Our database now contains whois records of 588 Million (588,419,020) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1573 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [588 Million Domains] $10,000 Details

Keyword: LOCKSMITHSERVICES

Reverse Whois » KEYWORD [locksmithservices ]  { 306 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1locksmithservices.nycGo China Domains, LLC8 Oct 201413 Oct 20177 Oct 2018
2locksmithservices.melbourneCrazy Domains FZ-LLC23 May 201620 May 202423 May 2025
3locksmithservices.sydneyCrazy Domains FZ-LLC10 Mar 2015-10 Mar 2016
4locksmithservices.london1&1 Internet AG25 Apr 20157 Jul 202425 Apr 2024
5locksmithservices.infoNamesilo, LLC11 Feb 202111 Feb 202111 Feb 2022
6locksmithservices.orgAzdomainz LLC14 May 201525 Jun 201714 May 2018
7locksmithservices.miamiYnot Domains Corp.4 Oct 2015-4 Oct 2016
8locksmithservices.comGoDaddy.com, LLC19 Apr 200320 Apr 202419 Apr 2025
9locksmithservices.mobiGoDaddy.com, LLC31 Jan 20161 Feb 201731 Jan 2018
10locksmithservices.netGoDaddy.com, LLC5 Feb 20196 Feb 20245 Feb 2025
11locksmithservices.xyzNameKing.com Inc.13 Oct 202113 Oct 202113 Oct 2022
12locksmithservices.bizDynadot, LLC3 Jun 20203 Jun 20213 Jun 2021
13locksmithservices.sitePDR Ltd. d/b/a PublicDomainRegistry.com26 Sep 202126 Sep 202126 Sep 2022
14locksmithservices.guruNameCheap, Inc.7 Sep 20177 Sep 20177 Sep 2018
15locksmithservices.groupNameCheap, Inc.18 Sep 201718 Sep 201718 Sep 2018
16locksmithservices.me.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Apr 20063 Apr 201610 Apr 2018
17locksmithservices.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Apr 20063 Apr 201610 Apr 2018
18locksmithservices.onlineNameCheap, Inc.15 Nov 202415 Nov 202415 Nov 2025
19locksmithservices.zonePorkbun, LLC24 Apr 201824 Apr 201824 Apr 2019
20locksmithservices.ca-26 Jul 20109 Sep 202426 Jul 2025
21locksmithservices.todayGoDaddy.com, LLC17 Apr 202422 Apr 202417 Apr 2025
22locksmithservices.coNameKing.com Inc.21 Jun 202226 Jun 202321 Jun 2023
23locksmithservices.sbsNamesilo, LLC14 Nov 202114 Nov 202114 Nov 2022
24locksmithservices.agencyNetwork Solutions, LLC13 Mar 20229 Jun 202413 Mar 2025
25locksmithservices.storeCrazy Domains FZ-LLC10 Aug 20227 Aug 202410 Aug 2025
26locksmithservices.companyGoogle, Inc.21 Oct 202221 Oct 202221 Oct 2023
27locksmithservices.clickNamesilo, LLC27 Nov 202230 Jan 202427 Nov 2023
28locksmithservices.ae----
29locksmithservices.monsterNameCheap, Inc.15 Oct 202216 Oct 202315 Oct 2024
30locksmithservices.co.uk-5 Aug 202331 Oct 20245 Aug 2025
31locksmithservices.uk-12 Jan 202216 May 202412 Jan 2025
32locksmithservices.ltdPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 202429 Mar 202423 Mar 2025
33locksmithservices.com.au--24 Oct 2023-
34locksmithservices.shopPDR Ltd. d/b/a PublicDomainRegistry.com17 Aug 202417 Aug 202417 Aug 2025
35locksmithservicessilverspringmd.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
36locksmithservicessanantonio.comGoDaddy.com, LLC28 Oct 202129 Oct 202428 Oct 2025
37locksmithservicesbethesdamd.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
38locksmithservicesphoenix.comNameCheap, Inc.6 Nov 20146 Oct 20246 Nov 2025
39locksmithservicesatlanta.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2025
40locksmithservicestaugustine.comTucows Domains Inc.25 Aug 201030 Aug 201425 Aug 2015
41locksmithservicesseattle.com1&1 Internet AG30 Aug 201430 Aug 201430 Aug 2015
42locksmithservicesqueens.comNameCheap, Inc.16 Feb 20244 Jul 202416 Feb 2025
43locksmithservicesdetroit.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2015
44locksmithservicesdenver.comGoogle, Inc.16 Jan 201921 Apr 202416 Jan 2025
45locksmithserviceswesthempstead.comGoDaddy.com, LLC21 Nov 201421 Nov 201421 Nov 2015
46locksmithservicesfl.comGoDaddy.com, LLC18 Oct 201418 Oct 201418 Oct 2015
47locksmithservicesacramento.netName.com, Inc.24 Nov 201424 Nov 201424 Nov 2015
48locksmithservicesplus.com-19 Feb 202219 Feb 202219 Feb 2023
49locksmithservicessantaana.comeNom, Inc.5 Dec 20145 Dec 20145 Dec 2015
50locksmithservicespring.comDotmedia Limited18 Mar 202328 May 202418 Mar 2024
51locksmithservicespringhill.comeNom, Inc.2 Jan 20152 Jan 20152 Jan 2016
52locksmithserviceshawaii.comGoDaddy.com, LLC4 Jan 20154 Jan 20154 Jan 2016
53locksmithservicespokane.comNetwork Solutions, LLC6 Jan 20156 Jan 20156 Jan 2016
54locksmithservicesantaclarita.comeNom, Inc.20 Jan 201520 Jan 201520 Jan 2016
55locksmithserviceslancaster.mobiTucows Domains Inc.18 Jan 201222 Jan 201518 Jan 2016
56locksmithserviceslancashire.mobiTucows Domains Inc.18 Jan 201222 Jan 201518 Jan 2016
57locksmithserviceslasvegas.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
58locksmithservicesgreenville.comGoDaddy.com, LLC18 Aug 201530 Sep 202018 Aug 2021
59locksmithservicesshawnee.comGoDaddy.com, LLC30 Jan 201530 Jan 201530 Jan 2016
60locksmithservicesdallastx.comeNom, Inc.12 Feb 201512 Feb 201512 Feb 2016
61locksmithservicespro.comGoDaddy.com, LLC21 Aug 201522 Aug 202321 Aug 2025
62locksmithservices1.comTucows Domains Inc.27 Feb 20083 Mar 201527 Feb 2016
63locksmithservicesintexas.comLaunchpad, Inc.4 Mar 20154 Mar 20154 Mar 2016
64locksmithservicesaintlouis.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
65locksmithservicesnearyou.comGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
66locksmithservicesqueens.netGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
67locksmithservicesmanhattan.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
68locksmithserviceslongisland.comGoDaddy.com, LLC26 Aug 201526 Aug 201526 Aug 2017
69locksmithservicesbrooklyn.comName.com, Inc.7 Feb 20177 Feb 20177 Feb 2018
70locksmithservicesbronx.comGoDaddy.com, LLC26 Aug 201527 Aug 201526 Aug 2016
71locksmithservicesnearme.comTLD Registrar Solutions Ltd.22 Mar 201528 Apr 202422 Mar 2025
72locksmithservicesalemor.comeNom, Inc.23 Mar 201523 Mar 201523 Mar 2016
73locksmithserviceswichitaks.comeNom, Inc.27 Mar 201527 Mar 201527 Mar 2016
74locksmithservicescavecreek.comGoDaddy.com, LLC7 Apr 20157 Apr 20157 Apr 2016
75locksmithservicesdunwoody.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20155 Sep 20155 Sep 2016
76locksmithservicestucson.comGoDaddy.com, LLC27 May 201527 May 201527 May 2016
77locksmithservices247.netNetwork Solutions, LLC25 Feb 202425 Feb 202425 Feb 2025
78locksmithservicesranchocucamonga.comGoDaddy.com, LLC3 Jul 20153 Jul 20243 Jul 2025
79locksmithservicesacworth.comGoDaddy.com, LLC24 Sep 201524 Sep 201524 Sep 2016
80locksmithservicesingapore.comNameCheap, Inc.10 Jul 201525 Jun 202410 Jul 2025
81locksmithservicesingeorgetownde.comeNom, Inc.24 Jul 201524 Jul 201524 Jul 2016
82locksmithservicesphiladelphia.comGoDaddy.com, LLC30 Jul 201530 Jul 201530 Jul 2016
83locksmithserviceshoustontx.comGoDaddy.com, LLC31 Jul 20151 Aug 202331 Jul 2025
84locksmithservicesouthwest.comTucows Domains Inc.18 Oct 200922 Oct 201518 Oct 2016
85locksmithservicesmilfordct.comeNom, Inc.18 Nov 20157 Apr 201718 Nov 2017
86locksmithserviceslosangeles.comGoDaddy.com, LLC20 Nov 201521 Jun 202420 Nov 2025
87locksmithservicesinlongbeachca.comeNom, Inc.1 Dec 20151 Dec 20151 Dec 2016
88locksmithserviceshermanoaks.comGoDaddy.com, LLC7 Dec 20157 Dec 20157 Dec 2016
89locksmithservicesavannahga.comeNom, Inc.15 Dec 201515 Dec 201515 Dec 2016
90locksmithservicesorangecounty.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2018
91locksmithservicescolumbus.comGoDaddy.com, LLC13 Jan 201613 Jan 201613 Jan 2017
92locksmithservicesmiami.comDynadot, LLC14 Nov 202014 Nov 202014 Nov 2021
93locksmithservicesaltlakecityut.comGoDaddy.com, LLC26 Jan 201626 Jan 201626 Jan 2017
94locksmithservicesforall.com35 Technology Co., Ltd.27 Apr 20226 Jul 202327 Apr 2023
95locksmithservicesmiamifl.comeNom, Inc.1 Mar 20161 Mar 20161 Mar 2017
96locksmithservicesmarietta.comGoDaddy.com, LLC22 Mar 201622 Mar 202422 Mar 2025
97locksmithserviceshoustontexas.comGoDaddy.com, LLC23 Mar 201624 Mar 202423 Mar 2026
98locksmithservicestx.comDomain.com, LLC20 Oct 202223 Oct 202420 Oct 2024
99locksmithservicestpaul.comLaunchpad, Inc.29 Mar 201614 Mar 202429 Mar 2025
100locksmithservicesjacksonville.comregister.com, Inc.25 May 201626 May 202425 May 2025
101locksmithservicesinc.xyzNameCheap, Inc.21 May 201610 Jun 201621 May 2017
102locksmithservicestroy.comNameCheap, Inc.30 Sep 201430 Aug 202430 Sep 2025
103locksmithservices-24h.comInternet Domain Services BS Corp19 Jul 201620 Jul 201719 Jul 2017
104locksmithservicesslc.xyzNameCheap, Inc.28 Jul 20165 Aug 201628 Jul 2017
105locksmithservicesdesmoines.comeNom, Inc.14 Mar 201328 Feb 201714 Mar 2018
106locksmithservicesandiegoca.comeNom, Inc.17 Aug 201629 Sep 201717 Aug 2017
107locksmithservices247.comGoDaddy.com, LLC23 Feb 200824 Feb 202423 Feb 2025
108locksmithservicesvancouver.comGoDaddy.com, LLC6 Jul 20117 Jul 20166 Jul 2017
109locksmithservicesedmonton.comGoDaddy.com, LLC19 Feb 201422 Sep 201519 Feb 2017
110locksmithservicesinc.comGoDaddy.com, LLC20 May 20088 Jul 202420 May 2025
111locksmithservices24-7.comAmazon Registrar, Inc.12 Dec 20069 Nov 202312 Dec 2024
112locksmithserviceslocksmithshops.comWild West Domains, LLC22 Dec 200723 Dec 201522 Dec 2016
113locksmithservicestoronto.comGoDaddy.com, LLC29 May 201929 May 201929 May 2020
114locksmithservicesnyc.comGoDaddy.com, LLC8 Mar 20248 Mar 20248 Mar 2027
115locksmithserviceshuntsville.comNameCheap, Inc.10 Jun 201419 Jul 202410 Jun 2025
116locksmithservicescarborough.comGoDaddy.com, LLC27 Jan 201228 Jan 202427 Jan 2026
117locksmithserviceseverett.comChengdu West Dimension Digital Technology Co., Ltd…31 May 201831 May 201831 May 2019
118locksmithservicescottsdale.comGoDaddy.com, LLC31 May 20131 Jun 201631 May 2017
119locksmithservicesd.comregister.com, Inc.9 Apr 20149 Apr 20149 Apr 2018
120locksmithserviceslansing.comTucows Domains Inc.3 Dec 20107 Dec 20173 Dec 2017
121locksmithservicesfortmyers.comNameCheap, Inc.25 Jun 201425 May 202425 Jun 2025
122locksmithservicesandiego.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
123locksmithserviceskennesaw.comGoDaddy.com, LLC2 Jul 20133 Jul 20242 Jul 2025
124locksmithserviceswoodbridge.comGoDaddy.com, LLC30 Mar 201422 Sep 201530 Mar 2017
125locksmithservicesacramento.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
126locksmithserviceshouston.comGoDaddy.com, LLC2 Jan 20143 Jan 20242 Jan 2025
127locksmithserviceskaty.comregister.com, Inc.11 Apr 201311 Apr 201311 Apr 2017
128locksmithservices-naples.comregister.com, Inc.3 Sep 20135 Sep 20163 Sep 2017
129locksmithservicesinmiami.comNameCheap, Inc.18 Apr 201219 Mar 202418 Apr 2025
130locksmithserviceshome.comregister.com, Inc.1 Nov 201311 Jan 20161 Nov 2016
131locksmithservicessandiego.comeNom, Inc.4 Aug 20147 Aug 20164 Aug 2016
132locksmithservicesqueensny.comregister.com, Inc.2 Aug 20137 Sep 20162 Aug 2017
133locksmithservicesofindiana.comDomain.com, LLC22 Jul 201329 Jul 202422 Jul 2029
134locksmithservicesnorcross.comGoDaddy.com, LLC25 Feb 201425 Feb 202425 Feb 2025
135locksmithservicesscarborough.comGoDaddy.com, LLC7 Jul 20128 Jul 20167 Jul 2017
136locksmithservicesrichmond.comGoDaddy.com, LLC16 Sep 201328 Oct 201516 Sep 2016
137locksmithservicestlouis.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED17 Nov 201817 Nov 201817 Nov 2019
138locksmithservicessingapore.comPSI-USA, Inc. dba Domain Robot15 Nov 202015 Nov 202015 Nov 2021
139locksmithservicesmd.comGoDaddy.com, LLC11 Jan 20108 Apr 202411 Jan 2026
140locksmithservices-sanantonio.comGoDaddy.com, LLC23 Apr 201323 Apr 202423 Apr 2025
141locksmithservicesoftyler.comNetwork Solutions, LLC18 Aug 200718 Jun 202218 Aug 2027
142locksmithservicesjerseycity.comGoDaddy.com, LLC6 Aug 20137 Aug 20166 Aug 2017
143locksmithserviceswinstonsalemnc.comregister.com, Inc.24 Jan 201424 Jan 201424 Jan 2018
144locksmithservicesuk.comFreeparking Domain Registrars, Inc.23 Jan 200722 May 201523 Jan 2022
145locksmithservicestpetersburg.comeNom, Inc.25 Jul 201426 Jun 201525 Jul 2017
146locksmithservicesdover.comeNom, Inc.25 Jul 201429 Aug 201625 Jul 2017
147locksmithservicesanfrancisco.comeNom, Inc.5 Jan 20147 Dec 20235 Jan 2025
148locksmithservicesbuffalo.comregister.com, Inc.30 Sep 201430 Sep 201430 Sep 2016
149locksmithservicesd.netregister.com, Inc.9 Apr 20149 Apr 20149 Apr 2018
150locksmithservicesoftyler.netTucows Domains Inc.24 Jun 201328 Jun 201724 Jun 2017
151locksmithservicestoronto.netGoDaddy.com, LLC7 Jul 20128 Jul 20167 Jul 2017
152locksmithservicesanjose.netregister.com, Inc.27 Mar 201427 Mar 201427 Mar 2021
153locksmithserviceshouston.netGoDaddy.com, LLC2 Jan 20143 Jan 20242 Jan 2025
154locksmithservicesandiego.netregister.com, Inc.27 Mar 201427 Mar 201427 Mar 2021
155locksmithservicesunnyside.comTucows Domains Inc.24 Oct 201628 Oct 201724 Oct 2017
156locksmithservicesinca.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
157locksmithservicesca.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
158locksmithserviceseattle.comGoDaddy.com, LLC27 Oct 201628 Oct 202427 Oct 2025
159locksmithservicesinny.comeNom, Inc.27 Oct 201628 Sep 201727 Oct 2018
160locksmithservicesny.comNameCheap, Inc.16 Jan 2020-16 Jan 2021
161locksmithservicesatl.comTucows Domains Inc.12 Nov 201616 Nov 201712 Nov 2017
162locksmithservicesincharlottenc.comeNom, Inc.27 Nov 201627 Nov 201627 Nov 2018
163locksmithservicesnearby.comGoDaddy.com, LLC10 Apr 202410 Apr 202410 Apr 2025
164locksmithservices4u.comGoDaddy.com, LLC13 Dec 201614 Dec 202213 Dec 2024
165locksmithservicesroswell.comGoDaddy.com, LLC20 Jan 201715 May 202420 Jan 2025
166locksmithserviceskensington.comTucows Domains Inc.7 Feb 201711 Feb 20197 Feb 2019
167locksmithservicescardiff.comeNom, Inc.16 Feb 201721 Jan 201816 Feb 2018
168locksmithservicesllc.comGoDaddy.com, LLC15 Oct 202016 Oct 202415 Oct 2025
169locksmithservicesboise.comGoDaddy.com, LLC7 Mar 20177 Mar 20177 Mar 2018
170locksmithservicesblog.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Mar 201724 May 201724 Mar 2018
171locksmithservicesalem.comName.com, Inc.11 May 201712 Apr 202411 May 2025
172locksmithservicesoftware.comGoDaddy.com, LLC7 Jun 20177 Jun 20177 Jun 2018
173locksmithservicesincardiff.comeNom, Inc.3 Jul 201711 Jun 20243 Jul 2025
174locksmithserviceshillsboro.comName.com, Inc.18 Jul 201726 Sep 201718 Jul 2018
175locksmithservices24h.menNameCheap, Inc.1 Nov 20176 Nov 20171 Nov 2018
176locksmithservices24hr.menNameCheap, Inc.1 Nov 20171 Nov 20171 Nov 2018
177locksmithservices24hr.techNameCheap, Inc.16 Nov 201716 Nov 201716 Nov 2018
178locksmithservicescoppell.comName.com, Inc.21 Nov 201721 Nov 201721 Nov 2018
179locksmithserviceslancaster.comFastDomain Inc.3 Jan 201818 Dec 20233 Jan 2025
180locksmithservicescardiff.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…22 Sep 201622 Sep 201622 Sep 2018
181locksmithserviceslondon.co.uk-18 Dec 201520 Aug 202418 Dec 2025
182locksmithservicesbirmingham.co.uk-29 Jul 201523 May 201729 Jul 2018
183locksmithservicesgrimsby.co.uk-3 Nov 20085 Oct 20243 Nov 2026
184locksmithservicesouthampton.co.uk-10 Jan 201726 Dec 201710 Jan 2019
185locksmithservicestwickenham.co.uk-25 Feb 201327 Dec 201725 Feb 2018
186locksmithservicessheffield.co.ukHello Internet Corp.15 May 201415 May 201715 May 2018
187locksmithservicesbirmingham.comeNom, Inc.9 Jan 20189 Jan 20189 Jan 2019
188locksmithservicesessex.co.uk-7 Oct 20134 Aug 20177 Oct 2020
189locksmithservicesportland.comName.com, Inc.30 Jan 201830 Jan 201830 Jan 2019
190locksmithservices06.comNetwork Solutions, LLC2 Mar 20182 Mar 20182 Mar 2020
191locksmithservicesummerhill.comTucows Domains Inc.7 Mar 201811 Mar 20197 Mar 2019
192locksmithservicesbirminghamal.comTucows Domains Inc.14 Mar 201817 Jun 202414 Mar 2025
193locksmithserviceschicago.comGoDaddy.com, LLC7 Jun 20187 Jun 20187 Jun 2019
194locksmithservicesedmonton.ca-19 Feb 20145 Apr 201919 Feb 2020
195locksmithservicesforyou.comeNom, Inc.5 Apr 20185 Apr 20185 Apr 2019
196locksmithservicesvaughan.comTucows Domains Inc.14 May 201818 May 201914 May 2019
197locksmithservicesbarrie.comTucows Domains Inc.14 May 201818 May 201914 May 2019
198locksmithservicesinwoodstock.comNetwork Solutions, LLC26 May 201826 May 201826 May 2019
199locksmithservicesinroswell.comNetwork Solutions, LLC26 May 201826 May 201826 May 2019
200locksmithservicesinburbank.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
201locksmithservicesinglendale.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
202locksmithservicesinsantaclarita.comGoDaddy.com, LLC31 May 201831 May 201831 May 2019
203locksmithservicesinhollywood.comGoDaddy.com, LLC1 Jun 20181 Jun 20181 Jun 2019
204locksmithserviceswildwood.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
205locksmithservicesummerfield.comTucows Domains Inc.7 Jun 201811 Jun 20197 Jun 2019
206locksmithservicesgroup.comGoDaddy.com, LLC7 Jun 202112 Jun 20237 Jun 2025
207locksmithserviceswi.comGoDaddy.com, LLC20 Nov 201820 Nov 201820 Nov 2020
208locksmithservices247.clubNameCheap, Inc.24 Dec 201824 Dec 201824 Dec 2019
209locksmithservicescoloradosprings.usNameCheap, Inc.21 Jul 202221 Jul 202321 Jul 2023
210locksmithservicesgta.comGoDaddy.com, LLC3 Aug 20216 Aug 20213 Aug 2022
211locksmithserviceslondon.comGoDaddy.com, LLC12 Mar 20191 Aug 202412 Mar 2025
212locksmithservices-in-fr.comKey-Systems GmbH9 Apr 20199 Apr 20199 Apr 2020
213locksmithservices-in-us.comKey-Systems GmbH9 Apr 20199 Apr 20199 Apr 2020
214locksmithserviceselginmills.comTucows Domains Inc.23 Apr 201927 Apr 202023 Apr 2020
215locksmithservicesintoronto.ca-23 Dec 201524 Dec 202223 Dec 2024
216locksmithservicespreston.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jul 20193 Jul 20193 Jul 2020
217locksmithservicesnow.comNameCheap, Inc.6 Jul 2019-6 Jul 2020
218locksmithservicescallnow.comNameCheap, Inc.16 Jul 2019-16 Jul 2020
219locksmithservicesandsecurity.comeNom, Inc.4 Oct 20194 Oct 20194 Oct 2020
220locksmithservices24.comFastDomain Inc.1 Dec 201916 Nov 20241 Dec 2025
221locksmithserviceshop.comNameCheap, Inc.1 Dec 2019-1 Dec 2020
222locksmithservicesla.comGoDaddy.com, LLC23 Feb 202024 Feb 202423 Feb 2025
223locksmithserviceseagan.comName.com, Inc.26 Feb 202026 Feb 202026 Feb 2021
224locksmithservicesisrael.comNameCheap, Inc.22 Mar 202021 Feb 202422 Mar 2025
225locksmithserviceshome.infoGoDaddy.com, LLC18 May 202018 May 202018 May 2021
226locksmithserviceslongmont.comGoogle, Inc.16 Jan 201921 May 202416 Jan 2025
227locksmithservicesanjose.comGoDaddy.com, LLC8 Jul 20208 Jul 20208 Jul 2021
228locksmithservicesonline.comGoDaddy.com, LLC23 Jul 202023 Jul 202423 Jul 2025
229locksmithservicesgateshead.xyzNameCheap, Inc.24 Jul 202013 Nov 202424 Jul 2025
230locksmithservicesoftyler1.comName.com, Inc.9 Sep 20209 Sep 20209 Sep 2021
231locksmithservicesoftyler2.comName.com, Inc.10 Sep 202010 Sep 202010 Sep 2021
232locksmithservicesbayarea.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
233locksmithservicespaloalto.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
234locksmithservicessanmateo.comGoDaddy.com, LLC16 Sep 202028 Oct 202416 Sep 2024
235locksmithservicesincs.com1&1 Internet AG13 Oct 202013 Oct 202013 Oct 2021
236locksmithserviceschampaignil.comGoDaddy.com, LLC17 Oct 20202 Nov 202217 Oct 2030
237locksmithservicesllc.coGoDaddy.com, LLC31 Oct 202016 Aug 202131 Oct 2021
238locksmithservicescollc.comGoDaddy.com, LLC5 Jan 20245 Jan 20245 Jan 2025
239locksmithservicespros.comNameCheap, Inc.16 May 20206 May 202416 May 2025
240locksmithservicesca.siteDOTSERVE INC.22 Apr 20197 Jul 202022 Apr 2021
241locksmithservicesilnet.comKey-Systems GmbH12 Jan 202112 Jan 202112 Jan 2022
242locksmithservicesdallas.comDynadot, LLC12 Mar 202112 Mar 202112 Mar 2022
243locksmithservicesusa.comGoDaddy.com, LLC4 May 20215 May 20244 May 2025
244locksmithservicesit.spaceDOTSERVE INC.29 Jun 20219 May 202229 Jun 2024
245locksmithservicesusanet.comKey-Systems GmbH2 Aug 20212 Aug 20212 Aug 2022
246locksmithservicesforever.comNameCheap, Inc.14 Aug 2021-14 Aug 2022
247locksmithservicesinwashingtondc.comFastDomain Inc.26 Aug 202126 Aug 202126 Aug 2022
248locksmithservicesspring.comNameCheap, Inc.27 Sep 202128 Aug 202427 Sep 2025
249locksmithservicesukweb.comKey-Systems GmbH8 Oct 20218 Oct 20218 Oct 2022
250locksmithserviceswebuk.comKey-Systems GmbH7 Jan 20227 Jan 20227 Jan 2023
251locksmithservicescan.comNamesilo, LLC26 Jan 202227 Jan 202226 Jan 2023
252locksmithservicesbrighton.comWild West Domains, LLC20 Aug 202230 Sep 202320 Aug 2023
253locksmithservices24hr.sbsNamesilo, LLC28 Aug 202228 Aug 202228 Aug 2023
254locksmithservicesinit.spaceDOTSERVE INC.8 Sep 20228 Sep 20228 Sep 2023
255locksmithservicesus.comAbove.com Pty Ltd.3 Oct 202213 Dec 20233 Oct 2023
256locksmithservices-uk.siteDOTSERVE INC.11 Oct 202211 Oct 202211 Oct 2023
257locksmithservicesokc.comGoDaddy.com, LLC27 Dec 201816 Oct 202227 Dec 2026
258locksmithservicesaurora.comGoDaddy.com, LLC19 Oct 202219 Oct 202219 Oct 2027
259locksmithservicesink.comDomain.com, LLC19 Oct 202222 Oct 202419 Oct 2024
260locksmithservicesmn.comGoDaddy.com, LLC29 Oct 20229 Nov 202429 Oct 2025
261locksmithservicesydney.onlineCrazy Domains FZ-LLC16 Dec 202222 Dec 202316 Dec 2024
262locksmithservices247.co.ukDynadot, LLC26 Dec 202227 Dec 202326 Dec 2023
263locksmithserviceslondon247.co.uk-28 Dec 20229 Feb 202428 Dec 2024
264locksmithservicestouffville.comHostinger, UAB8 Jan 202317 Feb 20248 Jan 2024
265locksmithservices24hours.buzzNameKing.com Inc.17 Jan 202222 Jan 202217 Jan 2023
266locksmithservices24hr.buzzNameKing.com Inc.17 Jan 202222 Jan 202217 Jan 2023
267locksmithservices-bayarea.comGoDaddy.com, LLC26 Jan 202326 Jan 202326 Jan 2025
268locksmithservices24h.buzzNameKing.com Inc.6 Jul 20226 Aug 20236 Jul 2023
269locksmithservices247.buzzNamesilo, LLC14 Oct 202217 Nov 202314 Oct 2023
270locksmithservicesydneyservice.comWild West Domains, LLC30 Jan 202312 Mar 202430 Jan 2024
271locksmithservicesindc.comGoDaddy.com, LLC2 Aug 201713 Sep 20232 Aug 2023
272locksmithservicesboulder.comGoogle, Inc.16 Jan 201923 Apr 202416 Jan 2025
273locksmithservicesaz.comGoDaddy.com, LLC5 May 202116 Jun 20235 May 2023
274locksmithservicesunnybank.comWild West Domains, LLC1 Apr 202313 Apr 20241 Apr 2025
275locksmithservicesfriendswood.comGoDaddy.com, LLC27 Sep 202128 Sep 202427 Sep 2025
276locksmithservicesrichardson.comGoDaddy.com, LLC27 Sep 202128 Sep 202427 Sep 2025
277locksmithservicesbaltimore.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
278locksmithservicespringtx.comGoDaddy.com, LLC5 Oct 20216 Oct 20245 Oct 2025
279locksmithservicesatlantaga.comGoDaddy.com, LLC24 Nov 202125 Nov 202324 Nov 2024
280locksmithservicesboston.comPorkbun, LLC28 Sep 202428 Sep 202428 Sep 2025
281locksmithserviceschelmsford.comGoDaddy.com, LLC13 Jul 202224 Aug 202413 Jul 2024
282locksmithserviceslongmont.orgGoogle, Inc.16 Dec 201926 Apr 202416 Dec 2024
283locksmithservicesbalwyn.comHostinger, UAB16 May 202325 Jun 202416 May 2024
284locksmithservicesmississauga.comWild West Domains, LLC24 May 20235 Aug 202424 May 2024
285locksmithservices-it.spaceDOTSERVE INC.27 Jun 20233 Aug 202427 Jun 2024
286locksmithservicesfast.comGoogle, Inc.18 Jul 202317 Sep 202418 Jul 2024
287locksmithservicesarc.comPorkbun, LLC20 Nov 202320 Nov 202320 Nov 2024
288locksmithserviceslanecovesydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
289locksmithserviceswestmeadsydney.comHosting Concepts B.V. dba Openprovider29 Dec 202317 Aug 202429 Dec 2024
290locksmithservicescharlotte.comGoDaddy.com, LLC7 Jan 20248 Jan 20247 Jan 2027
291locksmithservicesurfersparadise.comHostinger, UAB12 Jan 202413 Mar 202412 Jan 2025
292locksmithservicesmaryland.comGoDaddy.com, LLC17 Jan 202417 Jan 202417 Jan 2025
293locksmithservicesmb.comGoDaddy.com, LLC19 Jan 202419 Jan 202419 Jan 2027
294locksmithservicesouthportgoldcoast.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
295locksmithservicesbiggerawaters.comHostinger, UAB7 Feb 20248 Apr 20247 Feb 2025
296locksmithservicesliverpool.co.uk-14 Mar 202414 Mar 202414 Mar 2027
297locksmithservicess.comNameCheap, Inc.18 Mar 202421 Mar 202418 Mar 2025
298locksmithservicesadelaide.comHostinger, UAB14 Apr 202417 Apr 202414 Apr 2025
299locksmithservicesedwardstown.comHostinger, UAB14 Apr 202417 Apr 202414 Apr 2025
300locksmithserviceschelmsford.co.uk-12 Jul 20223 Jul 202312 Jul 2024
301locksmithservicesglenwaverley.comHostinger, UAB7 Jul 20247 Jul 20247 Jul 2025
302locksmithservicesus.todayGoDaddy.com, LLC30 Jul 20244 Aug 202430 Jul 2025
303locksmithservicesduae.comHostinger, UAB8 Oct 20248 Oct 20248 Oct 2025
304locksmithservicesvictoria.comGoogle, Inc.9 Oct 20249 Oct 20249 Oct 2025
305locksmithservicesgroup.co.uk-16 Oct 202416 Oct 202416 Oct 2025
306locksmithservicescalgary.ca-21 Feb 20236 Apr 202421 Feb 2025

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=locksmithservices

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now