | 13 Feb 2017 | 14 Oct 2017 |
| 789 | kellerwilliamsspringfieldnj.com | GoDaddy.com, LLC | 14 Oct 2014 | 15 Oct 2024 | 14 Oct 2025 |
| 790 | kellercfoster.com | GoDaddy.com, LLC | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2016 |
| 791 | kellerwilliamshunterdoncounty.com | Domain.com, LLC | 18 Oct 2014 | 3 Oct 2024 | 18 Oct 2025 |
| 792 | kellerrand.com | EPAG Domainservices GmbH | 18 Oct 2014 | 18 Oct 2014 | 18 Oct 2015 |
| 793 | kellergirlslacrosse.com | GoDaddy.com, LLC | 15 Oct 2014 | 16 Oct 2024 | 15 Oct 2025 |
| 794 | kellerhomeforsale.com | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 795 | kellerkoyu.com | FBS Inc. | 15 Oct 2014 | 25 May 2017 | 15 Oct 2017 |
| 796 | kellerskats.com | GoDaddy.com, LLC | 15 Oct 2014 | 16 Oct 2016 | 15 Oct 2017 |
| 797 | kellerskats.org | Domain.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 798 | kellerwilliamsmaryville.com | GoDaddy.com, LLC | 15 Oct 2014 | 16 Oct 2023 | 15 Oct 2025 |
| 799 | kellerwilliamsmaryvilletn.com | GoDaddy.com, LLC | 15 Oct 2014 | 17 Sep 2022 | 15 Oct 2025 |
| 800 | kellerk.com | GoDaddy.com, LLC | 26 Dec 2023 | 26 Dec 2023 | 26 Dec 2026 |
| 801 | kellerfamilyhealthcare.com | Brandsight, Inc. | 16 Oct 2009 | 31 Aug 2023 | 16 Oct 2025 |
| 802 | kellertechnical.com | Tucows Domains Inc. | 23 Nov 2008 | 27 Nov 2014 | 23 Nov 2015 |
| 803 | kellerpenthouse21salon.com | GoDaddy.com, LLC | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 804 | kellerlane.com | GoDaddy.com, LLC | 17 Jul 2022 | 18 Jul 2024 | 17 Jul 2025 |
| 805 | kellerwilliamsmaine.com | GoDaddy.com, LLC | 28 Nov 2014 | 28 Nov 2024 | 28 Nov 2029 |
| 806 | kellerskove.com | Name.com, Inc. | 19 Oct 1998 | 28 Nov 2024 | 18 Oct 2026 |
| 807 | kellersealcoat.com | GoDaddy.com, LLC | 16 Dec 2016 | 16 Dec 2016 | 16 Dec 2017 |
| 808 | kellerwilliamssells.com | Google, Inc. | 17 Mar 2018 | 23 Apr 2024 | 17 Mar 2025 |
| 809 | kellerrealtyinc.com | GoDaddy.com, LLC | 18 Jul 2015 | 19 Jul 2024 | 18 Jul 2025 |
| 810 | kellerwilliamssouthbayhomes.com | GoDaddy.com, LLC | 30 Nov 2014 | 30 Nov 2014 | 30 Nov 2015 |
| 811 | kellermasonrys.com | Tucows Domains Inc. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2016 |
| 812 | kellermasonrys.info | Tucows Domains Inc. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2016 |
| 813 | kellerwilliamslakelure.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2016 |
| 814 | kellertroyraplcneworleansla.com | Tucows Domains Inc. | 28 Nov 2011 | 2 Dec 2015 | 28 Nov 2016 |
| 815 | kellertreesvc.com | GoDaddy.com, LLC | 1 Dec 2014 | 2 Dec 2024 | 1 Dec 2029 |
| 816 | kellermasonrys.biz | Tucows Domains Inc. | 1 Dec 2014 | 1 Dec 2014 | 30 Nov 2016 |
| 817 | kellerhouse.com | Domain.com, LLC | 17 Mar 2000 | 17 Jan 2021 | 17 Mar 2026 |
| 818 | kellerhals-dynamics.com | Corehub, S.R.L. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 819 | kelleraudio.com | GoDaddy.com, LLC | 26 Mar 2021 | 27 Mar 2024 | 26 Mar 2025 |
| 820 | kellertxhomerealestate.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 821 | kellersmobilevet.com | GoDaddy.com, LLC | 3 Dec 2014 | 3 Dec 2024 | 3 Dec 2025 |
| 822 | kellermasonrys.us | Tucows Domains Inc. | 1 Dec 2014 | 1 Dec 2014 | 30 Nov 2016 |
| 823 | kellermasonrys.name | - | - | - | - |
| 824 | kellersoccer.com | TurnCommerce, Inc. DBA NameBright.com | 3 Dec 2014 | 27 Nov 2020 | 3 Dec 2024 |
| 825 | kellersfinelinewelding.com | Tucows Domains Inc. | 13 Dec 2007 | 6 Dec 2024 | 13 Dec 2025 |
| 826 | kellerwilliamscareer.info | GoDaddy.com, LLC | 7 Sep 2022 | 22 Oct 2024 | 7 Sep 2025 |
| 827 | kellerhelicopters.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 828 | kellerwilliamscareer.org | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2016 |
| 829 | kellerwilliamscareer.net | - | - | - | - |
| 830 | kellerwilliamstopteamsinpa.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 831 | kellerwilliamstopteambethlehempa.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 832 | kellerwilliamstopagentinthelehighvalleypa.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 833 | kellerwilliamsjohnbernard.com | GoDaddy.com, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2019 |
| 834 | kellertxhomesforsale.com | Automattic Inc. | 1 Nov 2019 | 1 Nov 2019 | 1 Nov 2020 |
| 835 | kellersjewelry.com | BlastDomains LLC | 6 Dec 2014 | 7 Dec 2017 | 6 Dec 2018 |
| 836 | kellerhelicopter.com | GoDaddy.com, LLC | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 837 | kellerwilliamsbiltmorevillage.com | Omnis Network, LLC | 8 Dec 2014 | 8 Dec 2024 | 8 Dec 2025 |
| 838 | kellerwilliamsashevillenc.com | Omnis Network, LLC | 8 Dec 2014 | 8 Dec 2024 | 8 Dec 2025 |
| 839 | kellerthai.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 840 | kellermannbanking.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 841 | kellerblindsandshutters.com | Domain.com, LLC | 10 Jan 2014 | 26 Dec 2016 | 10 Jan 2018 |
| 842 | kellersplexus.com | Tucows Domains Inc. | 10 Dec 2014 | 14 Dec 2017 | 10 Dec 2017 |
| 843 | kellermachineandwelding.com | GoDaddy.com, LLC | 9 Dec 2014 | 12 Mar 2024 | 9 Dec 2027 |
| 844 | kellercustoms.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2024 | 10 Dec 2026 |
| 845 | keller-hospital.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 8 Dec 2014 | - | 8 Dec 2015 |
| 846 | kellerwilliamsofmoorestown.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2026 |
| 847 | kellerwilliamsmoorestown.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2025 |
| 848 | kellerswellny.com | Tucows Domains Inc. | 16 Jun 2014 | 16 Jun 2014 | 16 Jun 2017 |
| 849 | kellerhighclayteam.com | - | 17 Aug 2016 | 17 Aug 2016 | 17 Aug 2017 |
| 850 | kellerclayteam.com | Network Solutions, LLC | 15 Aug 2021 | 16 Jun 2024 | 15 Aug 2027 |
| 851 | kellerwilliamsmoorestown.info | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2025 |
| 852 | kellerhvacservices.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 853 | kelleraktuell.com | PSI-USA, Inc. dba Domain Robot | 11 Dec 2014 | 12 Dec 2024 | 9 Dec 2025 |
| 854 | kellerwilliamsofmoorestown.net | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2025 |
| 855 | kellerwilliamsmoorestown.net | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2025 |
| 856 | kellerwilliamssignature.com | GoDaddy.com, LLC | 12 Dec 2014 | 13 Dec 2024 | 12 Dec 2025 |
| 857 | kellerwilliamsoakville.com | GoDaddy.com, LLC | 12 Dec 2014 | 13 Dec 2018 | 12 Dec 2020 |
| 858 | kellerlicht.com | NameCheap, Inc. | 13 Mar 2024 | 13 Mar 2024 | 13 Mar 2025 |
| 859 | kellerclinics.com | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 860 | kellercargroup.com | eNom, Inc. | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 861 | kellerwelle.com | Online SAS | 13 Dec 2014 | 13 Dec 2014 | 13 Dec 2015 |
| 862 | kellerpoolrepair.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2016 |
| 863 | kellergaragedoor.org | 1&1 Internet AG | 13 Dec 2014 | 13 Dec 2024 | 13 Dec 2025 |
| 864 | kellermanbackupsystems.com | eNom, Inc. | 28 Nov 2014 | 14 Dec 2014 | 28 Nov 2015 |
| 865 | kellerosteoheal.com | eNom, Inc. | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 866 | kellerjan.com | Tucows Domains Inc. | 16 Dec 2014 | 20 Dec 2015 | 16 Dec 2016 |
| 867 | kellerfordsales.com | 1&1 Internet AG | 15 Dec 2014 | 16 Dec 2016 | 15 Dec 2019 |
| 868 | kellerfordauto.com | Tucows Domains Inc. | 2 Feb 2024 | 19 Feb 2024 | 2 Feb 2025 |
| 869 | kellerwilliamsyardley.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Dec 2022 | 17 Dec 2024 |
| 870 | kellerwilliamsnewtown.com | GoDaddy.com, LLC | 17 Dec 2014 | 17 Sep 2022 | 17 Dec 2024 |
| 871 | kellereye.com | TurnCommerce, Inc. DBA NameBright.com | 1 Mar 2015 | 23 Feb 2021 | 1 Mar 2025 |
| 872 | kellerdevine.com | Tucows Domains Inc. | 13 Dec 2011 | 17 Dec 2014 | 13 Dec 2015 |
| 873 | keller-troiano.com | Online SAS | 12 Jan 2024 | 19 Jan 2024 | 12 Jan 2025 |
| 874 | keller-heart.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Dec 2014 | 12 Nov 2015 | 16 Dec 2024 |
| 875 | kellerkids.net | Google, Inc. | 16 Dec 2014 | 14 Jun 2024 | 16 Dec 2033 |
| 876 | kellerwilliamsrealtytacoma.com | Launchpad, Inc. | 17 Dec 2014 | 17 Dec 2016 | 17 Dec 2017 |
| 877 | kellerwilliamsbiltmorelakenc.com | Omnis Network, LLC | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 878 | kellermanauditory.com | eNom, Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 879 | kellerideas.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 880 | kellerwilliamslegacypartners.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2016 |
| 881 | kellerwilliamslegacymetropolitan.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2016 |
| 882 | kellerwilliamslegacymetro.com | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2016 |
| 883 | kellerschwartzpartners.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 884 | kellerschwartzfinancial.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 885 | kellerartclasses.com | Tucows Domains Inc. | 16 Dec 2012 | 20 Dec 2014 | 16 Dec 2015 |
| 886 | kellerwilliamslegacymetropolitan.org | GoDaddy.com, LLC | 19 Dec 2014 | 28 Dec 2016 | 19 Dec 2017 |
| 887 | kellerwilliamslegacymetropolitan.net | GoDaddy.com, LLC | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 888 | kellerweightlossdna.com | GoDaddy.com, LLC | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2015 |
| 889 | kellermurch.com | GoDaddy.com, LLC | 7 Jun 2019 | 7 Jun 2019 | 7 Jun 2020 |
| 890 | kellermanncottage.com | FastDomain Inc. | 21 Dec 2014 | 21 Dec 2016 | 21 Dec 2017 |
| 891 | kellerwilliamslagunaniguel.com | GoDaddy.com, LLC | 1 Jul 2021 | 12 Aug 2024 | 1 Jul 2024 |
| 892 | kellerwilliamslagunabeach.com | GoDaddy.com, LLC | 22 Dec 2014 | 10 Feb 2017 | 9 Feb 2019 |
| 893 | kellermmaclasses.com | GoDaddy.com, LLC | 22 Dec 2014 | 17 Sep 2022 | 22 Dec 2024 |
| 894 | keller-lufttechnik.com | Hetzner Online AG | 23 Dec 2014 | 22 Dec 2023 | 23 Dec 2024 |
| 895 | kellerwilliamseastnashville.com | GoDaddy.com, LLC | 24 Dec 2014 | 24 Dec 2014 | 24 Dec 2015 |
| 896 | keller-lufttechnik.net | Hetzner Online AG | 23 Dec 2014 | 24 Dec 2023 | 23 Dec 2024 |
| 897 | kellerwilliamssantanvalley.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 898 | kellerwilliamsqueencreek.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 899 | kellerwilliamsgreaterphoenix.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 900 | kellerslawnkare.com | Tucows Domains Inc. | 23 Dec 2012 | 27 Dec 2014 | 23 Dec 2015 |
| 901 | kellerscript.com | Name.com, Inc. | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 902 | kellermoore.com | CloudFlare, Inc. | 27 Jul 2022 | 27 Jun 2024 | 27 Jul 2025 |
| 903 | kellerbahais.com | DropCatch.com 891 LLC | 15 Mar 2016 | 16 Mar 2017 | 15 Mar 2018 |
| 904 | kellerbahais.info | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 905 | kellerbahais.net | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 906 | kellerstones.com | Tucows Domains Inc. | 28 Dec 2014 | 1 Jan 2018 | 28 Dec 2017 |
| 907 | kellerbahais.org | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2015 |
| 908 | kellerscove.com | Dynadot3 LLC | 19 Mar 2022 | 29 Apr 2023 | 19 Mar 2023 |
| 909 | kellerwilliamsmaricopa.com | GoDaddy.com, LLC | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 910 | kellerislamiccenter.org | GoDaddy.com, LLC | 29 Dec 2014 | 7 Jul 2024 | 29 Dec 2031 |
| 911 | kellertransport.com | GoDaddy.com, LLC | 9 Nov 2022 | 9 Nov 2022 | 9 Nov 2027 |
| 912 | kellerrm.com | NameCheap, Inc. | 31 Dec 2014 | 1 Dec 2023 | 31 Dec 2024 |
| 913 | kellerresidentialmanagement.com | NameCheap, Inc. | 31 Dec 2014 | 1 Dec 2024 | 31 Dec 2025 |
| 914 | kellerapp.com | GoDaddy.com, LLC | 17 Feb 2019 | 18 Feb 2024 | 17 Feb 2025 |
| 915 | kellerwilliamsessential.com | GoDaddy.com, LLC | 1 Jan 2015 | 1 Jan 2015 | 1 Jan 2016 |
| 916 | kellerwilliamsbuyeragent.com | GoDaddy.com, LLC | 2 Jan 2015 | 2 Jan 2015 | 2 Jan 2016 |
| 917 | kellerwilliamsvalleyrealtypropertymanagement.com | Tucows Domains Inc. | 30 Dec 2010 | 3 Jan 2015 | 30 Dec 2015 |
| 918 | kellersunsettravel.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2017 |
| 919 | kellerhomeimprovement.com | GoDaddy.com, LLC | 11 Dec 2021 | 12 Dec 2024 | 11 Dec 2025 |
| 920 | kellerequinechiro.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 921 | kellerabdichtungen.com | 1API GmbH | 24 Aug 2021 | 24 Aug 2021 | 24 Aug 2025 |
| 922 | kellerhealthsystem.xyz | Network Solutions, LLC | 17 Jul 2014 | 18 Jul 2014 | 17 Jul 2015 |
| 923 | keller-web.xyz | Network Solutions, LLC | 22 Jul 2014 | 23 Jul 2014 | 22 Jul 2015 |
| 924 | kellerfordkia.xyz | Network Solutions, LLC | 25 Jul 2014 | 25 Jul 2014 | 25 Jul 2015 |
| 925 | kellerwilliamsleesburg.xyz | Network Solutions, LLC | 29 Jul 2014 | 29 Jul 2014 | 29 Jul 2015 |
| 926 | keller-kollegen.immobilien | Cronon AG | 8 Aug 2014 | 22 Sep 2024 | 8 Aug 2025 |
| 927 | kellersanierungen.hamburg | 1&1 Internet AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2018 |
| 928 | kellersanierung.hamburg | united-domains AG | 27 Aug 2014 | 25 Jul 2015 | 27 Aug 2018 |
| 929 | kellermeyer.hamburg | 1&1 Internet AG | 27 Aug 2014 | 3 Oct 2018 | 27 Aug 2025 |
| 930 | kellerimmobilien.hamburg | united-domains AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 931 | kellerdurchfeuchtungen.hamburg | 1&1 Internet AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2018 |
| 932 | kellerdurchfeuchtung.hamburg | 1&1 Internet AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2025 |
| 933 | kellerabdichtungen.hamburg | 1&1 Internet AG | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2025 |
| 934 | kellerabdichtung.hamburg | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 4 May 2023 | 5 May 2023 | 4 May 2025 |
| 935 | kellerwilliamsrealty.international | GoDaddy.com, LLC | 7 Sep 2014 | 22 Oct 2017 | 7 Sep 2018 |
| 936 | kellerkind.cologne | Cronon AG | 5 Sep 2014 | 20 Oct 2017 | 5 Sep 2018 |
| 937 | kellerwilliamsrealty.vegas | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 938 | keller-maag.email | Key-Systems, LLC | 9 Sep 2014 | 27 Dec 2017 | 9 Sep 2018 |
| 939 | kellerwilliams.vegas | GoDaddy.com, LLC | 12 Jan 2020 | 23 Feb 2024 | 12 Jan 2024 |
| 940 | kellerkinder.club | Cronon AG | 29 Sep 2014 | 13 Nov 2024 | 28 Sep 2025 |
| 941 | kellerwilliamsrealty.properties | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 942 | kellerverlag.bayern | RegistryGate GmbH | 1 Oct 2014 | 15 Nov 2024 | 1 Oct 2025 |
| 943 | kellersports.bayern | Key-Systems, LLC | 1 Oct 2014 | 15 Nov 2024 | 1 Oct 2025 |
| 944 | keller-verlag.bayern | RegistryGate GmbH | 1 Oct 2014 | 15 Nov 2024 | 1 Oct 2025 |
| 945 | keller-sports.bayern | Key-Systems, LLC | 1 Oct 2014 | 15 Nov 2024 | 1 Oct 2025 |
| 946 | kellerwilliams.red | GoDaddy.com, LLC | 12 Oct 2021 | 23 Dec 2023 | 12 Oct 2023 |
| 947 | kellersteff.bayern | PSI-USA, Inc. dba Domain Robot | 6 Oct 2014 | 20 Nov 2024 | 6 Oct 2025 |
| 948 | kellerwilliamspropertymanagement.management | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 949 | kellerschutz.bayern | Tucows Domains Inc. | 10 Oct 2014 | 20 Nov 2023 | 10 Oct 2023 |
| 950 | kellerabdichtung.bayern | Tucows Domains Inc. | 10 Oct 2014 | 20 Nov 2023 | 10 Oct 2023 |
| 951 | kellersports.bike | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 6 Feb 2014 | 16 May 2024 | 6 Feb 2025 |
| 952 | keller-sports.bike | Key-Systems, LLC | 6 Feb 2014 | 22 Mar 2024 | 6 Feb 2025 |
| 953 | kellerwilliamspropertymanagement.company | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 954 | kellerwilliamspropertymanagement.properties | GoDaddy.com, LLC | 14 Oct 2014 | 14 Oct 2014 | 14 Oct 2015 |
| 955 | kellerschachtabdeckung.bayern | PSI-USA, Inc. dba Domain Robot | 22 Oct 2014 | 6 Dec 2024 | 22 Oct 2025 |
| 956 | kellerwilliams.xyz | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 8 Mar 2024 | 15 Apr 2024 | 8 Mar 2025 |
| 957 | kellerhrg.com | GoDaddy.com, LLC | 5 Jun 2017 | 5 Jun 2018 | 5 Jun 2019 |
| 958 | kellerhousekeeping.com | eName Technology Co., Ltd. | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 959 | keller1993.com | eNom, Inc. | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 960 | kellerwilliams.nyc | GoDaddy.com, LLC | 28 Oct 2014 | 28 Oct 2024 | 27 Oct 2029 |
| 961 | kellerwilliamshomes.nyc | GoDaddy.com, LLC | 12 Nov 2014 | 17 Nov 2017 | 11 Nov 2018 |
| 962 | kellermann.koeln | Key-Systems, LLC | 4 Sep 2014 | 4 Sep 2024 | 4 Sep 2025 |
| 963 | kelleronline.help | Network Solutions, LLC | 25 Nov 2014 | 27 Jan 2018 | 25 Nov 2018 |
| 964 | kellermasonrys.club | Tucows Domains Inc. | 1 Dec 2014 | 1 Dec 2014 | 30 Nov 2016 |
| 965 | kellerhexen-neckartailfingen.website | 1&1 Internet AG | 1 Oct 2014 | 9 Dec 2024 | 1 Oct 2025 |
| 966 | kelleronline.software | Network Solutions, LLC | 10 Dec 2014 | 10 Jan 2017 | 10 Dec 2017 |
| 967 | kellerer.immo | 1&1 Internet AG | 10 Dec 2014 | 10 Dec 2024 | 10 Dec 2025 |
| 968 | kellerwilliamslegacymetropolitan.club | GoDaddy.com, LLC | 19 Dec 2014 | 28 Dec 2016 | 18 Dec 2017 |
| 969 | kellerweis.beer | GoDaddy.com, LLC | 18 Dec 2014 | 19 Jul 2024 | 18 Dec 2024 |
| 970 | kellereiberatung.bio | united-domains AG | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 971 | kellerer.email | 1&1 Internet AG | 16 Dec 2014 | 30 Jan 2020 | 16 Dec 2020 |
| 972 | kellerrock.bar | Mesh Digital Limited | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 973 | kelleronline.training | Network Solutions, LLC | 19 Mar 2014 | 20 Jan 2015 | 19 Mar 2015 |
| 974 | kellerwilliamsrealtylakeridge.com | Wild West Domains, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 975 | kellerserror.com | Domain.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 976 | kellerscoeve.com | Name.com, Inc. | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 977 | kellerharvelpta.com | GoDaddy.com, LLC | 12 Aug 2015 | 13 Aug 2024 | 12 Aug 2025 |
| 978 | kellerbrownproductions.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 979 | kellerconstruction.company | GoDaddy.com, LLC | 16 Jan 2015 | 6 Jan 2017 | 16 Jan 2020 |
| 980 | kellertrockenlegen.haus | Cronon AG | 2 Feb 2015 | 18 Mar 2024 | 2 Feb 2025 |
| 981 | kellerton.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 982 | kellerman.property | Uniregistrar Corp | 31 Jan 2015 | 4 Feb 2015 | 31 Jan 2016 |
| 983 | kellerkind.pictures | Key-Systems, LLC | 18 Feb 2015 | 3 Apr 2024 | 18 Feb 2025 |
| 984 | kellers.nrw | Cronon AG | 24 Mar 2015 | 8 May 2017 | 24 Mar 2018 |
| 985 | keller-trocknen.nrw | united-domains AG | 24 Mar 2015 | - | 24 Mar 2016 |
| 986 | kellershohn.nrw | united-domains AG | 29 Mar 2015 | - | 29 Mar 2016 |
| 987 | kellertrockenlegung.bayern | Mesh Digital Limited | 26 Mar 2015 | - | 26 Mar 2016 |
| 988 | kellerwilliamssouthernarizona.xyz | eNom, Inc. | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 989 | kellerwilliamsmadisonalabama.com | GoDaddy.com, LLC | 13 Aug 2015 | 14 Aug 2024 | 13 Aug 2025 |
| 990 | kellerwilliamsmadisonal.com | GoDaddy.com, LLC | 13 Aug 2015 | 14 Aug 2024 | 13 Aug 2025 |
| 991 | kellertraube.com | 1&1 Internet AG | 13 Aug 2015 | 13 Mar 2018 | 13 Aug 2025 |
| 992 | kellerclassiccars.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 993 | kelleractivehealth.com | Hongkong Domain Name Information Management Co., L… | 29 Oct 2022 | 8 Jan 2024 | 29 Oct 2023 |
| 994 | kelleruniversity.college | eNom, Inc. | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2016 |
| 995 | kellertwincities.college | eNom, Inc. | 30 Apr 2015 | 12 Jul 2017 | 30 Apr 2017 |
| 996 | kellertexas.college | eNom, Inc. | 30 Apr 2015 | 12 Jul 2017 | 30 Apr 2017 |
| 997 | kellertampa.college | eNom, Inc. | 30 Apr 2015 | 12 Jul 2017 | 30 Apr 2017 |
| 998 | kellerstlouis.college | eNom, Inc. | 30 Apr 2015 | 12 Jul 2017 | 30 Apr 2017 |
| 999 | kellersouthflorida.college | eNom, Inc. | 30 Apr 2015 | 12 Jul 2017 | 30 Apr 2017 |
| 1000 | kellersocal.college | eNom, Inc. | 30 Apr 2015 | 12 Jul 2017 | 30 Apr 2017 |
Displaying 1,000 out of 15,347 domains starting with the keyword "KELLER". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=keller
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |