Our database now contains whois records of 588 Million (588,419,647) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1573 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [588 Million Domains] $10,000 Details

Keyword: LOCKSMITHSERVICE

Reverse Whois » KEYWORD [locksmithservice ]  { 751 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1locksmithservice.nycGoDaddy.com, LLC3 Oct 20143 Oct 20242 Oct 2025
2locksmithservice.london1&1 Internet AG14 Oct 202414 Oct 202414 Oct 2025
3locksmithservice.infoGoDaddy.com, LLC15 Nov 201728 Jul 202415 Nov 2024
4locksmithservice.miamiGoDaddy.com, LLC3 Aug 20231 Aug 20243 Aug 2027
5locksmithservice.orgGoDaddy.com, LLC29 Jun 201627 Aug 202429 Jun 2025
6locksmithservice.netGoDaddy.com, LLC29 Jun 201630 Jun 202429 Jun 2025
7locksmithservice.comGoDaddy.com, LLC14 Dec 19982 Dec 202413 Dec 2025
8locksmithservice.techNameCheap, Inc.26 Sep 20161 Nov 201726 Sep 2017
9locksmithservice.mobiGoDaddy.com, LLC25 Jul 201326 Jul 201725 Jul 2019
10locksmithservice.usGoDaddy.com, LLC25 Aug 20068 Sep 202424 Aug 2026
11locksmithservice.xyzDynadot, LLC21 Mar 20241 May 202421 Mar 2025
12locksmithservice.coDynadot, LLC20 Jul 202314 Aug 202420 Jul 2024
13locksmithservice.onlineGoDaddy.com, LLC28 May 202419 Sep 202428 May 2025
14locksmithservice.bizPSI-USA, Inc. dba Domain Robot12 Sep 202212 Sep 202412 Sep 2024
15locksmithservice.groupNameCheap, Inc.1 Nov 20171 Nov 20171 Nov 2018
16locksmithservice.directoryGoDaddy.com, LLC4 Dec 20174 Dec 20174 Dec 2018
17locksmithservice.menNameCheap, Inc.5 Dec 20175 Dec 20175 Dec 2018
18locksmithservice.co.uk-8 Nov 20041 Feb 20248 Nov 2026
19locksmithservice.me.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…20 Jun 201724 Aug 201720 Jun 2018
20locksmithservice.siteDOTSERVE INC.1 Nov 20221 Nov 20221 Nov 2023
21locksmithservice.proGoDaddy.com, LLC17 Nov 20186 Aug 202417 Nov 2024
22locksmithservice.partnersGoDaddy.com, LLC5 Sep 201910 Sep 20195 Sep 2020
23locksmithservice.todayGoDaddy.com, LLC17 Dec 201917 Dec 201917 Dec 2020
24locksmithservice.restNameKing.com Inc.15 Jun 202116 Jun 202115 Jun 2022
25locksmithservice.sbsNamesilo, LLC14 Nov 20213 Dec 202114 Nov 2023
26locksmithservice.clickNamesilo, LLC27 Nov 202230 Jan 202427 Nov 2023
27locksmithservice.caDomain.com, LLC10 Apr 201526 Mar 202410 Apr 2025
28locksmithservice.ie-20 Mar 201731 May 202420 Mar 2025
29locksmithservice.monsterNameCheap, Inc.15 Oct 202216 Oct 202315 Oct 2024
30locksmithservice.storeGoDaddy.com, LLC24 Oct 202325 Oct 202424 Oct 2025
31locksmithservice.us.comNameCheap, Inc.24 Feb 201515 Nov 202424 Feb 2025
32locksmithservice.lifeGoDaddy.com, LLC4 Feb 202411 Jul 20244 Feb 2025
33locksmithservice.shopGoDaddy.com, LLC5 Feb 202417 Aug 20245 Feb 2025
34locksmithservicenyc.netGoDaddy.com, LLC29 Nov 201112 Nov 201629 Nov 2017
35locksmithserviceredmond.com-16 Jan 202416 Nov 202411 Jan 2025
36locksmithservicemariettaga.comGoDaddy.com, LLC2 Jun 20143 Jun 20152 Jun 2016
37locksmithservicemiamifl.comGoDaddy.com, LLC23 Dec 201923 Dec 201923 Dec 2020
38locksmithservicessilverspringmd.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
39locksmithservicessanantonio.comGoDaddy.com, LLC28 Oct 202129 Oct 202428 Oct 2025
40locksmithservicesbethesdamd.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
41locksmithservicenorthwest.comNetwork Solutions, LLC30 Oct 201428 Oct 201630 Oct 2018
42locksmithservice911.comGoDaddy.com, LLC27 Oct 201028 Oct 202427 Oct 2025
43locksmithservicelongbeach.comGoDaddy.com, LLC30 Mar 201427 Apr 201530 Mar 2016
44locksmithserviceusa.comLaunchpad, Inc.5 Jan 202321 Dec 20235 Jan 2025
45locksmithservicesphoenix.comNameCheap, Inc.6 Nov 20146 Oct 20246 Nov 2025
46locksmithservicelaplace.comNameCheap, Inc.21 Aug 201421 Jul 202421 Aug 2025
47locksmithservicesatlanta.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2025
48locksmithservicerichardson.comeNom, Inc.8 Nov 201410 Oct 20178 Nov 2018
49locksmithservicecolumbus.comNameCheap, Inc.25 Aug 201425 Jul 202025 Aug 2021
50locksmithserviceorlando.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2016
51locksmithservicekilleentx.comeNom, Inc.14 Aug 201431 Jul 201714 Aug 2018
52locksmithservicegroup.comGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
53locksmithserviceny.mobi1&1 Internet AG6 Jul 202320 Aug 20246 Jul 2025
54locksmithservicecoloradosprings.comNameCheap, Inc.13 Nov 201415 Oct 201813 Nov 2019
55locksmithservicestaugustine.comTucows Domains Inc.25 Aug 201030 Aug 201425 Aug 2015
56locksmithservicedenver.comGoDaddy.com, LLC10 Jan 20172 Dec 202310 Jan 2025
57locksmithservicemansfield.comeNom, Inc.12 Sep 201412 Sep 201412 Sep 2015
58locksmithservicesseattle.com1&1 Internet AG30 Aug 201430 Aug 201430 Aug 2015
59locksmithservicelakeforest.comeNom, Inc.14 Nov 201414 Nov 201414 Nov 2015
60locksmithservicepros.netDNC Holdings, Inc.13 Oct 201624 Nov 201713 Oct 2017
61locksmithservicepocatello.comNameCheap, Inc.15 Sep 201425 Oct 202415 Sep 2025
62locksmithservicesqueens.comNameCheap, Inc.16 Feb 20244 Jul 202416 Feb 2025
63locksmithservicetroy.comGoDaddy.com, LLC18 Sep 201418 Sep 201418 Sep 2015
64locksmithservicebradenton.comeNom, Inc.10 Sep 20149 Aug 201510 Sep 2018
65locksmithserviceconcord.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2015
66locksmithservicesdetroit.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2015
67locksmithservicesdenver.comGoogle, Inc.16 Jan 201921 Apr 202416 Jan 2025
68locksmithserviceoklahomacity.comeNom, Inc.19 Nov 201419 Nov 201419 Nov 2015
69locksmithservicetuscaloosa.comNameCheap, Inc.1 Oct 20141 Sep 20241 Oct 2025
70locksmithservice24-7.netGoDaddy.com, LLC2 Oct 20142 Oct 20142 Oct 2016
71locksmithservicemcdonough.comNameCheap, Inc.22 Sep 201422 Aug 202422 Sep 2025
72locksmithservicenampa.comNameCheap, Inc.22 Sep 201422 Aug 202422 Sep 2025
73locksmithserviceswesthempstead.comGoDaddy.com, LLC21 Nov 201421 Nov 201421 Nov 2015
74locksmithservicehayward.comeNom, Inc.7 Oct 20147 Oct 20147 Oct 2015
75locksmithservicegeorgia.comTucows Domains Inc.22 Sep 201125 Sep 201422 Sep 2015
76locksmithservicetucson.comeNom, Inc.13 Oct 201413 Oct 201413 Oct 2015
77locksmithservicesfl.comGoDaddy.com, LLC18 Oct 201418 Oct 201418 Oct 2015
78locksmithservicesacramento.netName.com, Inc.24 Nov 201424 Nov 201424 Nov 2015
79locksmithservicesplus.com-19 Feb 202219 Feb 202219 Feb 2023
80locksmithservicedetroit.comeNom, Inc.28 Nov 201430 Oct 202328 Nov 2024
81locksmithserviceboston.comeNom, Inc.28 Nov 201430 Oct 202428 Nov 2025
82locksmithservicebaltimore.comeNom, Inc.28 Nov 201430 Oct 202428 Nov 2025
83locksmithservicemontreal.infoGoDaddy.com, LLC3 Dec 20143 Dec 20143 Dec 2015
84locksmithservicessantaana.comeNom, Inc.5 Dec 20145 Dec 20145 Dec 2015
85locksmithservicemelbourne.comNameCheap, Inc.5 Dec 201410 Jan 20185 Dec 2018
86locksmithservicephenixcity.comeNom, Inc.10 Dec 20149 Nov 201510 Dec 2016
87locksmithservicelongmont.comGoogle, Inc.27 Jun 202012 Jun 202427 Jun 2025
88locksmithservicepro.comGoogle, Inc.9 May 20209 May 20209 May 2021
89locksmithservicespring.comDotmedia Limited18 Mar 202328 May 202418 Mar 2024
90locksmithservicepearland.comeNom, Inc.29 Dec 201430 Nov 202329 Dec 2024
91locksmithservicefriendswood.comGoDaddy.com, LLC27 Apr 202228 Apr 202427 Apr 2025
92locksmithservicemanatee.comNetwork Solutions, LLC31 Dec 201423 Jan 201731 Dec 2017
93locksmithservicespringhill.comeNom, Inc.2 Jan 20152 Jan 20152 Jan 2016
94locksmithservice2.comGoDaddy.com, LLC2 Jan 20153 Jan 20232 Jan 2025
95locksmithservice1.comGoDaddy.com, LLC2 Jan 20153 Jan 20232 Jan 2025
96locksmithserviceshawaii.comGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
97locksmithservice2.orgGoDaddy.com, LLC2 Jan 20152 Jan 20152 Jan 2017
98locksmithservice2.netGoDaddy.com, LLC2 Jan 20153 Jan 20232 Jan 2025
99locksmithservice1.orgGoDaddy.com, LLC2 Jan 20152 Jan 20152 Jan 2017
100locksmithservice1.netGoDaddy.com, LLC2 Jan 20153 Jan 20232 Jan 2025
101locksmithservices.nycGo China Domains, LLC8 Oct 201413 Oct 20177 Oct 2018
102locksmithservices.melbourneCrazy Domains FZ-LLC23 May 201620 May 202423 May 2025
103locksmithservices.sydneyCrazy Domains FZ-LLC10 Mar 2015-10 Mar 2016
104locksmithservicepomona.comeNom, Inc.13 Aug 201513 Aug 201513 Aug 2016
105locksmithserviceontario.comeNom, Inc.13 Aug 201513 Aug 201513 Aug 2016
106locksmithservicefontana.comeNom, Inc.13 Aug 201513 Aug 201513 Aug 2016
107locksmithservices.london1&1 Internet AG25 Apr 20157 Jul 202425 Apr 2024
108locksmithservicespokane.comNetwork Solutions, LLC6 Jan 20156 Jan 20156 Jan 2016
109locksmithservicechicago.comDynadot, LLC31 Mar 20209 Apr 202431 Mar 2025
110locksmithservicegreenville.comeNom, Inc.19 Jan 201519 Jan 201519 Jan 2016
111locksmithservicewashingtondc.comName.com, Inc.4 Dec 20175 Nov 20234 Dec 2024
112locksmithservicesantaclarita.comeNom, Inc.20 Jan 201520 Jan 201520 Jan 2016
113locksmithservicerockvillemd.comeNom, Inc.22 Jan 201522 Jan 201522 Jan 2016
114locksmithserviceslancaster.mobiTucows Domains Inc.18 Jan 201222 Jan 201518 Jan 2016
115locksmithserviceslancashire.mobiTucows Domains Inc.18 Jan 201222 Jan 201518 Jan 2016
116locksmithserviceslasvegas.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
117locksmithservicesgreenville.comGoDaddy.com, LLC18 Aug 201530 Sep 202018 Aug 2021
118locksmithservicesshawnee.comGoDaddy.com, LLC30 Jan 201530 Jan 201530 Jan 2016
119locksmithservicedallas.comGoDaddy.com, LLC9 Nov 20219 Nov 20219 Nov 2022
120locksmithservicesdallastx.comeNom, Inc.12 Feb 201512 Feb 201512 Feb 2016
121locksmithservicespro.comGoDaddy.com, LLC21 Aug 201522 Aug 202321 Aug 2025
122locksmithserviceneworleansla.comGoDaddy.com, LLC17 Feb 201517 Feb 201517 Feb 2016
123locksmithserviceprovider.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
124locksmithservicecenter.com----
125locksmithservices1.comTucows Domains Inc.27 Feb 20083 Mar 201527 Feb 2016
126locksmithservicesintexas.comLaunchpad, Inc.4 Mar 20154 Mar 20154 Mar 2016
127locksmithserviceincolumbus.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Aug 201524 Aug 201524 Aug 2016
128locksmithservicesaintlouis.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
129locksmithservicesnearyou.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
130locksmithserviceplano.netBigRock Solutions Ltd.12 Mar 201512 Mar 201512 Mar 2016
131locksmithservicesqueens.netGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
132locksmithservicesmanhattan.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
133locksmithserviceslongisland.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
134locksmithservicesbrooklyn.comName.com, Inc.7 Feb 20177 Feb 20177 Feb 2018
135locksmithservicesbronx.comGoDaddy.com, LLC26 Aug 201527 Aug 201526 Aug 2016
136locksmithservicesnearme.comTLD Registrar Solutions Ltd.22 Mar 201528 Apr 202422 Mar 2025
137locksmithservicesalemor.comeNom, Inc.23 Mar 201523 Mar 201523 Mar 2016
138locksmithservicetoronto.comRealtime Register B.V.26 Aug 202431 Aug 202426 Aug 2025
139locksmithservicelosangeles.netGoDaddy.com, LLC23 Mar 201524 Mar 202423 Mar 2025
140locksmithserviceswichitaks.comeNom, Inc.27 Mar 201527 Mar 201527 Mar 2016
141locksmithservice-usa.comGoDaddy.com, LLC31 Mar 201531 Mar 201531 Mar 2017
142locksmithservicenearby.comGoDaddy.com, LLC31 Mar 201531 Mar 201531 Mar 2016
143locksmithservicescavecreek.comGoDaddy.com, LLC7 Apr 20157 Apr 20157 Apr 2016
144locksmithservice247.net----
145locksmithservicesdunwoody.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20155 Sep 20155 Sep 2016
146locksmithservices.infoNamesilo, LLC11 Feb 202111 Feb 202111 Feb 2022
147locksmithserviceallhours.comWest263 International Limited28 Jul 202028 Jul 202028 Jul 2021
148locksmithservicenewjersey.comGoDaddy.com, LLC4 May 20154 May 20154 May 2016
149locksmithservicethecolonytx.comGoDaddy.com, LLC11 May 201511 May 201511 May 2016
150locksmithservicequote.comCosmotown, Inc.12 May 201512 May 201512 May 2016
151locksmithservicedc.com1&1 Internet AG15 May 201514 Mar 201815 May 2025
152locksmithservices.orgAzdomainz LLC14 May 201525 Jun 201714 May 2018
153locksmithservicehollywood.comGoDaddy.com, LLC17 May 201517 May 201517 May 2016
154locksmithserviceinorlandofl.comeNom, Inc.22 May 201522 May 201522 May 2016
155locksmithservicestucson.comGoDaddy.com, LLC27 May 201527 May 201527 May 2016
156locksmithserviceguys.comXin Net Technology Corporation18 Mar 202318 May 202418 Mar 2024
157locksmithserviceinfremontca.comeNom, Inc.1 Jun 201530 Apr 20161 Jun 2017
158locksmithservicerichmondva.comGoDaddy.com, LLC4 Jun 20154 Jun 20154 Jun 2017
159locksmithserviceboise.netTucows Domains Inc.9 Jun 20159 Jun 20159 Jun 2017
160locksmithservicedenverco.comeNom, Inc.22 Jun 201528 Jun 201722 Jun 2017
161locksmithservices247.netNetwork Solutions, LLC25 Feb 202425 Feb 202425 Feb 2025
162locksmithservicemiami.netMesh Digital Limited23 Sep 201523 Sep 201523 Sep 2016
163locksmithservicesranchocucamonga.comGoDaddy.com, LLC3 Jul 20153 Jul 20243 Jul 2025
164locksmithservicesacworth.comGoDaddy.com, LLC24 Sep 201524 Sep 201524 Sep 2016
165locksmithservicesingapore.comNameCheap, Inc.10 Jul 201525 Jun 202410 Jul 2025
166locksmithserviceofoneco.comGoDaddy.com, LLC21 Feb 201920 Feb 202421 Feb 2025
167locksmithservicearvada.comGoDaddy.com, LLC14 Jul 201514 Jul 201514 Jul 2016
168locksmithservicesingeorgetownde.comeNom, Inc.24 Jul 201524 Jul 201524 Jul 2016
169locksmithservicesphiladelphia.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
170locksmithservicephilly.comGoDaddy.com, LLC30 Jul 20154 Aug 201630 Jul 2016
171locksmithservicepa.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
172locksmithserviceshoustontx.comGoDaddy.com, LLC31 Jul 20151 Aug 202331 Jul 2025
173locksmithservicehoustontx.comGoDaddy.com, LLC31 Jul 20151 Aug 202331 Jul 2025
174locksmithservicehouston.comGoDaddy.com, LLC31 Jul 20151 Aug 202331 Jul 2025
175locksmithservicehouston.netGoDaddy.com, LLC3 Aug 20153 Aug 20153 Aug 2016
176locksmithservices.miamiYnot Domains Corp.4 Oct 2015-4 Oct 2016
177locksmithservicesouthwest.comTucows Domains Inc.18 Oct 200922 Oct 201518 Oct 2016
178locksmithserviceinc.orgGoDaddy.com, LLC30 Oct 201530 Dec 201530 Oct 2017
179locksmithservicesmilfordct.comeNom, Inc.18 Nov 20157 Apr 201718 Nov 2017
180locksmithserviceslosangeles.comGoDaddy.com, LLC20 Nov 201521 Jun 202420 Nov 2025
181locksmithservicehawaii.comeNom, Inc.25 Nov 201525 Nov 201525 Nov 2016
182locksmithservice-247.comTucows Domains Inc.26 Nov 201530 Nov 201626 Nov 2016
183locksmithservicesinlongbeachca.comeNom, Inc.1 Dec 20151 Dec 20151 Dec 2016
184locksmithserviceshermanoaks.comGoDaddy.com, LLC7 Dec 20157 Dec 20157 Dec 2016
185locksmithservicesavannahga.comeNom, Inc.15 Dec 201515 Dec 201515 Dec 2016
186locksmithservicetechs.xyzNameCheap, Inc.2 Jan 20162 Jan 20162 Jan 2017
187locksmithservicesorangecounty.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2018
188locksmithservicepros.xyzNameCheap, Inc.12 Jan 201618 Feb 201612 Jan 2017
189locksmithservicescolumbus.comGoDaddy.com, LLC13 Jan 201613 Jan 201613 Jan 2017
190locksmithservicefrederick.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
191locksmithservicelexington.comGoDaddy.com, LLC18 May 201829 Jun 202418 May 2024
192locksmithservicekansascity.comGoDaddy.com, LLC30 Nov 202330 Nov 202330 Nov 2024
193locksmithservicesmiami.comDynadot, LLC14 Nov 202014 Nov 202014 Nov 2021
194locksmithservicesaltlakecityut.comGoDaddy.com, LLC26 Jan 201626 Jan 201626 Jan 2017
195locksmithservicemiami.comPorkbun, LLC30 Jan 201626 Jan 202330 Jan 2025
196locksmithservicesforall.com35 Technology Co., Ltd.27 Apr 20226 Jul 202327 Apr 2023
197locksmithservicemetrodetroit.usPDR Ltd. d/b/a PublicDomainRegistry.com11 Feb 201611 Feb 201610 Feb 2017
198locksmithservicejacksonville.comGoDaddy.com, LLC10 Feb 201611 Feb 201610 Feb 2017
199locksmithservicemesaaz.clubGoDaddy.com, LLC12 Feb 201612 Feb 201611 Feb 2017
200locksmithserviceandsuppley.comGoDaddy.com, LLC16 Feb 201617 Feb 202416 Feb 2025
201locksmithservicesmiamifl.comeNom, Inc.1 Mar 20161 Mar 20161 Mar 2017
202locksmithservicealpharetta.comGoDaddy.com, LLC11 Mar 201611 Mar 201611 Mar 2017
203locksmithservicesmarietta.comGoDaddy.com, LLC22 Mar 201622 Mar 202422 Mar 2025
204locksmithserviceshoustontexas.comGoDaddy.com, LLC23 Mar 201624 Mar 202423 Mar 2026
205locksmithservicerialto.comGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2017
206locksmithservicehoustontexas.comGoDaddy.com, LLC23 Mar 201624 Mar 202423 Mar 2026
207locksmithservicestx.comDomain.com, LLC20 Oct 202223 Oct 202420 Oct 2024
208locksmithservicewoodbury.comLaunchpad, Inc.29 Mar 201614 Mar 202429 Mar 2025
209locksmithservicestpaul.comLaunchpad, Inc.29 Mar 201614 Mar 202429 Mar 2025
210locksmithservicempls.comLaunchpad, Inc.29 Mar 201614 Mar 202429 Mar 2025
211locksmithservicenow.usTucows Domains Inc.31 Mar 201431 Mar 201430 Mar 2016
212locksmithservicenow.netTucows Domains Inc.31 Mar 201431 Mar 201431 Mar 2017
213locksmithservicenow.comGoDaddy.com, LLC27 Dec 201828 Dec 202327 Dec 2024
214locksmithservicelilburn.comGoDaddy.com, LLC19 Apr 201620 Apr 202419 Apr 2025
215locksmithservicefortworth.comDropCatch.com 688 LLC22 Apr 201622 Apr 201622 Apr 2017
216locksmithservicesjacksonville.comregister.com, Inc.25 May 201626 May 202425 May 2025
217locksmithservicesinc.xyzNameCheap, Inc.21 May 201610 Jun 201621 May 2017
218locksmithservicetucsonaz.comGoDaddy.com, LLC13 Jun 201624 May 202413 Jun 2025
219locksmithserviceva.comregister.com, Inc.15 Jun 201615 Jun 201615 Jun 2017
220locksmithserviceauroraco.comGoDaddy.com, LLC1 Jul 20161 Jul 20161 Jul 2017
221locksmithserviceinmanhattan.comGoDaddy.com, LLC16 Jun 201317 Jun 202416 Jun 2025
222locksmithservicestroy.comNameCheap, Inc.30 Sep 201430 Aug 202430 Sep 2025
223locksmithservicemanhattan.comNameCheap, Inc.16 Feb 20244 Jul 202416 Feb 2025
224locksmithservicelosangeles.comDynadot, LLC15 Dec 202015 Dec 202015 Dec 2021
225locksmithservices-24h.comInternet Domain Services BS Corp19 Jul 201620 Jul 201719 Jul 2017
226locksmithservice24.comGoDaddy.com, LLC3 Jun 20194 Jun 20243 Jun 2026
227locksmithservicesslc.xyzNameCheap, Inc.28 Jul 20165 Aug 201628 Jul 2017
228locksmithservicesdesmoines.comeNom, Inc.14 Mar 201328 Feb 201714 Mar 2018
229locksmithserviceacworth.comGoDaddy.com, LLC14 Aug 201615 Aug 202414 Aug 2025
230locksmithserviceaurora.comGoDaddy.com, LLC14 Aug 201615 Aug 202414 Aug 2025
231locksmithserviceboulder.comGoDaddy.com, LLC14 Aug 201615 Aug 202414 Aug 2025
232locksmithservicemesa.comGoDaddy.com, LLC15 Aug 20165 Apr 20241 Apr 2025
233locksmithservicecentennial.comGoDaddy.com, LLC16 Aug 201617 Aug 202416 Aug 2025
234locksmithservicesandiegoca.comeNom, Inc.17 Aug 201629 Sep 201717 Aug 2017
235locksmithservice-anaheim.comTreasure Trove Domains LLC26 Aug 20161 Sep 201626 Aug 2017
236locksmithservices247.comGoDaddy.com, LLC23 Feb 200824 Feb 202423 Feb 2025
237locksmithserviceduluth.comregister.com, Inc.9 Sep 201625 Aug 20179 Sep 2018
238locksmithservicemesaaz.comeNom, Inc.17 Apr 201419 Mar 202417 Apr 2025
239locksmithserviceparkcity.comGoDaddy.com, LLC9 May 20149 May 20249 May 2025
240locksmithservicemd.comGoDaddy.com, LLC11 Jan 20107 Apr 202411 Jan 2026
241locksmithservice-columbia.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
242locksmithservice-lasvegas.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
243locksmithservice-humble.comGoDaddy.com, LLC28 Apr 201129 Apr 202428 Apr 2025
244locksmithservicecall.comGoDaddy.com, LLC2 Feb 20113 Feb 20152 Feb 2017
245locksmithservicesvancouver.comGoDaddy.com, LLC6 Jul 20117 Jul 20166 Jul 2017
246locksmithserviceboise.com-14 Jun 202416 Nov 202414 Jun 2025
247locksmithservicewestpalmbeach.comeNom, Inc.31 Jul 201429 Jun 201531 Jul 2018
248locksmithservice-bethesda.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
249locksmithservicesedmonton.comGoDaddy.com, LLC19 Feb 201422 Sep 201519 Feb 2017
250locksmithserviceinqueens.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
251locksmithservicesinc.comGoDaddy.com, LLC20 May 20088 Jul 202420 May 2025
252locksmithservice247.comGoDaddy.com, LLC5 Apr 20106 Apr 20245 Apr 2025
253locksmithserviceinfortlauderdale.comGoDaddy.com, LLC13 Aug 201321 Jul 201513 Aug 2018
254locksmithservice24hr.comGoDaddy.com, LLC12 Jul 201013 Jul 202312 Jul 2025
255locksmithservice-indianapolis.comGoDaddy.com, LLC27 Apr 202228 Apr 202427 Apr 2025
256locksmithservice-sanantonio.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
257locksmithservicemississauga.comGoDaddy.com, LLC27 Jan 201228 Jan 202427 Jan 2026
258locksmithserviceinseattle.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
259locksmithserviceinportland.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
260locksmithservices24-7.comAmazon Registrar, Inc.12 Dec 20069 Nov 202312 Dec 2024
261locksmithservice-austin.comGoDaddy.com, LLC1 May 20112 May 20241 May 2025
262locksmithserviceinphiladelphia.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
263locksmithserviceinminneapolis.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
264locksmithserviceslocksmithshops.comWild West Domains, LLC22 Dec 200723 Dec 201522 Dec 2016
265locksmithserviceplus.comFastDomain Inc.1 Dec 20111 Dec 20161 Dec 2017
266locksmithservicestoronto.comGoDaddy.com, LLC29 May 201929 May 201929 May 2020
267locksmithserviceinphoenix.comGoDaddy.com, LLC16 Jun 201317 Jun 202416 Jun 2025
268locksmithservicephiladelphia.comGoDaddy.com, LLC25 Nov 201322 Jun 201615 Aug 2017
269locksmithservicesnyc.comGoDaddy.com, LLC8 Mar 20248 Mar 20248 Mar 2027
270locksmithservicerockville.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
271locksmithserviceinpittsburgh.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
272locksmithservicemidlothian.comGoDaddy.com, LLC20 Nov 201221 Nov 202320 Nov 2024
273locksmithserviceinnewyork.comGoDaddy.com, LLC16 Jun 201317 Jun 202416 Jun 2025
274locksmithserviceatlanta.comGoDaddy.com, LLC8 Sep 201120 Nov 20238 Sep 2023
275locksmithserviceshuntsville.comNameCheap, Inc.10 Jun 201419 Jul 202410 Jun 2025
276locksmithserviceinfortcollins.comGoDaddy.com, LLC22 Jul 201412 Jul 201622 Jul 2017
277locksmithservice-boston.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
278locksmithserviceinjacksonville.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
279locksmithservices.comGoDaddy.com, LLC19 Apr 200320 Apr 202419 Apr 2025
280locksmithservicecharlestonsc.comregister.com, Inc.16 May 201216 May 201216 May 2025
281locksmithservicescarborough.comGoDaddy.com, LLC27 Jan 201228 Jan 202427 Jan 2026
282locksmithserviceseverett.comChengdu West Dimension Digital Technology Co., Ltd…31 May 201831 May 201831 May 2019
283locksmithservicescottsdale.comGoDaddy.com, LLC31 May 20131 Jun 201631 May 2017
284locksmithservice-sandiego.comeNom, Inc.23 Apr 201325 Mar 201723 Apr 2018
285locksmithserviceinindianapolis.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
286locksmithserviceorlandofl.comGoDaddy.com, LLC13 Jun 201314 Jun 201613 Jun 2017
287locksmithservice-chicago.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
288locksmithservicetulsa.comGoDaddy.com, LLC9 Jan 201413 May 20249 Jan 2025
289locksmithservicelocksmithshopslocallocksmith.comWild West Domains, LLC22 Dec 200723 Dec 201522 Dec 2016
290locksmithservicesd.comregister.com, Inc.9 Apr 20149 Apr 20149 Apr 2018
291locksmithserviceinsacramento.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
292locksmithserviceslansing.comTucows Domains Inc.3 Dec 20107 Dec 20173 Dec 2017
293locksmithservicemanchester.comGoDaddy.com, LLC20 Nov 201221 Nov 202320 Nov 2024
294locksmithservicephoenix.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED10 Apr 202311 Apr 202410 Apr 2025
295locksmithservice-baltimore.comGoDaddy.com, LLC29 Apr 201111 Jul 202329 Apr 2023
296locksmithservice-dundalk.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
297locksmithserviceinatlanta.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
298locksmithservicesfortmyers.comNameCheap, Inc.25 Jun 201425 May 202425 Jun 2025
299locksmithservicegainesville.comregister.com, Inc.4 Sep 20124 Sep 20124 Sep 2019
300locksmithservicesandiego.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
301locksmithserviceindenver.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
302locksmithserviceinchicago.comGoDaddy.com, LLC16 Jun 201317 Jun 202416 Jun 2025
303locksmithserviceellicottcity.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
304locksmithservicequeens.comGoDaddy.com, LLC20 May 201431 Jan 202420 May 2029
305locksmithservice-thewoodlands.comGoDaddy.com, LLC28 Apr 201129 Apr 202428 Apr 2025
306locksmithservice-denver.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
307locksmithserviceinlasvegas.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
308locksmithservicegermantown.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
309locksmithserviceinwashington.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
310locksmithserviceskennesaw.comGoDaddy.com, LLC2 Jul 20133 Jul 20242 Jul 2025
311locksmithserviceinsanantonio.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
312locksmithserviceinsandiego.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
313locksmithserviceinbaltimore.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
314locksmithserviceswoodbridge.comGoDaddy.com, LLC30 Mar 201422 Sep 201530 Mar 2017
315locksmithserviceinc.comGoDaddy.com, LLC20 Feb 201120 Feb 202420 Feb 2025
316locksmithservice-spring.comGoDaddy.com, LLC28 Apr 201129 Apr 202428 Apr 2025
317locksmithserviceglendale.comGoDaddy.com, LLC27 Jan 201228 Jan 202427 Jan 2025
318locksmithservice-houston.comGoDaddy.com, LLC1 May 20112 May 20241 May 2025
319locksmithservicesacramento.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
320locksmithserviceshouston.comGoDaddy.com, LLC2 Jan 20143 Jan 20242 Jan 2025
321locksmithservicetampa.comGoDaddy.com, LLC25 Feb 201311 Feb 201525 Feb 2017
322locksmithserviceskaty.comregister.com, Inc.11 Apr 201311 Apr 201311 Apr 2017
323locksmithservice-cypress.comGoDaddy.com, LLC28 Apr 201129 Apr 202428 Apr 2025
324locksmithservicetowson.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
325locksmithservices-naples.comregister.com, Inc.3 Sep 20135 Sep 20163 Sep 2017
326locksmithservicesinmiami.comNameCheap, Inc.18 Apr 201219 Mar 202418 Apr 2025
327locksmithservicebeaverton.comeNom, Inc.11 Jul 201412 Jun 201511 Jul 2017
328locksmithserviceinsaltlakecity.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
329locksmithservice-dallas.comGoDaddy.com, LLC1 May 20112 May 20241 May 2025
330locksmithserviceinbrooklyn.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
331locksmithserviceinlosangeles.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
332locksmithservice24-7.comGoDaddy.com, LLC17 Mar 201118 Mar 202317 Mar 2025
333locksmithserviceincincinnati.comGoDaddy.com, LLC18 Mar 2014-18 Mar 2017
334locksmithserviceny.comGoDaddy.com, LLC22 Apr 20133 Jul 202422 Apr 2024
335locksmithservicegaithersburg.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
336locksmithservicecleveland.com-19 Jul 202320 Sep 202419 Jul 2024
337locksmithserviceinorlando.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
338locksmithserviceinlouisiana.comGoDaddy.com, LLC19 May 201419 May 201419 May 2019
339locksmithserviceindayton.comGoDaddy.com, LLC18 Mar 2014-18 Mar 2017
340locksmithserviceintampa.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
341locksmithservice-kingwood.comGoDaddy.com, LLC28 Apr 201129 Apr 202428 Apr 2025
342locksmithserviceshome.comregister.com, Inc.1 Nov 201311 Jan 20161 Nov 2016
343locksmithserviceinoakland.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
344locksmithservicessandiego.comeNom, Inc.4 Aug 20147 Aug 20164 Aug 2016
345locksmithserviceintucson.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
346locksmithservice-aspenhill.comGoDaddy.com, LLC29 Apr 201130 Apr 202429 Apr 2025
347locksmithserviceus.comGoDaddy.com, LLC9 Oct 20189 Oct 20189 Oct 2019
348locksmithservice-phoenix.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
349locksmithserviceatlantaga.comGoDaddy.com, LLC4 Feb 20214 Feb 20214 Feb 2022
350locksmithservicesqueensny.comregister.com, Inc.2 Aug 20137 Sep 20162 Aug 2017
351locksmithservicehopkins.comGoDaddy.com, LLC2 Jul 201417 May 20162 Jul 2017
352locksmithservicesofindiana.comDomain.com, LLC22 Jul 201329 Jul 202422 Jul 2029
353locksmithservicesnorcross.comGoDaddy.com, LLC25 Feb 201425 Feb 202425 Feb 2025
354locksmithserviceofsandiego.comGoDaddy.com, LLC3 Jun 201422 Nov 202321 Nov 2024
355locksmithservicelasvegas.comGoDaddy.com, LLC29 May 201230 May 202429 May 2025
356locksmithservicenyc.comFastDomain Inc.26 May 200911 May 202426 May 2025
357locksmithserviceneworleans.comNameCheap, Inc.1 Jul 20141 Jun 20241 Jul 2025
358locksmithservice-losangeles.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
359locksmithserviceindallas.comGoDaddy.com, LLC16 Jun 201317 Jun 202416 Jun 2025
360locksmithservicerichmond.comGoDaddy.com, LLC20 Nov 201221 Nov 202320 Nov 2024
361locksmithservice4all.comGoDaddy.com, LLC11 Jun 201811 Oct 202411 Jun 2025
362locksmithserviceinhouston.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
363locksmithservicenearme.comGoDaddy.com, LLC26 Feb 20197 Mar 202426 Feb 2025
364locksmithserviceinmiami.comGoDaddy.com, LLC11 Aug 201312 Aug 202311 Aug 2025
365locksmithservicesscarborough.comGoDaddy.com, LLC7 Jul 20128 Jul 20167 Jul 2017
366locksmithservicesrichmond.comGoDaddy.com, LLC16 Sep 201328 Oct 201516 Sep 2016
367locksmithservicestlouis.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED17 Nov 201817 Nov 201817 Nov 2019
368locksmithservicessingapore.comPSI-USA, Inc. dba Domain Robot15 Nov 202015 Nov 202015 Nov 2021
369locksmithservicesmd.comGoDaddy.com, LLC11 Jan 20108 Apr 202411 Jan 2026
370locksmithservicecharlottenc.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jan 201314 Jan 20173 Jan 2018
371locksmithservices-sanantonio.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
372locksmithservicesoftyler.comNetwork Solutions, LLC18 Aug 200718 Jun 202218 Aug 2027
373locksmithserviceinvancouver.comGoDaddy.com, LLC13 Aug 201313 Aug 201313 Aug 2018
374locksmithservicesjerseycity.comGoDaddy.com, LLC6 Aug 20137 Aug 20166 Aug 2017
375locksmithserviceinboise.comGoDaddy.com, LLC3 Apr 20144 Apr 20173 Apr 2020
376locksmithserviceswinstonsalemnc.comregister.com, Inc.24 Jan 201424 Jan 201424 Jan 2018
377locksmithservicesuk.comFreeparking Domain Registrars, Inc.23 Jan 200722 May 201523 Jan 2022
378locksmithservicestpetersburg.comeNom, Inc.25 Jul 201426 Jun 201525 Jul 2017
379locksmithservicein.comGoDaddy.com, LLC2 Aug 20173 Aug 20242 Aug 2025
380locksmithservice-atlanta.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
381locksmithservicesdover.comeNom, Inc.25 Jul 201429 Aug 201625 Jul 2017
382locksmithservice-sacramento.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
383locksmithservicesanfrancisco.comeNom, Inc.5 Jan 20147 Dec 20235 Jan 2025
384locksmithservicesbuffalo.comregister.com, Inc.30 Sep 201430 Sep 201430 Sep 2016
385locksmithserviceinsanjose.comGoDaddy.com, LLC16 Jun 2013-16 Jun 2017
386locksmithservicehyattsvillemd.comeNom, Inc.12 Sep 201625 Oct 201712 Sep 2017
387locksmithservicephenixcity.us-21 Sep 201621 Sep 201620 Sep 2017
388locksmithservices.mobiGoDaddy.com, LLC31 Jan 20161 Feb 201731 Jan 2018
389locksmithserviceinc.netGoDaddy.com, LLC20 Feb 201119 Feb 201520 Feb 2017
390locksmithserviceinphoenix.netGoDaddy.com, LLC13 Aug 201325 Apr 201413 Aug 2018
391locksmithservicesd.netregister.com, Inc.9 Apr 20149 Apr 20149 Apr 2018
392locksmithservicesoftyler.netTucows Domains Inc.24 Jun 201328 Jun 201724 Jun 2017
393locksmithservicestoronto.netGoDaddy.com, LLC7 Jul 20128 Jul 20167 Jul 2017
394locksmithservicesanjose.netregister.com, Inc.27 Mar 201427 Mar 201427 Mar 2021
395locksmithservices.netGoDaddy.com, LLC5 Feb 20196 Feb 20245 Feb 2025
396locksmithserviceshouston.netGoDaddy.com, LLC2 Jan 20143 Jan 20242 Jan 2025
397locksmithservicesandiego.netregister.com, Inc.27 Mar 201427 Mar 201427 Mar 2021
398locksmithservicesunnyside.comTucows Domains Inc.24 Oct 201628 Oct 201724 Oct 2017
399locksmithservices.xyzNameKing.com Inc.13 Oct 202113 Oct 202113 Oct 2022
400locksmithserviceedmonds.comGoDaddy.com, LLC26 Oct 201627 Oct 202426 Oct 2025
401locksmithservicesinca.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
402locksmithservicesca.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
403locksmithserviceseattle.comGoDaddy.com, LLC27 Oct 201628 Oct 202427 Oct 2025
404locksmithservicesinny.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
405locksmithservicedesmoines.comGoDaddy.com, LLC27 Oct 201628 Oct 202427 Oct 2025
406locksmithservicesny.comNameCheap, Inc.16 Jan 2020-16 Jan 2021
407locksmithservicesatl.comTucows Domains Inc.12 Nov 201616 Nov 201712 Nov 2017
408locksmithservicesincharlottenc.comeNom, Inc.27 Nov 201627 Nov 201627 Nov 2018
409locksmithservicesnearby.comGoDaddy.com, LLC10 Apr 202410 Apr 202410 Apr 2025
410locksmithservices4u.comGoDaddy.com, LLC13 Dec 201614 Dec 202213 Dec 2024
411locksmithservicefairfield.comWild West Domains, LLC14 Jan 201714 Jan 202014 Jan 2021
412locksmithserviceevansville.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Jan 201717 Jan 201818 Jan 2019
413locksmithservicesroswell.comGoDaddy.com, LLC20 Jan 201715 May 202420 Jan 2025
414locksmithserviceottawa.comGoDaddy.com, LLC3 Feb 20174 Feb 20233 Feb 2025
415locksmithserviceskensington.comTucows Domains Inc.7 Feb 201711 Feb 20197 Feb 2019
416locksmithservicescardiff.comeNom, Inc.16 Feb 201721 Jan 201816 Feb 2018
417locksmithservicemichigan.comGoDaddy.com, LLC23 Feb 201723 Feb 201723 Feb 2018
418locksmithservicesllc.comGoDaddy.com, LLC15 Oct 202016 Oct 202415 Oct 2025
419locksmithservicesboise.comGoDaddy.com, LLC7 Mar 20177 Mar 20177 Mar 2018
420locksmithservicesblog.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 201724 May 201724 Mar 2018
421locksmithservicechulavista.comName.com, Inc.12 Apr 201716 Oct 201712 Apr 2018
422locksmithservice-memphis.comNameCheap, Inc.16 Sep 202217 Aug 202416 Sep 2025
423locksmithservicecompany.comNameCheap, Inc.23 Jul 20234 Sep 202423 Jul 2024
424locksmithservicesalem.comName.com, Inc.11 May 201712 Apr 202411 May 2025
425locksmithserviceoceanside.comGoDaddy.com, LLC22 May 201719 Jul 202422 May 2025
426locksmithservicesoftware.comGoDaddy.com, LLC7 Jun 20177 Jun 20177 Jun 2018
427locksmithservicesincardiff.comeNom, Inc.3 Jul 201711 Jun 20243 Jul 2025
428locksmithservices.bizDynadot, LLC3 Jun 20203 Jun 20213 Jun 2021
429locksmithserviceshillsboro.comName.com, Inc.18 Jul 201726 Sep 201718 Jul 2018
430locksmithservices.sitePDR Ltd. d/b/a PublicDomainRegistry.com26 Sep 202126 Sep 202126 Sep 2022
431locksmithserviceranchocucamonga.comName.com, Inc.28 Aug 201728 Aug 201728 Aug 2018
432locksmithservices.guruNameCheap, Inc.7 Sep 20177 Sep 20177 Sep 2018
433locksmithservices.groupNameCheap, Inc.18 Sep 201718 Sep 201718 Sep 2018
434locksmithservice-tucson.comNameCheap, Inc.21 Jul 202214 Jul 202421 Jul 2025
435locksmithserviceincharlottenc.comNameCheap, Inc.13 Oct 201713 Oct 201713 Oct 2018
436locksmithservices24h.menNameCheap, Inc.1 Nov 20176 Nov 20171 Nov 2018
437locksmithservices24hr.menNameCheap, Inc.1 Nov 20171 Nov 20171 Nov 2018
438locksmithservices24hr.techNameCheap, Inc.16 Nov 201716 Nov 201716 Nov 2018
439locksmithservicescoppell.comName.com, Inc.21 Nov 201721 Nov 201721 Nov 2018
440locksmithserviceslancaster.comFastDomain Inc.3 Jan 201818 Dec 20233 Jan 2025
441locksmithserviceinripon.co.uk-21 Nov 20166 Nov 201721 Nov 2018
442locksmithserviceglasgow.co.uk-27 Apr 20159 Apr 201727 Apr 2018
443locksmithservicebirmingham.co.uk-29 Jul 201523 May 201729 Jul 2018
444locksmithserviceinscarborough.co.uk-21 Nov 20166 Nov 201721 Nov 2018
445locksmithserviceinclitheroe.co.uk-21 Nov 20166 Nov 201721 Nov 2018
446locksmithserviceinleigh.co.uk-24 Nov 20166 Nov 201724 Nov 2018
447locksmithservicenewport.co.uk-20 Oct 20165 Oct 201720 Oct 2018
448locksmithservice247.co.uk-11 Nov 201712 Nov 202411 Nov 2027
449locksmithservicescardiff.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…22 Sep 201622 Sep 201622 Sep 2018
450locksmithservicecardiff.co.uk-3 Jul 202415 Aug 20243 Jul 2025
451locksmithserviceincolne.co.uk-21 Nov 20166 Nov 201721 Nov 2018
452locksmithserviceinskelmersdale.co.uk-21 Nov 20166 Nov 201721 Nov 2018
453locksmithserviceinsheffield.co.uk-29 Jul 202229 Jul 202229 Jul 2023
454locksmithserviceinskipton.co.uk-21 Nov 20166 Nov 201721 Nov 2018
455locksmithserviceinthornaby.co.uk-21 Nov 20166 Nov 201721 Nov 2018
456locksmithserviceinmorecambe.co.uk-21 Nov 20166 Nov 201721 Nov 2018
457locksmithserviceslondon.co.uk-18 Dec 201520 Aug 202418 Dec 2025
458locksmithservicelondon.co.uk-11 Apr 20147 Jun 201711 Apr 2018
459locksmithserviceinleith.co.uk-4 Oct 201614 Sep 20174 Oct 2018
460locksmithserviceinedinburgh.co.uk-4 Mar 20165 Aug 20164 Mar 2018
461locksmithserviceinpoulton.co.uk-21 Nov 20166 Nov 201721 Nov 2018
462locksmithservicesbirmingham.co.uk-29 Jul 201523 May 201729 Jul 2018
463locksmithservices.me.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Apr 20063 Apr 201610 Apr 2018
464locksmithservicesgrimsby.co.uk-3 Nov 20085 Oct 20243 Nov 2026
465locksmithserviceinormskirk.co.uk-21 Nov 20166 Nov 201721 Nov 2018
466locksmithserviceinhull.co.uk-10 Jan 201726 Dec 201710 Jan 2019
467locksmithserviceinfleetwood.co.uk-21 Nov 20166 Nov 201721 Nov 2018
468locksmithserviceinnelson.co.uk-21 Nov 20166 Nov 201721 Nov 2018
469locksmithserviceindunfermline.co.uk-4 Oct 201614 Sep 20174 Oct 2018
470locksmithserviceinknaresborough.co.uk-21 Nov 20166 Nov 201721 Nov 2018
471locksmithserviceinchesterfield.co.uk-26 Apr 20165 Aug 201626 Apr 2018
472locksmithserviceingateshead.co.uk-20 Dec 20161 Dec 201720 Dec 2018
473locksmithservicesouthampton.co.uk-10 Jan 201726 Dec 201710 Jan 2019
474locksmithservices.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Apr 20063 Apr 201610 Apr 2018
475locksmithserviceindarlington.co.uk-21 Nov 20166 Nov 201721 Nov 2018
476locksmithserviceinmiddlesbrough.co.uk-21 Nov 20166 Nov 201721 Nov 2018
477locksmithserviceinwidnes.co.uk-24 Nov 20166 Nov 201724 Nov 2018
478locksmithserviceinyarm.co.uk-21 Nov 20166 Nov 201721 Nov 2018
479locksmithserviceinhaslingden.co.uk-21 Nov 20166 Nov 201721 Nov 2018
480locksmithserviceinrotherham.co.uk-12 Sep 202212 Sep 202312 Sep 2023
481locksmithserviceinthirsk.co.uk-21 Nov 20166 Nov 201721 Nov 2018
482locksmithserviceinsthelens.co.uk-24 Nov 20166 Nov 201724 Nov 2018
483locksmithserviceinnewcastle.co.uk-20 Dec 20161 Dec 201720 Dec 2018
484locksmithservicestwickenham.co.uk-25 Feb 201327 Dec 201725 Feb 2018
485locksmithserviceinredcar.co.uk-21 Nov 20166 Nov 201721 Nov 2018
486locksmithserviceinpreston.co.uk-11 Sep 201611 Sep 201611 Sep 2018
487locksmithservicegateshead.co.uk-12 Nov 201525 Oct 201712 Nov 2018
488locksmithserviceinnorthallerton.co.uk-21 Nov 20166 Nov 201721 Nov 2018
489locksmithserviceportsmouth.co.uk-10 Jan 201726 Dec 201710 Jan 2019
490locksmithservicessheffield.co.ukHello Internet Corp.15 May 201415 May 201715 May 2018
491locksmithserviceinwigan.co.uk-24 Nov 20166 Nov 201724 Nov 2018
492locksmithserviceinpenwortham.co.uk-21 Nov 20166 Nov 201721 Nov 2018
493locksmithservicesbirmingham.comeNom, Inc.9 Jan 20189 Jan 20189 Jan 2019
494locksmithserviceinstockton-on-tees.co.uk-21 Nov 20166 Nov 201721 Nov 2018
495locksmithserviceindalkeith.co.uk-4 Oct 201614 Sep 20174 Oct 2018
496locksmithservicesessex.co.uk-7 Oct 20134 Aug 20177 Oct 2020
497locksmithserviceinrawtenstall.co.uk-21 Nov 20166 Nov 201721 Nov 2018
498locksmithservicebristol.co.uk-29 Sep 201614 Sep 201729 Sep 2018
499locksmithserviceinharrogate.co.uk-21 Nov 20166 Nov 201721 Nov 2018
500locksmithserviceinbeverly.co.uk-10 Jan 201726 Dec 201710 Jan 2019
501locksmithserviceinwarrington.co.uk-24 Nov 20166 Nov 201724 Nov 2018
502locksmithserviceinwhitby.co.uk-21 Nov 20166 Nov 201721 Nov 2018
503locksmithserviceinnorthwich.co.uk-24 Nov 20166 Nov 201724 Nov 2018
504locksmithserviceinyork.co.uk-21 Nov 20166 Nov 201721 Nov 2018
505locksmithserviceinmusselburgh.co.uk-4 Oct 201614 Sep 20174 Oct 2018
506locksmithserviceinlancaster.co.uk-21 Nov 20166 Nov 201721 Nov 2018
507locksmithserviceinsouthshields.co.uk-20 Dec 20161 Dec 201720 Dec 2018
508locksmithserviceinglasgow.co.uk-27 Jan 201610 Jan 201827 Jan 2019
509locksmithserviceindarwen.co.uk-21 Nov 20166 Nov 201721 Nov 2018
510locksmithserviceinguisborough.co.uk-21 Nov 20166 Nov 201721 Nov 2018
511locksmithserviceinfulwood.co.ukReserved18 Dec 201718 Dec 201718 Dec 2018
512locksmithservicesportland.comName.com, Inc.30 Jan 201830 Jan 201830 Jan 2019
513locksmithservices06.comNetwork Solutions, LLC2 Mar 20182 Mar 20182 Mar 2020
514locksmithservicesummerhill.comTucows Domains Inc.7 Mar 201811 Mar 20197 Mar 2019
515locksmithservicemidtowntoronto.comTucows Domains Inc.7 Mar 201811 Mar 20197 Mar 2019
516locksmithservices.onlineNameCheap, Inc.15 Nov 202415 Nov 202415 Nov 2025
517locksmithservicesbirminghamal.comTucows Domains Inc.14 Mar 201817 Jun 202414 Mar 2025
518locksmithserviceschicago.comGoDaddy.com, LLC7 Jun 20187 Jun 20187 Jun 2019
519locksmithservicesedmonton.ca-19 Feb 20145 Apr 201919 Feb 2020
520locksmithservicesforyou.comeNom, Inc.5 Apr 20185 Apr 20185 Apr 2019
521locksmithserviceflorenceky.comTucows Domains Inc.9 Apr 201813 Apr 20199 Apr 2019
522locksmithservices.zonePorkbun, LLC24 Apr 201824 Apr 201824 Apr 2019
523locksmithservicesvaughan.comTucows Domains Inc.14 May 201818 May 201914 May 2019
524locksmithservicesbarrie.comTucows Domains Inc.14 May 201818 May 201914 May 2019
525locksmithservicesinwoodstock.comNetwork Solutions, LLC26 May 201826 May 201826 May 2019
526locksmithservicesinroswell.comNetwork Solutions, LLC26 May 201826 May 201826 May 2019
527locksmithservicesinburbank.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
528locksmithservicesinglendale.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
529locksmithservicesinsantaclarita.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
530locksmithservicesinhollywood.comGoDaddy.com, LLC1 Jun 20181 Jun 20181 Jun 2019
531locksmithserviceladylake.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
532locksmithserviceswildwood.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
533locksmithservicesummerfield.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
534locksmithservices.ca-26 Jul 20109 Sep 202426 Jul 2025
535locksmithservicetoronto.caRCN Corporation9 Feb 20119 Aug 20169 Feb 2020
536locksmithservicesgroup.comGoDaddy.com, LLC7 Jun 202112 Jun 20237 Jun 2025
537locksmithservicepros.comGoDaddy.com, LLC2 Jan 20242 Jan 20242 Jan 2027
538locksmithservicepro.netGoDaddy.com, LLC12 Aug 201812 Aug 201812 Aug 2020
539locksmithserviceswi.comGoDaddy.com, LLC20 Nov 201820 Nov 201820 Nov 2020
540locksmithservices247.clubNameCheap, Inc.24 Dec 201824 Dec 201824 Dec 2019
541locksmithservicescoloradosprings.usNameCheap, Inc.21 Jul 202221 Jul 202321 Jul 2023
542locksmithservicesgta.comGoDaddy.com, LLC3 Aug 20216 Aug 20213 Aug 2022
543locksmithserviceslondon.comGoDaddy.com, LLC12 Mar 20191 Aug 202412 Mar 2025
544locksmithservicega.comNameCheap, Inc.19 Mar 201919 Mar 201919 Mar 2020
545locksmithservices-in-fr.comKey-Systems GmbH9 Apr 20199 Apr 20199 Apr 2020
546locksmithservices-in-us.comKey-Systems GmbH9 Apr 20199 Apr 20199 Apr 2020
547locksmithserviceamerica.comNameCheap, Inc.23 Apr 201923 Apr 201923 Apr 2020
548locksmithservice-tx.comGoDaddy.com, LLC22 Apr 201922 Apr 201922 Apr 2020
549locksmithserviceselginmills.comTucows Domains Inc.23 Apr 201927 Apr 202023 Apr 2020
550locksmithservicesintoronto.ca-23 Dec 201524 Dec 202223 Dec 2024
551locksmithservicekc.comRealtime Register B.V.24 May 201924 May 201924 May 2020
552locksmithservicespreston.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jul 20193 Jul 20193 Jul 2020
553locksmithservicesnow.comNameCheap, Inc.6 Jul 2019-6 Jul 2020
554locksmithservicetoday.comGoDaddy.com, LLC10 Jul 201910 Jul 201910 Jul 2020
555locksmithservices.todayGoDaddy.com, LLC17 Apr 202422 Apr 202417 Apr 2025
556locksmithserviceandrepair.comGoDaddy.com, LLC12 Jul 201912 Jul 201912 Jul 2021
557locksmithservicescallnow.comNameCheap, Inc.16 Jul 2019-16 Jul 2020
558locksmithservicecharlotte.comregister.com, Inc.26 Sep 201927 Sep 202426 Sep 2025
559locksmithservicesandsecurity.comeNom, Inc.4 Oct 20194 Oct 20194 Oct 2020
560locksmithservices24.comFastDomain Inc.1 Dec 201916 Nov 20241 Dec 2025
561locksmithserviceshop.comNameCheap, Inc.1 Dec 2019-1 Dec 2020
562locksmithservicesla.comGoDaddy.com, LLC23 Feb 202024 Feb 202423 Feb 2025
563locksmithserviceseagan.comName.com, Inc.26 Feb 202026 Feb 202026 Feb 2021
564locksmithservicesisrael.comNameCheap, Inc.22 Mar 202021 Feb 202422 Mar 2025
565locksmithservicebox.comKey-Systems GmbH5 May 20205 May 20205 May 2021
566locksmithserviceshome.infoGoDaddy.com, LLC18 May 202018 May 202018 May 2021
567locksmithserviceslongmont.comGoogle, Inc.16 Jan 201921 May 202416 Jan 2025
568locksmithservicesanjose.comGoDaddy.com, LLC8 Jul 20208 Jul 20208 Jul 2021
569locksmithservice24h.spaceUniregistrar Corp16 Jun 202019 Jun 202016 Jun 2021
570locksmithservicesonline.comGoDaddy.com, LLC23 Jul 202023 Jul 202423 Jul 2025
571locksmithservicesgateshead.xyzNameCheap, Inc.24 Jul 202013 Nov 202424 Jul 2025
572locksmithservicesoftyler1.comName.com, Inc.9 Sep 20209 Sep 20209 Sep 2021
573locksmithservicesoftyler2.comName.com, Inc.10 Sep 202010 Sep 202010 Sep 2021
574locksmithservicesbayarea.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
575locksmithservicespaloalto.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
576locksmithservicessanmateo.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
577locksmithservicesincs.com1&1 Internet AG13 Oct 202013 Oct 202013 Oct 2021
578locksmithserviceschampaignil.comGoDaddy.com, LLC17 Oct 20202 Nov 202217 Oct 2030
579locksmithservices.coNameKing.com Inc.21 Jun 202226 Jun 202321 Jun 2023
580locksmithservicesllc.coGoDaddy.com, LLC31 Oct 202016 Aug 202131 Oct 2021
581locksmithserviceilnet.comKey-Systems GmbH11 Nov 202011 Nov 202011 Nov 2021
582locksmithserviceaustin.comDynadot, LLC15 Nov 202015 Nov 202015 Nov 2021
583locksmithservicescollc.comGoDaddy.com, LLC5 Jan 20245 Jan 20245 Jan 2025
584locksmithservicespros.comNameCheap, Inc.16 May 20206 May 202416 May 2025
585locksmithserviceorleans.ca-8 Jan 202022 Feb 20248 Jan 2025
586locksmithservice247.sitePDR Ltd. d/b/a PublicDomainRegistry.com7 Sep 20217 Sep 20217 Sep 2022
587locksmithservice24hr.siteUniregistrar Corp2 Jun 202020 Aug 20202 Jun 2021
588locksmithservicesca.siteDOTSERVE INC.22 Apr 20197 Jul 202022 Apr 2021
589locksmithservice24hour.com-30 Dec 202027 Feb 202430 Dec 2024
590locksmithservicesilnet.comKey-Systems GmbH12 Jan 202112 Jan 202112 Jan 2022
591locksmithservicenear.comGoDaddy.com, LLC28 Jan 202128 Jan 202128 Jan 2022
592locksmithservicesdallas.comDynadot, LLC12 Mar 202112 Mar 202112 Mar 2022
593locksmithservicephoenixaz.comGoDaddy.com, LLC20 Apr 202120 Apr 202120 Apr 2022
594locksmithservicecan.comKey-Systems GmbH4 May 20214 May 20214 May 2022
595locksmithservicesusa.comGoDaddy.com, LLC4 May 20215 May 20244 May 2025
596locksmithservicellc.comGoogle, Inc.4 Jun 202114 Jun 20244 Jun 2025
597locksmithservicejonesboroar.comGoDaddy.com, LLC28 Jun 202128 Jun 202128 Jun 2022
598locksmithservicesit.spaceDOTSERVE INC.29 Jun 20219 May 202229 Jun 2024
599locksmithservicebronxny.comGoDaddy.com, LLC6 Jul 20216 Jul 20216 Jul 2022
600locksmithserviceuk.comKey-Systems GmbH19 Jul 202119 Jul 202119 Jul 2022
601locksmithserviceusanet.comKey-Systems GmbH28 Jul 202128 Jul 202128 Jul 2022
602locksmithservicesusanet.comKey-Systems GmbH2 Aug 20212 Aug 20212 Aug 2022
603locksmithservicesforever.comNameCheap, Inc.14 Aug 2021-14 Aug 2022
604locksmithservicesinwashingtondc.comFastDomain Inc.26 Aug 202126 Aug 202126 Aug 2022
605locksmithservicesspring.comNameCheap, Inc.27 Sep 202128 Aug 202427 Sep 2025
606locksmithservicehumble.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
607locksmithserviceplano.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
608locksmithservicekingwood.comGoDaddy.com, LLC6 Oct 20217 Oct 20246 Oct 2025
609locksmithserviceaustintx.comGoDaddy.com, LLC6 Oct 202111 Oct 20246 Oct 2025
610locksmithservicesukweb.comKey-Systems GmbH8 Oct 20218 Oct 20218 Oct 2022
611locksmithservices.sbsNamesilo, LLC14 Nov 202114 Nov 202114 Nov 2022
612locksmithserviceofchicago.comGoDaddy.com, LLC16 Nov 202117 Nov 202416 Nov 2025
613locksmithserviceofphoenix.comGoDaddy.com, LLC21 Nov 202122 Nov 202321 Nov 2024
614locksmithservice-houstontx.comGoDaddy.com, LLC22 Nov 202122 Nov 202322 Nov 2024
615locksmithserviceofbetchworthcompany.comGoogle, Inc.5 Dec 20215 Dec 20215 Dec 2022
616locksmithservicedubai.comGoDaddy.com, LLC27 Dec 202116 Dec 202327 Dec 2024
617locksmithserviceswebuk.comKey-Systems GmbH7 Jan 20227 Jan 20227 Jan 2023
618locksmithserviceinfouk.comKey-Systems GmbH13 Jan 202213 Jan 202213 Jan 2023
619locksmithservicescan.comNamesilo, LLC26 Jan 202227 Jan 202226 Jan 2023
620locksmithservices.agencyNetwork Solutions, LLC13 Mar 20229 Jun 202413 Mar 2025
621locksmithservicevegas.comNameCheap, Inc.21 Mar 20224 Apr 202321 Mar 2024
622locksmithservicepasco.comGoogle, Inc.7 Apr 20227 Jun 20247 Apr 2024
623locksmithservice1-it.spaceDOTSERVE INC.19 May 20222 Jun 202219 May 2024
624locksmithservice-it.spaceDOTSERVE INC.19 May 20222 Jun 202219 May 2024
625locksmithservicelakewood.comGoDaddy.com, LLC30 Oct 201731 Oct 202430 Oct 2025
626locksmithservices.storeCrazy Domains FZ-LLC10 Aug 20227 Aug 202410 Aug 2025
627locksmithservice24h.co.ukClick Registrar, Inc. d/b/a publicdomainregistry.c…10 Aug 202220 Aug 202210 Aug 2023
628locksmithservice24hr.sbsNamesilo, LLC21 Aug 202221 Aug 202221 Aug 2023
629locksmithservice24hrs.sbsNamesilo, LLC21 Aug 202221 Aug 202221 Aug 2023
630locksmithservicesbrighton.comWild West Domains, LLC20 Aug 202230 Sep 202320 Aug 2023
631locksmithservices24hr.sbsNamesilo, LLC28 Aug 202228 Aug 202228 Aug 2023
632locksmithservicesinit.spaceDOTSERVE INC.8 Sep 20228 Sep 20228 Sep 2023
633locksmithservicesus.comAbove.com Pty Ltd.3 Oct 202213 Dec 20233 Oct 2023
634locksmithservices-uk.siteDOTSERVE INC.11 Oct 202211 Oct 202211 Oct 2023
635locksmithserviceinit.spaceDOTSERVE INC.13 Oct 202213 Oct 202213 Oct 2023
636locksmithservicesokc.comGoDaddy.com, LLC27 Dec 201816 Oct 202227 Dec 2026
637locksmithservicesaurora.comGoDaddy.com, LLC19 Oct 202219 Oct 202219 Oct 2027
638locksmithservicesink.comDomain.com, LLC19 Oct 202222 Oct 202419 Oct 2024
639locksmithservices.companyGoogle, Inc.21 Oct 202221 Oct 202221 Oct 2023
640locksmithservicecanada.comNameCheap, Inc.26 Oct 202226 Sep 202426 Oct 2025
641locksmithservicesmn.comGoDaddy.com, LLC29 Oct 20229 Nov 202429 Oct 2025
642locksmithservices.clickNamesilo, LLC27 Nov 202230 Jan 202427 Nov 2023
643locksmithservicesydney.onlineCrazy Domains FZ-LLC16 Dec 202222 Dec 202316 Dec 2024
644locksmithservices247.co.ukDynadot, LLC26 Dec 202227 Dec 202326 Dec 2023
645locksmithserviceslondon247.co.uk-28 Dec 20229 Feb 202428 Dec 2024
646locksmithserviceasap.comNameCheap, Inc.4 Jan 202313 Jan 20244 Jan 2025
647locksmithserviceunionville.comHostinger, UAB7 Jan 202317 Feb 20247 Jan 2024
648locksmithservicestouffville.comHostinger, UAB8 Jan 202317 Feb 20248 Jan 2024
649locksmithservicemineola.comNameCheap, Inc.12 Jan 202313 Dec 202312 Jan 2025
650locksmithservice24h.buzzNameKing.com Inc.9 Aug 20228 Sep 20239 Aug 2023
651locksmithservices24hours.buzzNameKing.com Inc.17 Jan 202222 Jan 202217 Jan 2023
652locksmithservices24hr.buzzNameKing.com Inc.17 Jan 202222 Jan 202217 Jan 2023
653locksmithservices-bayarea.comGoDaddy.com, LLC26 Jan 202326 Jan 202326 Jan 2025
654locksmithservices24h.buzzNameKing.com Inc.6 Jul 20226 Aug 20236 Jul 2023
655locksmithservice247.buzzNamesilo, LLC14 Oct 202217 Nov 202314 Oct 2023
656locksmithservices247.buzzNamesilo, LLC14 Oct 202217 Nov 202314 Oct 2023
657locksmithservicedeltabc.ca-17 Apr 20161 Jun 202417 Apr 2025
658locksmithservicesydneyservice.comWild West Domains, LLC30 Jan 202312 Mar 202430 Jan 2024
659locksmithserviceauroraon.ca-13 Jun 202014 Jun 202413 Jun 2026
660locksmithservicemarkham.ca-13 Jun 202014 Jun 202413 Jun 2026
661locksmithservices.ae----
662locksmithservicedandenong.comKey-Systems GmbH4 Feb 20237 Apr 20244 Feb 2025
663locksmithservicearlingtonheights.comGoDaddy.com, LLC1 Aug 20172 Aug 20241 Aug 2025
664locksmithservicesindc.comGoDaddy.com, LLC2 Aug 201713 Sep 20232 Aug 2023
665locksmithservicecapalababrisbane.comGransy s.r.o. d/b/a subreg.cz27 Feb 202328 Feb 202427 Feb 2025
666locksmithservicemarietta.comGoDaddy.com, LLC8 Nov 20179 Aug 20248 Nov 2025
667locksmithservicegardencity.comGoDaddy.com, LLC1 Feb 201813 Feb 20221 Feb 2023
668locksmithserviceblackburnmelbourne.comGransy s.r.o. d/b/a subreg.cz8 Mar 20239 Mar 20248 Mar 2025
669locksmithservice-us.siteDOTSERVE INC.14 Mar 20238 Feb 202414 Mar 2025
670locksmithservicemchenry.comGoDaddy.com, LLC23 May 20183 Aug 202323 May 2023
671locksmithservicesboulder.comGoogle, Inc.16 Jan 201923 Apr 202416 Jan 2025
672locksmithservicesaz.comGoDaddy.com, LLC5 May 202116 Jun 20235 May 2023
673locksmithservicesunnybank.comWild West Domains, LLC1 Apr 202313 Apr 20241 Apr 2025
674locksmithservicesfriendswood.comGoDaddy.com, LLC27 Sep 202128 Sep 202427 Sep 2025
675locksmithservicesrichardson.comGoDaddy.com, LLC27 Sep 202128 Sep 202427 Sep 2025
676locksmithservicecypress.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
677locksmithservicesbaltimore.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
678locksmithservicespringtx.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
679locksmithservicedallastx.comGoDaddy.com, LLC6 Oct 20217 Oct 20246 Oct 2025
680locksmithserviceindianapolis.comGoDaddy.com, LLC6 Oct 20217 Oct 20246 Oct 2025
681locksmithservicethewoodlands.comGoDaddy.com, LLC6 Oct 202111 Oct 20246 Oct 2025
682locksmithservicesatlantaga.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
683locksmithserviceofatlanta.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
684locksmithservicesboston.comPorkbun, LLC28 Sep 202428 Sep 202428 Sep 2025
685locksmithserviceschelmsford.comGoDaddy.com, LLC13 Jul 202224 Aug 202413 Jul 2024
686locksmithservices.monsterNameCheap, Inc.15 Oct 202216 Oct 202315 Oct 2024
687locksmithserviceslongmont.orgGoogle, Inc.16 Dec 201926 Apr 202416 Dec 2024
688locksmithservicerepair.comNameCheap, Inc.27 Apr 20238 Jul 202427 Apr 2024
689locksmithservices.co.uk-5 Aug 202331 Oct 20245 Aug 2025
690locksmithservice24.co.uk-9 Oct 20203 Oct 20249 Oct 2025
691locksmithservicesbalwyn.comHostinger, UAB16 May 202325 Jun 202416 May 2024
692locksmithservicesmississauga.comWild West Domains, LLC24 May 20235 Aug 202424 May 2024
693locksmithserviceexperts.comGoDaddy.com, LLC16 Jun 202311 Sep 202416 Jun 2026
694locksmithservicefl.comGoDaddy.com, LLC16 Jun 202311 Sep 202416 Jun 2026
695locksmithservices-it.spaceDOTSERVE INC.27 Jun 20233 Aug 202427 Jun 2024
696locksmithserviceglanwaverley.comHostinger, UAB30 Jun 20233 Jun 202430 Jun 2025
697locksmithservices.uk-12 Jan 202216 May 202412 Jan 2025
698locksmithservicesfast.comGoogle, Inc.18 Jul 202317 Sep 202418 Jul 2024
699locksmithservice247.com.au--15 Jul 2024-
700locksmithserviceexperts.xyzDynadot, LLC8 Nov 20239 Nov 20248 Nov 2025
701locksmithservicesarc.comPorkbun, LLC20 Nov 202320 Nov 202320 Nov 2024
702locksmithservicekingsfordsydney.comHostinger, UAB22 Nov 202322 Jan 202422 Nov 2024
703locksmithservicemascot.comHostinger, UAB22 Nov 202322 Jan 202422 Nov 2024
704locksmithservicebrisbane.comGransy s.r.o. d/b/a subreg.cz3 Dec 20233 Dec 20233 Dec 2024
705locksmithservicenearme.orgDropCatch.com 1524 LLC22 Dec 202327 Dec 202322 Dec 2024
706locksmithservicebankstownsydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
707locksmithservicemerrylandssydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
708locksmithservicepymblesydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
709locksmithserviceslanecovesydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
710locksmithserviceswestmeadsydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
711locksmithserviceredfern.comHostinger, UAB6 Jan 20246 Jan 20246 Jan 2025
712locksmithservicescharlotte.comGoDaddy.com, LLC7 Jan 20248 Jan 20247 Jan 2027
713locksmithservicehopeisland.comHostinger, UAB12 Jan 202413 Mar 202412 Jan 2025
714locksmithservicebiggerawasters.comHostinger, UAB12 Jan 202413 Mar 202412 Jan 2025
715locksmithservicesurfersparadise.comHostinger, UAB12 Jan 202413 Mar 202412 Jan 2025
716locksmithservicesmaryland.comGoDaddy.com, LLC17 Jan 202417 Jan 202417 Jan 2025
717locksmithservicesmb.comGoDaddy.com, LLC19 Jan 202419 Jan 202419 Jan 2027
718locksmithserviceashmore.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
719locksmithserviceburleighheads.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
720locksmithservicemainbeach.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
721locksmithserviceparadisepoint.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
722locksmithservicesouthportgoldcoast.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
723locksmithservicesbiggerawaters.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
724locksmithservicebrooklyn.comNameCheap, Inc.16 Feb 20244 Jul 202416 Feb 2025
725locksmithserviceenglewood.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
726locksmithserviceteaneck.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
727locksmithservicebronx.comNameCheap, Inc.16 Feb 20244 Jul 202416 Feb 2025
728locksmithservicehoboken.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
729locksmithservicenewark.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
730locksmithservicenewyork.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
731locksmithserviceclifton.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
732locksmithservicejerseycity.comNameCheap, Inc.16 Feb 20245 Jun 202416 Feb 2025
733locksmithservicebrighton.comRealtime Register B.V.23 Feb 202428 Feb 202423 Feb 2025
734locksmithservicesliverpool.co.uk-14 Mar 202414 Mar 202414 Mar 2027
735locksmithservicess.comNameCheap, Inc.18 Mar 202421 Mar 202418 Mar 2025
736locksmithservices.ltdPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 202429 Mar 202423 Mar 2025
737locksmithservicesadelaide.comHostinger, UAB14 Apr 202417 Apr 202414 Apr 2025
738locksmithservicesedwardstown.comHostinger, UAB14 Apr 202417 Apr 202414 Apr 2025
739locksmithservices.com.au--24 Oct 2023-
740locksmithservicepaddingtonbrisbane.comRealtime Register B.V.27 Feb 20236 Feb 202427 Feb 2025
741locksmithservicenaples.comInternet Domain Services BS Corp19 Apr 202229 Jun 202419 Apr 2024
742locksmithservicecompanies.comGoDaddy.com, LLC23 Apr 202423 Apr 202423 Apr 2025
743locksmithserviceschelmsford.co.uk-12 Jul 20223 Jul 202312 Jul 2024
744locksmithservicesglenwaverley.comHostinger, UAB7 Jul 20247 Jul 20247 Jul 2025
745locksmithservicesus.todayGoDaddy.com, LLC30 Jul 20244 Aug 202430 Jul 2025
746locksmithservices.shopPDR Ltd. d/b/a PublicDomainRegistry.com17 Aug 202417 Aug 202417 Aug 2025
747locksmithservicesduae.comHostinger, UAB8 Oct 20248 Oct 20248 Oct 2025
748locksmithservicesvictoria.comGoogle, Inc.9 Oct 20249 Oct 20249 Oct 2025
749locksmithservicesgroup.co.uk-16 Oct 202416 Oct 202416 Oct 2025
750locksmithserviceranchocucamonga.info-5 Nov 20245 Nov 20245 Nov 2025
751locksmithservicescalgary.ca-21 Feb 20236 Apr 202421 Feb 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=locksmithservice

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now