Our database now contains whois records of 611 Million (611,528,182) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [611 Million Domains] $10,000 Details

Keyword: KISHHEALTH

Reverse Whois » KEYWORD [kishhealth ]  { 48 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1kishhealth.orgNetwork Solutions, LLC1 May 20007 Mar 20251 May 2026
2kishhealth.infoDynadot, LLC18 Apr 202329 May 202418 Apr 2024
3kishhealth.comNetwork Solutions, LLC8 Mar 19986 Jan 20257 Mar 2026
4kishhealth.netNetwork Solutions, LLC1 May 200016 Sep 20241 May 2026
5kishhealthcarebiotechnologies.comGoDaddy.com, LLC13 Sep 201413 Sep 201413 Sep 2015
6kishhealth-direct.netGoDaddy.com, LLC30 Aug 201530 Aug 202430 Aug 2025
7kishhealthbecause.comWild West Domains, LLC29 May 201529 May 201529 May 2016
8kishhealthbecause.orgWild West Domains, LLC29 May 201510 Jul 201729 May 2018
9kishhealthy.comRealtime Register B.V.4 Jul 20154 Jul 20174 Jul 2017
10kishhealthtourism.netREALTIME REGISTER BV28 May 201628 May 201628 May 2017
11kishhealthtourism.comREALTIME REGISTER BV28 May 201628 May 201628 May 2017
12kishhealthlaboratories.comWild West Domains, LLC6 Jul 20117 Jul 20166 Jul 2017
13kishhealthfoundation.comWild West Domains, LLC8 Jul 20109 Jul 20168 Jul 2017
14kishhealthsystem.comNetwork Solutions, LLC14 Dec 201215 Oct 202414 Dec 2025
15kishhealthhospice.comWild West Domains, LLC27 Jun 201328 Jun 201627 Jun 2017
16kishhealthdiabetes.comWild West Domains, LLC11 May 201212 May 201611 May 2017
17kishhealthphysiciangroup.comWild West Domains, LLC29 Sep 201130 Sep 201529 Sep 2016
18kishhealthems.comWest263 International Limited4 Jan 20224 Jan 20224 Jan 2023
19kishhealthfamilyandspecialtycare.comWild West Domains, LLC22 Jun 200623 Jun 201622 Jun 2017
20kishhealthyu.comWild West Domains, LLC22 Mar 201123 Mar 201622 Mar 2017
21kishhealthcounseling.comWild West Domains, LLC24 Sep 201025 Sep 201524 Sep 2016
22kishhealthyyou.comWild West Domains, LLC22 Mar 201123 Mar 201622 Mar 2017
23kishhealthprograms.comWild West Domains, LLC10 Jul 201211 Jul 201610 Jul 2017
24kishhealthcancercare.comLiteDomains LLC12 Jan 201912 Jan 201912 Jan 2020
25kishhealthnetwork.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…12 Sep 202320 Oct 202412 Sep 2024
26kishhealthphysicaltherapy.comWild West Domains, LLC27 Jun 201328 Jun 201627 Jun 2017
27kishhealthlab.comWild West Domains, LLC6 Jul 20117 Jul 20166 Jul 2017
28kishhealthsystem.infoWild West Domains, LLC21 Oct 200822 Oct 201721 Oct 2018
29kishhealthcancercare.netWild West Domains, LLC25 Oct 200726 Oct 201525 Oct 2016
30kishhealthprogramrequest.orgWild West Domains, LLC20 Feb 201421 Feb 201720 Feb 2018
31kishhealthphysiciangroup.orgNetwork Solutions, LLC29 Sep 201116 Sep 202429 Sep 2025
32kishhealthnetwork.orgWild West Domains, LLC2 Sep 20113 Sep 20172 Sep 2018
33kishhealthportal.orgNetwork Solutions, LLC25 May 201016 Sep 202425 May 2025
34kishhealthcancercare.orgWild West Domains, LLC25 Oct 200726 Oct 201725 Oct 2018
35kishhealthyyou.orgWild West Domains, LLC22 Mar 201123 Mar 201722 Mar 2018
36kishhealthprograms.orgWild West Domains, LLC10 Jul 201211 Jul 201710 Jul 2018
37kishhealthyu.orgWild West Domains, LLC22 Mar 201123 Mar 201722 Mar 2018
38kishhealthservicesprogramrequest.orgWild West Domains, LLC20 Feb 201421 Feb 201720 Feb 2018
39kishhealthlab.orgNetwork Solutions, LLC6 Jul 201116 Sep 20246 Jul 2025
40kishhealthdiabetes.orgWild West Domains, LLC11 May 201212 May 201711 May 2018
41kishhealthphysicaltherapy.orgWild West Domains, LLC27 Jun 201328 Jun 201727 Jun 2018
42kishhealthfoundation.orgWild West Domains, LLC8 Jul 20109 Jul 20178 Jul 2018
43kishhealthhospice.orgNetwork Solutions, LLC27 Jun 201316 Sep 202427 Jun 2025
44kishhealthlaboratories.orgWild West Domains, LLC6 Jul 20117 Jul 20176 Jul 2018
45kishhealthcounseling.orgWild West Domains, LLC24 Sep 20108 Oct 201724 Sep 2018
46kishhealthsystem.orgNetwork Solutions, LLC14 Dec 201220 Oct 202414 Dec 2025
47kishhealthcaregroup.comAtak Domain Hosting Internet d/b/a Atak Teknoloji27 May 202025 Aug 202027 May 2026
48kishhealthcare.comAtak Domain Hosting Internet d/b/a Atak Teknoloji26 May 202025 Aug 202026 May 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=kishhealth

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now