With support for 
Keyword: MALPRACTICE
Reverse Whois » KEYWORD [malpractice ] { 1,865 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | malpractice.pw | Alpnames Limited | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 2 | malpractice.me | GoDaddy.com, LLC | 9 Jul 2008 | 23 Jun 2017 | 9 Jul 2018 |
| 3 | malpractice.today | GoDaddy.com, LLC | 17 Jul 2014 | 31 Aug 2024 | 17 Jul 2026 |
| 4 | malpractice.dental | GoDaddy.com, LLC | 17 May 2017 | 24 Jul 2024 | 17 May 2025 |
| 5 | malpractice.clinic | Tucows Domains Inc. | 13 Aug 2014 | 17 Aug 2015 | 13 Aug 2016 |
| 6 | malpractice.partners | NameCheap, Inc. | 20 Mar 2022 | 4 Apr 2023 | 20 Mar 2024 |
| 7 | malpractice.associates | Dynadot, LLC | 17 Aug 2014 | 17 Aug 2014 | 17 Aug 2015 |
| 8 | malpractice.insure | NameCheap, Inc. | 6 Dec 2023 | 11 Nov 2024 | 6 Dec 2025 |
| 9 | malpractice.lawyer | eNom, Inc. | 8 Oct 2014 | 21 Sep 2024 | 8 Oct 2025 |
| 10 | malpractice.nyc | GoDaddy.com, LLC | 4 Nov 2014 | 9 Nov 2024 | 3 Nov 2026 |
| 11 | malpractice.healthcare | GoDaddy.com, LLC | 17 May 2017 | 28 Jun 2023 | 17 May 2023 |
| 12 | malpractice.vegas | eNom, Inc. | 2 Jun 2014 | 11 May 2017 | 2 Jun 2018 |
| 13 | malpractice.attorney | eNom, Inc. | 8 Oct 2014 | 21 Sep 2024 | 8 Oct 2025 |
| 14 | malpractice.click | GoDaddy.com, LLC | 5 Feb 2015 | 19 Mar 2017 | 5 Feb 2017 |
| 15 | malpractice.top | GMO Internet Inc. | 10 Nov 2016 | 25 Feb 2017 | 10 Nov 2017 |
| 16 | malpractice.directory | GoDaddy.com, LLC | 17 May 2017 | 24 Jul 2024 | 17 May 2025 |
| 17 | malpractice.link | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 18 | malpractice.help | Uniregistrar Corp | 18 Mar 2015 | 23 Feb 2017 | 18 Mar 2018 |
| 19 | malpractice.legal | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 20 | malpractice.space | 1&1 Internet AG | 17 Mar 2019 | 16 Apr 2024 | 17 Mar 2025 |
| 21 | malpractice.website | Porkbun, LLC | 13 Jun 2019 | 12 Jun 2024 | 13 Jun 2025 |
| 22 | malpractice.asia | BigRock Solutions Ltd. | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 23 | malpractice.miami | Go France Domains, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 24 | malpractice.win | Dynadot, LLC | 26 Nov 2018 | 26 Nov 2018 | 26 Nov 2019 |
| 25 | malpractice.work | GoDaddy.com, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 26 | malpractice.law | GoDaddy.com, LLC | 8 Feb 2022 | 9 Feb 2025 | 8 Feb 2026 |
| 27 | malpractice.guru | GoDaddy.com, LLC | 8 Aug 2019 | 5 Apr 2020 | 8 Aug 2020 |
| 28 | malpractice.team | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 29 | malpractice.com | GoDaddy.com, LLC | 12 Feb 1995 | 27 Apr 2024 | 13 Feb 2031 |
| 30 | malpractice.world | Cronon AG | 17 Apr 2016 | 17 Apr 2016 | 17 Apr 2017 |
| 31 | malpractice.fyi | GoDaddy.com, LLC | 6 Jul 2018 | 6 Jul 2018 | 6 Jul 2019 |
| 32 | malpractice.cloud | - | 29 Jun 2023 | 12 Aug 2024 | 29 Jun 2024 |
| 33 | malpractice.group | Dynadot, LLC | 10 Nov 2020 | 12 Oct 2024 | 10 Nov 2025 |
| 34 | malpractice.in | - | 4 Jun 2009 | 5 May 2016 | 4 Jun 2018 |
| 35 | malpractice.solutions | GoDaddy.com, LLC | 28 Mar 2014 | 9 Apr 2023 | 28 Mar 2024 |
| 36 | malpractice.agency | GoDaddy.com, LLC | 6 Mar 2017 | 29 Sep 2017 | 6 Mar 2018 |
| 37 | malpractice.wiki | Uniregistrar Corp | 7 Jun 2014 | 5 Jun 2015 | 7 Jun 2017 |
| 38 | malpractice.reviews | Go Canada Domains, LLC | 4 Jun 2014 | 19 Jul 2024 | 4 Jun 2025 |
| 39 | malpractice.london | united-domains AG | 9 Sep 2014 | 9 Sep 2015 | 9 Sep 2016 |
| 40 | malpractice.biz | Moniker Online Services LLC | 27 Mar 2002 | 24 Oct 2024 | 26 Mar 2025 |
| 41 | malpractice.info | Network Solutions, LLC | 13 Jul 2002 | 19 May 2023 | 13 Jul 2025 |
| 42 | malpractice.net | Epik Inc. | 2 Jan 2013 | 9 Jan 2020 | 2 Jan 2026 |
| 43 | malpractice.org | Dynadot, LLC | 28 Jul 2004 | 6 Jul 2024 | 28 Jul 2025 |
| 44 | malpractice.us | GoDaddy.com, LLC | 11 Jul 2013 | 8 Jul 2024 | 10 Jul 2025 |
| 45 | malpractice.xyz | Dynadot, LLC | 20 Jan 2020 | 14 Jun 2024 | 20 Jan 2026 |
| 46 | malpractice.bz | Network Solutions, LLC | 16 Aug 2006 | 15 Aug 2017 | 16 Aug 2018 |
| 47 | malpractice.club | GoDaddy.com, LLC | 17 Jul 2014 | 22 Jul 2024 | 16 Jul 2026 |
| 48 | malpractice.de | - | - | 23 May 2017 | - |
| 49 | malpractice.eu | - | - | - | - |
| 50 | malpractice.kr | - | 18 Aug 2011 | 22 Jan 2015 | 18 Aug 2018 |
| 51 | malpractice.it | - | 2 Jul 2001 | 16 Aug 2024 | 31 Jul 2025 |
| 52 | malpractice.pro | Tucows Domains Inc. | 10 May 2019 | 14 May 2024 | 10 May 2025 |
| 53 | malpractice.press | NameCheap, Inc. | 8 Nov 2016 | 14 Dec 2017 | 8 Nov 2017 |
| 54 | malpractice.online | Chengdu West Dimension Digital Technology Co., Ltd… | 7 Apr 2021 | 12 Jul 2024 | 7 Apr 2025 |
| 55 | malpractice.wtf | NameCheap, Inc. | 16 Sep 2021 | 16 Sep 2021 | 16 Sep 2022 |
| 56 | malpractice.co | GoDaddy.com, LLC | 2 Sep 2010 | 28 Aug 2017 | 1 Sep 2018 |
| 57 | malpractice.report | GoDaddy.com, LLC | 17 May 2017 | 28 Jun 2023 | 17 May 2023 |
| 58 | malpractice.support | GoDaddy.com, LLC | 17 May 2017 | 28 Jun 2023 | 17 May 2023 |
| 59 | malpractice.network | Gandi SAS | 11 Feb 2025 | 11 Feb 2025 | 11 Feb 2026 |
| 60 | malpractice.zone | GoDaddy.com, LLC | 17 May 2017 | 29 Sep 2017 | 17 May 2018 |
| 61 | malpractice.exposed | GoDaddy.com, LLC | 6 Jun 2017 | 6 Jun 2023 | 6 Jun 2024 |
| 62 | malpractice.business | NameCheap, Inc. | 8 Jun 2017 | 29 Sep 2017 | 8 Jun 2018 |
| 63 | malpractice.chat | GoDaddy.com, LLC | 17 Sep 2017 | 16 Nov 2024 | 17 Sep 2024 |
| 64 | malpractice.institute | Google, Inc. | 17 Sep 2017 | 17 Sep 2017 | 17 Sep 2018 |
| 65 | malpractice.co.uk | - | 17 Oct 2021 | 13 Jan 2025 | 17 Oct 2025 |
| 66 | malpractice.org.uk | LCN.COM Ltd. | 20 Mar 2014 | 20 Mar 2014 | 20 Mar 2019 |
| 67 | malpractice.media | GoDaddy.com, LLC | 22 Mar 2018 | 22 Mar 2018 | 22 Mar 2019 |
| 68 | malpractice.guide | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 69 | malpractice.expert | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 70 | malpractice.care | GoDaddy.com, LLC | 20 Nov 2018 | 20 Nov 2018 | 20 Nov 2019 |
| 71 | malpractice.doctor | GoDaddy.com, LLC | 13 Aug 2021 | 27 Sep 2024 | 13 Aug 2025 |
| 72 | malpractice.center | NameKing.com Inc. | 31 May 2024 | 17 Oct 2024 | 31 May 2025 |
| 73 | malpractice.international | Gabia, Inc. | 1 Dec 2019 | 1 Dec 2019 | 1 Dec 2021 |
| 74 | malpractice.site | 1&1 Internet AG | 17 Mar 2019 | 31 Aug 2023 | 17 Mar 2031 |
| 75 | malpractice.tv | Network Solutions, LLC | 10 May 2022 | 28 May 2024 | 10 May 2025 |
| 76 | malpractice.direct | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 77 | malpractice.claims | Super Registry Inc. | 26 Feb 2022 | 11 Apr 2024 | 26 Feb 2025 |
| 78 | malpractice.tech | NameCheap, Inc. | 5 Aug 2022 | 15 Nov 2024 | 5 Aug 2025 |
| 79 | malpractice.one | Name.com, Inc. | 15 Mar 2024 | 12 Nov 2024 | 15 Mar 2025 |
| 80 | malpractice.abogado | 101domain, Inc. | 2 Sep 2016 | 9 Jul 2024 | 2 Sep 2025 |
| 81 | malpractice.life | GoDaddy.com, LLC | 18 Jan 2023 | 30 Mar 2024 | 18 Jan 2024 |
| 82 | malpractice.charity | NameCheap, Inc. | 22 Feb 2023 | 4 Apr 2024 | 22 Feb 2024 |
| 83 | malpractice.news | NameCheap, Inc. | 27 Dec 2020 | 8 Mar 2024 | 27 Dec 2023 |
| 84 | malpractice.uk | - | 20 Mar 2020 | 2 Jun 2024 | 20 Mar 2025 |
| 85 | malpractice.esq | Google, Inc. | 9 May 2023 | 23 Jun 2024 | 9 May 2025 |
| 86 | malpractice.cam | - | 26 Sep 2023 | 6 Dec 2024 | 26 Sep 2025 |
| 87 | malpractice.io | Dynadot, LLC | 15 Apr 2016 | 14 Aug 2023 | 15 Apr 2025 |
| 88 | malpractice.movie | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 2 Nov 2023 | 4 Nov 2024 | 2 Nov 2025 |
| 89 | malpractice.nl | - | 3 Apr 2006 | 11 Oct 2022 | - |
| 90 | malpractice.ru | - | 19 Nov 2015 | - | 19 Nov 2025 |
| 91 | malpractice.observer | NameCheap, Inc. | 25 Jul 2024 | 30 Jul 2024 | 25 Jul 2025 |
| 92 | malpractice.band | GoDaddy.com, LLC | 15 Oct 2024 | 20 Oct 2024 | 15 Oct 2029 |
| 93 | malpractice.app | NameCheap, Inc. | 1 Jan 2025 | 6 Jan 2025 | 1 Jan 2026 |
| 94 | malpracticelawyercalifornia.com | NameCheap, Inc. | 29 Nov 2022 | 2 Dec 2024 | 29 Nov 2025 |
| 95 | malpracticelawdetroit.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 96 | malpracticedata.com | NameCheap, Inc. | 23 Jan 2022 | - | 23 Jan 2023 |
| 97 | malpracticesupport.ws | - | - | - | - |
| 98 | malpracticesupport.com | GoDaddy.com, LLC | 12 Apr 2022 | 24 May 2024 | 12 Apr 2024 |
| 99 | malpracticesupport.org | GoDaddy.com, LLC | 12 Apr 2022 | 24 May 2024 | 12 Apr 2024 |
| 100 | malpracticesupport.net | GoDaddy.com, LLC | 26 Jul 2017 | 4 Oct 2022 | 26 Jul 2027 |
| 101 | malpracticesupport.tv | GoDaddy.com, LLC | 22 May 2005 | 23 May 2015 | 22 May 2016 |
| 102 | malpracticesupport.name | - | - | - | - |
| 103 | malpracticesupport.info | GoDaddy.com, LLC | 22 May 2005 | 22 May 2015 | 22 May 2016 |
| 104 | malpracticeattorneysflorida.com | GoDaddy.com, LLC | 4 Jun 2012 | 9 Jun 2015 | 4 Jun 2016 |
| 105 | malpracticesettlementlawyer.com | GoDaddy.com, LLC | 6 Jun 2012 | 6 Jun 2015 | 6 Jun 2016 |
| 106 | malpracticeusa.com | NameCheap, Inc. | 19 Jul 2022 | 30 Sep 2023 | 19 Jul 2023 |
| 107 | malpracticeinsurancequotes.com | GoDaddy.com, LLC | 24 Jan 2018 | 24 Jan 2025 | 24 Jan 2026 |
| 108 | malpracticelawyer.biz | Namesilo, LLC | 12 Jan 2006 | 16 Nov 2018 | 11 Jan 2020 |
| 109 | malpracticeinsurers.com | eNom, Inc. | 27 Apr 2009 | 22 Apr 2024 | 27 Apr 2025 |
| 110 | malpracticeattorney.pw | Alpnames Limited | 21 Jun 2015 | 21 Aug 2015 | 21 Jun 2017 |
| 111 | malpracticeexpertwitness.com | GoDaddy.com, LLC | 4 Mar 2005 | 23 Jan 2023 | 4 Mar 2030 |
| 112 | malpracticeinsurancelegal.com | GoDaddy.com, LLC | 4 Aug 2014 | 23 Apr 2015 | 4 Aug 2015 |
| 113 | malpracticelawyerssandiego.com | GoDaddy.com, LLC | 10 Apr 2012 | 21 Apr 2015 | 10 Apr 2016 |
| 114 | malpracticelawyercleveland.com | GoDaddy.com, LLC | 2 Sep 2014 | 22 Apr 2015 | 2 Sep 2015 |
| 115 | malpracticeattorneycleveland.com | Tucows Domains Inc. | 30 Jul 2018 | 3 Aug 2021 | 30 Jul 2021 |
| 116 | malpractice-insurance-guide.com | GoDaddy.com, LLC | 6 Oct 2007 | 7 Oct 2014 | 6 Oct 2015 |
| 117 | malpracticeforum.com | Moniker Online Services LLC | 16 Aug 2005 | 19 Sep 2014 | 16 Aug 2015 |
| 118 | malpracticeattorney.biz | GoDaddy.com, LLC | 24 Nov 2017 | 28 Nov 2018 | 24 Nov 2018 |
| 119 | malpracticelawyertexas.com | - | 18 Mar 2023 | 6 Apr 2024 | 18 Mar 2025 |
| 120 | malpracticelawyersnewyork.com | Wild West Domains, LLC | 1 Mar 2008 | 14 Oct 2024 | 1 Mar 2025 |
| 121 | malpracticeri.com | Namesilo, LLC | 29 Oct 2014 | 30 Nov 2024 | 29 Oct 2025 |
| 122 | malpracticelawsuits.org | Namesilo, LLC | 9 May 2009 | 5 Apr 2017 | 9 May 2019 |
| 123 | malpracticedc.com | GoDaddy.com, LLC | 5 Dec 2010 | 6 Dec 2024 | 5 Dec 2025 |
| 124 | malpracticeweb.com | GoDaddy.com, LLC | 7 Jun 1999 | 10 Jun 2024 | 7 Jun 2025 |
| 125 | malpracticeattorneycalifornia.com | GoDaddy.com, LLC | 3 Apr 2014 | 14 Apr 2015 | 3 Apr 2016 |
| 126 | malpracticelawyerdallas.com | GoDaddy.com, LLC | 5 Mar 2013 | 9 Mar 2015 | 5 Mar 2016 |
| 127 | malpracticelawyersdenver.com | GoDaddy.com, LLC | 22 Aug 2012 | 21 Apr 2015 | 22 Aug 2015 |
| 128 | malpracticeattorneyillinois.com | GoDaddy.com, LLC | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 129 | malpracticelawyerssanfrancisco.com | GoDaddy.com, LLC | 24 Aug 2012 | 5 Oct 2014 | 24 Aug 2015 |
| 130 | malpracticetrialattorneys.com | GoDaddy.com, LLC | 18 Feb 2015 | 15 Apr 2015 | 18 Feb 2016 |
| 131 | malpracticecertification.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 132 | malpracticelawsuitattorneys.com | GoDaddy.com, LLC | 18 Mar 2023 | 29 Dec 2024 | 18 Mar 2025 |
| 133 | malpracticelawsuitlawyers.com | GoDaddy.com, LLC | 23 Mar 2019 | 12 Mar 2024 | 23 Mar 2025 |
| 134 | malpracticesolicitors.com | GoDaddy.com, LLC | 7 Apr 2013 | 1 May 2015 | 7 Apr 2016 |
| 135 | malpracticeattorneysanfrancisco.com | GoDaddy.com, LLC | 6 May 2012 | 7 May 2015 | 6 May 2016 |
| 136 | malpracticeslawyer.com | GoDaddy.com, LLC | 20 Mar 2024 | 4 Apr 2024 | 20 Mar 2025 |
| 137 | malpractices.info | GoDaddy.com, LLC | 28 Jan 2012 | 2 Feb 2015 | 28 Jan 2016 |
| 138 | malpracticeagent.com | GoDaddy.com, LLC | 7 Aug 2008 | 8 Aug 2024 | 7 Aug 2025 |
| 139 | malpracticelawgroup.com | GoDaddy.com, LLC | 15 Jul 2020 | 26 Jul 2024 | 15 Jul 2025 |
| 140 | malpracticelawattorney.com | - | 5 Mar 2024 | 28 Oct 2024 | 5 Mar 2025 |
| 141 | malpracticemediators.com | GoDaddy.com, LLC | 11 Dec 2014 | 22 Jan 2025 | 11 Dec 2024 |
| 142 | malpracticelegalcounsel.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 143 | malpracticechicago.com | GoDaddy.com, LLC | 30 Oct 2021 | 15 Nov 2022 | 30 Oct 2025 |
| 144 | malpracticelawyerchicago.com | Porkbun, LLC | 17 Jan 2025 | 17 Jan 2025 | 17 Jan 2026 |
| 145 | malpracticemakesperfect.com | Web Commerce Communications Limited dba WebNic.cc | 22 Oct 2020 | 22 Oct 2020 | 22 Oct 2021 |
| 146 | malpracticelawoffice.com | GoDaddy.com, LLC | 9 Nov 2007 | 5 Nov 2024 | 9 Nov 2025 |
| 147 | malpracticeinsuranceillinois.info | Above.com Pty Ltd. | 16 Dec 2015 | 16 Dec 2015 | 16 Dec 2016 |
| 148 | malpracticeinsuranceillinois.net | Gransy s.r.o. d/b/a subreg.cz | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 149 | malpracticeinsuranceillinois.org | - | - | - | - |
| 150 | malpracticelawyers.info | GoDaddy.com, LLC | 3 Aug 2019 | 17 Sep 2024 | 3 Aug 2025 |
| 151 | malpracticeattorneynyc.com | NameKing.com Inc. | 4 Nov 2024 | 3 Jan 2025 | 4 Nov 2025 |
| 152 | malpracticelawyersillinois.com | - | - | - | - |
| 153 | malpracticelawyerstexas.com | GoDaddy.com, LLC | 24 Feb 2020 | 24 Feb 2020 | 24 Feb 2021 |
| 154 | malpracticeinfonow.com | Uniregistrar Corp | - | - | - |
| 155 | malpracticeattorny.com | Dynadot, LLC | 11 Apr 2023 | 12 Apr 2024 | 11 Apr 2025 |
| 156 | malpracticeinsurance.tv | Name.com, Inc. | 9 Jul 2012 | 14 Aug 2014 | 9 Jul 2015 |
| 157 | malpracticeinsuranceforlawyers.com | GoDaddy.com, LLC | 3 Jul 2021 | 4 Jul 2024 | 3 Jul 2025 |
| 158 | malpracticecomplaints.net | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 159 | malpractice-attorneys-california.com | GoDaddy.com, LLC | 30 Jul 2001 | 8 Apr 2013 | 31 Dec 2017 |
| 160 | malpractice-lawyers-california.com | GoDaddy.com, LLC | 30 Jul 2001 | 14 Apr 2015 | 31 Dec 2017 |
| 161 | malpracticelawyerscalifornia.com | GoDaddy.com, LLC | 30 Jul 2001 | 14 Apr 2015 | 31 Dec 2017 |
| 162 | malpracticeattorneyatlanta.com | GoDaddy.com, LLC | 6 Jun 2021 | 7 Jun 2024 | 6 Jun 2025 |
| 163 | malpractice-lawyers-ny.com | GoDaddy.com, LLC | 12 Aug 2013 | 21 Apr 2015 | 12 Aug 2015 |
| 164 | malpracticeattorneydallas.com | GoDaddy.com, LLC | 6 Aug 2012 | 17 Sep 2014 | 6 Aug 2015 |
| 165 | malpracticeattorneysandiego.com | GoDaddy.com, LLC | 6 Aug 2012 | 17 Sep 2014 | 6 Aug 2015 |
| 166 | malpracticelawyersflorida.com | GoDaddy.com, LLC | 3 Aug 2011 | 14 Sep 2014 | 3 Aug 2015 |
| 167 | malpracticeinsurancehelp.com | GoDaddy.com, LLC | 10 Mar 2004 | 11 Jun 2015 | 10 Mar 2016 |
| 168 | malpracticelawlocal.com | GoDaddy.com, LLC | 23 Jun 2014 | 24 Apr 2015 | 23 Jun 2015 |
| 169 | malpracticeattorneybrooklyn.com | GoDaddy.com, LLC | 8 Jun 2014 | 8 Jun 2015 | 8 Jun 2016 |
| 170 | malpracticeinternational.com | GoDaddy.com, LLC | 15 Jun 2014 | 16 Jun 2015 | 15 Jun 2016 |
| 171 | malpracticelawohio.com | GoDaddy.com, LLC | 16 Jun 2009 | 17 Jun 2015 | 16 Jun 2016 |
| 172 | malpracticeclaimsflorida.com | GoDaddy.com, LLC | 19 Jun 2006 | 20 Jun 2015 | 19 Jun 2016 |
| 173 | malpractice-claims-florida.com | GoDaddy.com, LLC | 19 Jun 2006 | 20 Jun 2015 | 19 Jun 2016 |
| 174 | malpracticelawyer.la | Reserved for non-billable transactions where Regis… | 11 Dec 2010 | 5 Dec 2024 | 11 Dec 2025 |
| 175 | malpracticeforums.com | GoDaddy.com, LLC | 26 May 2008 | 17 Mar 2018 | 26 May 2019 |
| 176 | malpracticemaven.com | GoDaddy.com, LLC | 12 Jan 2015 | 25 Aug 2024 | 24 Aug 2025 |
| 177 | malpracticepersonalinjuryattorneyaugustaga.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 178 | malpracticeattorneyssandiego.com | eNom, Inc. | 10 Sep 2011 | 11 Sep 2014 | 10 Sep 2015 |
| 179 | malpracticelawyerinchicago.com | GoDaddy.com, LLC | 22 Mar 2020 | 3 Apr 2021 | 22 Mar 2022 |
| 180 | malpracticelawyerseattle.com | eNom, Inc. | 10 Sep 2011 | 11 Sep 2014 | 10 Sep 2015 |
| 181 | malpractice-lawyer-mo.com | GoDaddy.com, LLC | 13 Nov 2014 | 18 Nov 2015 | 13 Nov 2017 |
| 182 | malpracticelawyermo.com | GoDaddy.com, LLC | 3 Sep 2014 | 4 Sep 2016 | 3 Sep 2017 |
| 183 | malpractice101.com | Moniker Online Services LLC | 15 Sep 2014 | 16 Sep 2017 | 15 Sep 2018 |
| 184 | malpracticecompensation.com | GoDaddy.com, LLC | 9 Jul 2019 | 10 Jul 2024 | 9 Jul 2025 |
| 185 | malpracticenews.com | TurnCommerce, Inc. DBA NameBright.com | 19 Sep 2014 | 13 Sep 2020 | 19 Sep 2025 |
| 186 | malpractice-attorney4u.info | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2014 | 19 Sep 2015 |
| 187 | malpracticelawyerks.com | GoDaddy.com, LLC | 17 Nov 2014 | 17 Nov 2014 | 17 Nov 2015 |
| 188 | malpracticefirm.net | GoDaddy.com, LLC | 7 Sep 2014 | 30 Jan 2017 | 7 Sep 2018 |
| 189 | malpracticezoom.com | Brandsight, Inc. | 10 Sep 2014 | 10 Aug 2024 | 10 Sep 2025 |
| 190 | malpracticecaseattys.com | GoDaddy.com, LLC | 1 Oct 2014 | 6 Oct 2016 | 1 Oct 2017 |
| 191 | malpracticeinsuranceshop.com | GoDaddy.com, LLC | 20 Nov 2014 | 21 Nov 2023 | 20 Nov 2025 |
| 192 | malpracticeking.com | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 193 | malpracticelawyercambridge.com | register.com, Inc. | 29 Sep 2014 | 27 Oct 2016 | 29 Sep 2017 |
| 194 | malpractice-lawyers-now.com | Register4Less, Inc. | 13 Oct 2014 | 1 Jan 2016 | 13 Oct 2017 |
| 195 | malpracticeassurance.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2016 |
| 196 | malpractice-injunction.mobi | GMO Internet Inc. | 19 Oct 2014 | - | 19 Oct 2015 |
| 197 | malpracticelawyersinnyc.com | eNom, Inc. | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 198 | malpracticeattorneydecaturil.com | GoDaddy.com, LLC | 8 Dec 2014 | 27 Nov 2024 | 8 Dec 2025 |
| 199 | malpracticewatchdog.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2016 |
| 200 | malpractice-transcendence.org | GMO Internet Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 201 | malpractice-interrogate.org | GMO Internet Inc. | 17 Dec 2014 | - | 17 Dec 2015 |
| 202 | malpractice-lawyer-chicago.com | Tucows Domains Inc. | 17 Dec 2013 | 21 Dec 2014 | 17 Dec 2015 |
| 203 | malpracticelawyersinlasvegas.com | eNom, Inc. | 2 Jan 2015 | 14 Feb 2018 | 2 Jan 2018 |
| 204 | malpracticeinsurance.agency | GoDaddy.com, LLC | 17 Jul 2014 | 3 Jul 2024 | 17 Jul 2026 |
| 205 | malpractice4docs.xyz | Network Solutions, LLC | 30 Jul 2014 | 30 Jul 2014 | 30 Jul 2015 |
| 206 | malpracticelawyers.nyc | NameCheap, Inc. | 11 Apr 2017 | 16 Apr 2017 | 11 Apr 2018 |
| 207 | malpracticelawyer.nyc | Hello Internet Corp. | 8 Oct 2014 | 4 Oct 2017 | 7 Oct 2018 |
| 208 | malpracticeinsurance.nyc | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2014 | 7 Oct 2015 |
| 209 | malpracticeteam.lawyer | GoDaddy.com, LLC | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 210 | malpracticefirm.nyc | GoDaddy.com, LLC | 9 Oct 2014 | 14 Oct 2024 | 8 Oct 2026 |
| 211 | malpracticelawyer.attorney | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 212 | malpracticeattorney.lawyer | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 213 | malpractice-injunction.club | GMO Internet Inc. | 18 Oct 2014 | 18 Oct 2014 | 17 Oct 2015 |
| 214 | malpracticedefense.attorney | Network Solutions, LLC | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 215 | malpracticelawyer.healthcare | GoDaddy.com, LLC | 10 Nov 2014 | 6 Jan 2017 | 10 Nov 2017 |
| 216 | malpracticeattorney.healthcare | GoDaddy.com, LLC | 10 Nov 2014 | 6 Jan 2017 | 10 Nov 2017 |
| 217 | malpracticelaw.nyc | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 7 Nov 2015 |
| 218 | malpracticeinsurance.healthcare | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 219 | malpracticeattorneys.website | eNom, Inc. | 5 Nov 2014 | 3 Nov 2016 | 5 Nov 2017 |
| 220 | malpracticeattorneys.directory | eNom, Inc. | 5 Nov 2014 | 6 Jan 2017 | 5 Nov 2017 |
| 221 | malpracticeattorneys.club | eNom, Inc. | 5 Nov 2014 | 28 Oct 2016 | 4 Nov 2018 |
| 222 | malpracticeinsurance.solutions | GoDaddy.com, LLC | 30 Aug 2016 | 6 Jan 2017 | 30 Aug 2017 |
| 223 | malpracticeinsurance.company | GoDaddy.com, LLC | 28 Dec 2014 | 28 Dec 2014 | 28 Dec 2015 |
| 224 | malpracticeattorney.review | NameCheap, Inc. | 5 Apr 2017 | 20 Apr 2023 | 4 Apr 2023 |
| 225 | malpracticelegal.help | Uniregistrar Corp | 31 Jan 2015 | 31 Jan 2015 | 31 Jan 2016 |
| 226 | malpracticeexpert.dental | GoDaddy.com, LLC | 7 Feb 2015 | 6 Jan 2017 | 7 Feb 2018 |
| 227 | malpracticelawyers.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 May 2016 | 20 May 2016 | 20 May 2017 |
| 228 | malpracticelawyer.directory | GoDaddy.com, LLC | 1 Jul 2016 | 1 Jul 2016 | 1 Jul 2017 |
| 229 | malpracticeattorney.directory | GoDaddy.com, LLC | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 230 | malpracticelawyers.legal | GoDaddy.com, LLC | 16 Mar 2015 | 13 Feb 2016 | 16 Mar 2017 |
| 231 | malpracticelawyers.lawyer | GoDaddy.com, LLC | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 232 | malpracticelawyer.lawyer | GoDaddy.com, LLC | 29 Mar 2015 | 29 Mar 2015 | 29 Mar 2016 |
| 233 | malpracticelawyerconsult.com | GoDaddy.com, LLC | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 234 | malpracticelaw.claims | eNom, Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 235 | malpracticelaw.center | eNom, Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 236 | malpractice-individual.link | GMO Internet Inc. | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 237 | malpracticecases.net | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 238 | malpracticediabetes.com | Tucows Domains Inc. | 10 Jan 2005 | 14 Jan 2015 | 10 Jan 2016 |
| 239 | malpractice-diabetes.com | Tucows Domains Inc. | 10 Jan 2005 | 14 Jan 2015 | 10 Jan 2016 |
| 240 | malpractice-law-directory.com | eNom, Inc. | 21 Jul 2016 | 2 Sep 2017 | 21 Jul 2017 |
| 241 | malpracticeattorney.xyz | NameCheap, Inc. | 26 Jun 2024 | 7 Jul 2024 | 26 Jun 2025 |
| 242 | malpracticelawyer.website | Porkbun, LLC | 20 Aug 2022 | 31 Aug 2023 | 20 Aug 2024 |
| 243 | malpracticeattorney.website | Alpnames Limited | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 244 | malpracticelaw.site | GoDaddy.com, LLC | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 245 | malpracticeinsurance.site | DOTSERVE INC. | 17 Aug 2021 | 17 Aug 2021 | 17 Aug 2022 |
| 246 | malpractice-malpractice.top | GMO Internet Inc. | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 247 | malpracticelawyer.top | Dynadot, LLC | 22 Aug 2018 | 28 Sep 2018 | 22 Aug 2019 |
| 248 | malpracticelawyer.us | GoDaddy.com, LLC | 28 Dec 2017 | 5 Jan 2019 | 28 Dec 2019 |
| 249 | malpracticeinsuranceforlawyers.us | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 16 Aug 2016 |
| 250 | malpracticelawconsultation.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 251 | malpracticemedical.net | Porkbun, LLC | 1 Feb 2015 | 31 Jan 2025 | 1 Feb 2026 |
| 252 | malpracticelawyerpensacola.com | DreamHost, LLC | 11 Feb 2015 | 11 Feb 2015 | 11 Feb 2016 |
| 253 | malpracticeinjurylawyer.com | DropCatch.com 518 LLC | 15 Feb 2015 | 21 Sep 2020 | 15 Feb 2026 |
| 254 | malpracticerdirectory.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 255 | malpracticerattorneydirectory.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 256 | malpracticelawyerdirectory.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 257 | malpracticeinjurylawyers.com | TurnCommerce, Inc. DBA NameBright.com | 5 Mar 2015 | 21 Sep 2020 | 5 Mar 2025 |
| 258 | malpracticelawyerpanamacity.com | DreamHost, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 259 | malpracticelawyersverified.com | GoDaddy.com, LLC | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 260 | malpracticelawyerstrusted.com | GoDaddy.com, LLC | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2017 |
| 261 | malpractice-attorney-louisville.com | Domain.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2017 |
| 262 | malpracticelawyergroups.com | GoDaddy.com, LLC | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 263 | malpracticelawyerarea.com | GoDaddy.com, LLC | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 264 | malpracticelawyers.biz | GoDaddy.com, LLC | 3 Aug 2019 | 5 Apr 2020 | 3 Aug 2020 |
| 265 | malpracticelawyerin.com | Name.com, Inc. | 27 Aug 2015 | 23 Aug 2016 | 27 Aug 2017 |
| 266 | malpracticeattorneyin.com | Name.com, Inc. | 27 Aug 2015 | 23 Aug 2016 | 27 Aug 2017 |
| 267 | malpracticeagents.com | GoDaddy.com, LLC | 6 Apr 2020 | 6 Apr 2020 | 6 Apr 2021 |
| 268 | malpracticed.com | GoDaddy.com, LLC | 16 Jun 2016 | 4 Jul 2024 | 16 Jun 2025 |
| 269 | malpracticelawyerrockford.com | GoDaddy.com, LLC | 28 Mar 2015 | 28 Mar 2015 | 28 Mar 2016 |
| 270 | malpracticelawyerspecializing.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 271 | malpractice-attorney-options.com | eNom, Inc. | 4 Sep 2015 | 22 Jul 2017 | 4 Sep 2017 |
| 272 | malpracticelawyernyc.com | - | 20 Sep 2023 | 13 Oct 2024 | 20 Sep 2025 |
| 273 | malpracticelawyersinpa.info | GoDaddy.com, LLC | 21 Apr 2015 | - | 21 Apr 2016 |
| 274 | malpracticelawyertallahassee.com | DreamHost, LLC | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 275 | malpracticelawyerlisting.com | - | 5 Aug 2016 | 5 Aug 2016 | 5 Aug 2017 |
| 276 | malpracticelawyerfirms.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 277 | malpracticelawyeraccess.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 278 | malpracticelawlink.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 279 | malpracticelawconnection.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 280 | malpracticelawcenters.com | GoDaddy.com, LLC | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 281 | malpracticeinsuranceofnewyork.com | Cyrus the Great, LLC | 25 Apr 2015 | 25 Apr 2015 | 25 Apr 2016 |
| 282 | malpracticelitigators.com | GoDaddy.com, LLC | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 283 | malpracticetailcoverage.com | GoDaddy.com, LLC | 1 May 2015 | 26 Sep 2024 | 1 May 2025 |
| 284 | malpracticelawyerconnect.com | GoDaddy.com, LLC | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 285 | malpracticecheck.com | GoDaddy.com, LLC | 14 Dec 2017 | 21 Dec 2024 | 14 Dec 2028 |
| 286 | malpracticeattorneymobilewebsites.com | Fabulous.com Pty Ltd. | 5 May 2015 | 6 May 2017 | 5 May 2017 |
| 287 | malpracticerater.com | eNom, Inc. | 8 May 2015 | 8 May 2015 | 8 May 2016 |
| 288 | malpracticelawadvantage.com | - | 5 Aug 2016 | 5 Aug 2016 | 5 Aug 2017 |
| 289 | malpracticeblogs.com | TLD Registrar Solutions Ltd. | 13 May 2015 | 13 May 2015 | 13 May 2016 |
| 290 | malpracticelawyersandiego.com | NameCheap, Inc. | 6 Feb 2023 | 19 Mar 2024 | 6 Feb 2024 |
| 291 | malpracticelawyerinlosangeles.com | eNom, Inc. | 10 Sep 2011 | 11 Sep 2015 | 10 Sep 2016 |
| 292 | malpracticelawyerinboston.com | eNom, Inc. | 10 Sep 2011 | 11 Sep 2015 | 10 Sep 2016 |
| 293 | malpracticeone.us | GoDaddy.com, LLC | 13 May 2015 | 13 May 2017 | 12 May 2018 |
| 294 | malpracticeone.net | GoDaddy.com, LLC | 13 May 2015 | 14 May 2024 | 13 May 2025 |
| 295 | malpracticelawyergroup.com | - | 8 Aug 2016 | 8 Aug 2016 | 8 Aug 2017 |
| 296 | malpracticelawyercompany.com | - | 8 Aug 2016 | 8 Aug 2016 | 8 Aug 2017 |
| 297 | malpracticeattorneysnewjersey.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 16 Apr 2023 | 17 Apr 2024 | 16 Apr 2025 |
| 298 | malpracticelawyers.club | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Sep 2015 | - | 12 Sep 2016 |
| 299 | malpracticelawyergroup.net | - | 8 Aug 2016 | 8 Aug 2016 | 8 Aug 2017 |
| 300 | malpracticelawgroups.com | GoDaddy.com, LLC | 24 May 2015 | 24 May 2015 | 24 May 2016 |
| 301 | malpracticelawappointment.com | GoDaddy.com, LLC | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 302 | malpractice100.info | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2016 |
| 303 | malpracticeattorneynewyorkcity.com | Fabulous.com Pty Ltd. | 29 May 2015 | 9 Jul 2017 | 29 May 2018 |
| 304 | malpracticebusters.com | GoDaddy.com, LLC | 15 Sep 2015 | 15 Sep 2015 | 15 Sep 2016 |
| 305 | malpracticelawyersolutions.com | GoDaddy.com, LLC | 2 Jun 2015 | 2 Jun 2015 | 2 Jun 2016 |
| 306 | malpracticelawlongisland.org | GoDaddy.com, LLC | 1 Jun 2015 | 30 May 2017 | 1 Jun 2018 |
| 307 | malpracticelawyerselection.com | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 308 | malpracticelawyersecure.com | GoDaddy.com, LLC | 9 Jun 2015 | 9 Jun 2015 | 9 Jun 2016 |
| 309 | malpracticeboard.com | Dynadot, LLC | 16 Sep 2021 | 26 Nov 2024 | 16 Sep 2024 |
| 310 | malpracticepvp.com | eNom, Inc. | 15 Jun 2015 | 16 Jun 2015 | 15 Jun 2016 |
| 311 | malpracticeliabilityinsurance.com | Dynadot, LLC | 23 Nov 2022 | 2 Feb 2024 | 23 Nov 2023 |
| 312 | malpracticelawyersnow.com | Uniregistrar Corp | - | - | - |
| 313 | malpracticelawyerguide.com | GoDaddy.com, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 314 | malpracticelawoptions.com | GoDaddy.com, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 315 | malpracticeattorneystonemountainga.com | Google, Inc. | 25 Jun 2015 | 26 Jun 2017 | 25 Jun 2018 |
| 316 | malpracticelawyersuccess.com | GoDaddy.com, LLC | 29 Jun 2015 | 29 Jun 2015 | 29 Jun 2016 |
| 317 | malpracticeattorneyfind.com | GoDaddy.com, LLC | 23 Jun 2017 | 23 Jun 2017 | 23 Jun 2018 |
| 318 | malpracticesafeguard.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 319 | malpracticelawyersonly.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 320 | malpracticelawyeronly.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 321 | malpracticelawyerexperience.com | GoDaddy.com, LLC | 24 Sep 2015 | 24 Sep 2015 | 24 Sep 2016 |
| 322 | malpracticeindemnity.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 323 | malpracticeattorneysonly.com | GoDaddy.com, LLC | 23 Sep 2015 | 23 Sep 2015 | 23 Sep 2016 |
| 324 | malpracticelawexperts.com | - | - | - | - |
| 325 | malpracticeattorneywinstonsalem.com | HiChina Zhicheng Technology Limited | 14 Sep 2018 | 14 Sep 2018 | 14 Sep 2019 |
| 326 | malpractice-committee.com | Beijing Lanhai Jiye Technology Co., Ltd | 29 Sep 2024 | 17 Jan 2025 | 29 Sep 2025 |
| 327 | malpracticelawyernetwork.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 328 | malpracticeinsurancebroker.com | Tucows Domains Inc. | 28 Sep 2016 | 2 Oct 2017 | 28 Sep 2017 |
| 329 | malpracticepro.com | NameCheap, Inc. | 1 Sep 2022 | 2 Aug 2024 | 1 Sep 2025 |
| 330 | malpracticenewyorkcity.com | GoDaddy.com, LLC | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2016 |
| 331 | malpracticelawyerfirm.com | GoDaddy.com, LLC | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 332 | malpracticelawyerslocal.com | GoDaddy.com, LLC | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2016 |
| 333 | malpracticelawyerconsultation.com | GoDaddy.com, LLC | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2016 |
| 334 | malpracticecenter.com | GoDaddy.com, LLC | 25 Jul 2015 | 2 Sep 2024 | 25 Jul 2029 |
| 335 | malpracticeattorneymanhattan.com | - | - | - | - |
| 336 | malpracticelawtrusted.com | GoDaddy.com, LLC | 28 Jul 2015 | 28 Jul 2015 | 28 Jul 2016 |
| 337 | malpracticelegalfirm.com | GoDaddy.com, LLC | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 338 | malpracticeinsurancelosangeles.com | GoDaddy.com, LLC | 30 Jul 2015 | 30 Jul 2024 | 30 Jul 2025 |
| 339 | malpracticehelpcenter.com | GoDaddy.com, LLC | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 340 | malpracticeassetprotection.com | FastDomain Inc. | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 341 | malpracticeinjuryclaims.com | GoDaddy.com, LLC | 1 Aug 2015 | 1 Aug 2015 | 1 Aug 2016 |
| 342 | malpracticelawyerrecovery.com | GoDaddy.com, LLC | 3 Aug 2015 | 3 Aug 2015 | 3 Aug 2016 |
| 343 | malpracticelawyer.miami | Blue Razor Domains, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 344 | malpracticeattorney.miami | GoDaddy.com, LLC | 2 Oct 2015 | 2 Oct 2015 | 2 Oct 2016 |
| 345 | malpracticeanalysis.com | GoDaddy.com, LLC | 5 Aug 2015 | 29 Nov 2024 | 5 Aug 2025 |
| 346 | malpracticesuit.attorney | GoDaddy.com, LLC | 5 Oct 2015 | 5 Oct 2015 | 5 Oct 2016 |
| 347 | malpracticequotes.info | GoDaddy.com, LLC | 6 Oct 2015 | 7 Oct 2016 | 6 Oct 2017 |
| 348 | malpracticequote.us | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2016 | 5 Oct 2017 |
| 349 | malpracticequote.net | GoDaddy.com, LLC | 6 Oct 2015 | 6 Oct 2015 | 6 Oct 2016 |
| 350 | malpracticequote.info | GoDaddy.com, LLC | 6 Oct 2015 | 7 Oct 2016 | 6 Oct 2017 |
| 351 | malpracticelawyerprotection.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 352 | malpracticelawmethods.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2016 |
| 353 | malpracticeattorneys.guide | eNom, Inc. | 6 Oct 2015 | 6 Jan 2017 | 6 Oct 2017 |
| 354 | malpracticeattorneyguide.com | GoDaddy.com, LLC | 14 Aug 2019 | 4 Sep 2024 | 14 Aug 2025 |
| 355 | malpracticelawyers.miami | GoDaddy.com, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 356 | malpracticescreener.com | GoDaddy.com, LLC | 10 Oct 2015 | 10 Oct 2015 | 10 Oct 2016 |
| 357 | malpracticeattorneys.miami | Go Canada Domains, LLC | 2 Oct 2015 | 13 Nov 2024 | 2 Oct 2024 |
| 358 | malpracticelawyer.legal | Google, Inc. | 13 Oct 2015 | 29 Sep 2017 | 13 Oct 2017 |
| 359 | malpracticeattorneys.legal | Google, Inc. | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 360 | malpracticelawyerservice.com | GoDaddy.com, LLC | 14 Oct 2015 | 15 Oct 2015 | 14 Oct 2016 |
| 361 | malpracticelawyerapproval.com | GoDaddy.com, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 362 | malpracticeinsurancecarriers.com | eNom, Inc. | 14 Oct 2015 | 15 Oct 2015 | 14 Oct 2016 |
| 363 | malpracticelawyernetwork.xyz | NameCheap, Inc. | 17 Oct 2015 | 17 Oct 2015 | 17 Oct 2016 |
| 364 | malpracticelawyerpublic.com | GoDaddy.com, LLC | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 365 | malpracticelawyercompensation.com | GoDaddy.com, LLC | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 366 | malpracticechiropractor.com | GoDaddy.com, LLC | 22 Oct 2015 | 22 Oct 2015 | 22 Oct 2017 |
| 367 | malpracticephoenix.com | GMO Internet Inc. | 14 Aug 2021 | 14 Aug 2021 | 14 Aug 2022 |
| 368 | malpracticedallas.com | GoDaddy.com, LLC | 11 Aug 2024 | 8 Oct 2024 | 11 Aug 2025 |
| 369 | malpracticeattorneymississippi.com | Tucows Domains Inc. | 22 Oct 2010 | 26 Oct 2015 | 22 Oct 2016 |
| 370 | malpracticeportland.com | DropCatch.com 555 LLC | 27 Dec 2018 | 27 Dec 2018 | 27 Dec 2019 |
| 371 | malpracticehartford.com | Namesilo, LLC | 18 Oct 2006 | 17 Nov 2017 | 18 Oct 2018 |
| 372 | malpracticefortworth.com | Namesilo, LLC | 18 Oct 2006 | 17 Nov 2017 | 18 Oct 2018 |
| 373 | malpracticelawyertopexperts.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 374 | malpracticelawyerprecision.com | GoDaddy.com, LLC | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 375 | malpracticelawyer.law | Minds + Machines Registrar Limited | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 376 | malpracticeattorney.law | Minds + Machines Registrar Limited | 28 Oct 2015 | 28 Oct 2015 | 28 Oct 2016 |
| 377 | malpracticelawyermarkets.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 378 | malpracticelawyerguarantee.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 379 | malpracticelawyeradvance.com | GoDaddy.com, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 380 | malpracticenewjersey.com | Dynadot, LLC | 4 Jan 2024 | 5 Jan 2025 | 4 Jan 2026 |
| 381 | malpracticecase.xyz | NameCheap, Inc. | 23 Nov 2015 | 9 Dec 2016 | 23 Nov 2017 |
| 382 | malpractice-consultants.xyz | NameCheap, Inc. | 23 Nov 2015 | 9 Dec 2016 | 23 Nov 2017 |
| 383 | malpracticeinsuranceforlawyers.org | 1API GmbH | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2016 |
| 384 | malpracticeresearch.com | NameCheap, Inc. | 26 Jul 2019 | - | 26 Jul 2020 |
| 385 | malpracticetriallawyers.com | eNom, Inc. | 27 Nov 2015 | 30 Oct 2024 | 27 Nov 2025 |
| 386 | malpracticelawyersonline.com | GoDaddy.com, LLC | 13 Feb 2017 | 13 Feb 2017 | 13 Feb 2018 |
| 387 | malpracticelawyersphiladelphia.info | GoDaddy.com, LLC | 7 Dec 2015 | - | 7 Dec 2016 |
| 388 | malpracticewiseguides.com | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 389 | malpracticeny.com | Annulet LLC | 29 Dec 2016 | 15 Feb 2025 | 29 Dec 2025 |
| 390 | malpracticedefinition.com | Namesilo, LLC | 26 Dec 2015 | 26 Jan 2019 | 26 Dec 2019 |
| 391 | malpracticelawyerrockfordil.com | Tucows Domains Inc. | 28 Dec 2010 | 1 Jan 2016 | 28 Dec 2016 |
| 392 | malpracticelawyerhome.com | GoDaddy.com, LLC | 31 Dec 2015 | 1 Jan 2025 | 31 Dec 2025 |
| 393 | malpracticelawyersnow.xyz | TLD Registrar Solutions Ltd. | 31 Dec 2015 | 6 Jan 2016 | 31 Dec 2016 |
| 394 | malpracticepunk.com | FastDomain Inc. | 2 Jan 2016 | 18 Dec 2024 | 2 Jan 2026 |
| 395 | malpracticeservices.com | Annulet LLC | 4 Oct 2016 | 6 Nov 2017 | 4 Oct 2018 |
| 396 | malpracticedefenseservices.com | Tucows Domains Inc. | 31 Dec 2005 | 4 Jan 2017 | 31 Dec 2016 |
| 397 | malpracticelawyerrockford.net | Tucows Domains Inc. | 11 Jan 2011 | 15 Jan 2016 | 11 Jan 2017 |
| 398 | malpracticelawyersearch.xyz | TLD Registrar Solutions Ltd. | 23 Jan 2016 | 23 Jan 2016 | 23 Jan 2017 |
| 399 | malpracticementor.com | Google, Inc. | 25 Jan 2016 | 25 Jan 2016 | 25 Jan 2017 |
| 400 | malpracticeinsurancespecialists.com | GoDaddy.com, LLC | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2017 |
| 401 | malpractice-quote.com | GoDaddy.com, LLC | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2017 |
| 402 | malpracticeinsurance.us | GoDaddy.com, LLC | 19 Aug 2017 | 19 Aug 2017 | 18 Aug 2018 |
| 403 | malpractice-lawyer-local.info | GoDaddy.com, LLC | 15 Feb 2016 | 15 Feb 2016 | 15 Feb 2017 |
| 404 | malpracticelaw.info | GoDaddy.com, LLC | 10 Dec 2024 | 15 Dec 2024 | 10 Dec 2026 |
| 405 | malpracticelawyersaltlakecityut.com | GoDaddy.com, LLC | 1 Jun 2021 | 1 Jun 2021 | 1 Jun 2022 |
| 406 | malpracticeattorneywinstonsalem.net | FastDomain Inc. | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 407 | malpracticelawyers.online | GoDaddy.com, LLC | 2 Jul 2018 | 2 Jul 2018 | 2 Jul 2019 |
| 408 | malpracticelawyer.online | NameCheap, Inc. | 21 Feb 2021 | 27 Feb 2021 | 21 Feb 2022 |
| 409 | malpracticeinsurance.info | Epik Inc. | 1 Mar 2020 | 1 May 2020 | 1 Mar 2021 |
| 410 | malpracticeportal.com | Domain.com, LLC | 14 Mar 2016 | 14 Mar 2016 | 14 Mar 2017 |
| 411 | malpracticeservices.net | Tucows Domains Inc. | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 412 | malpracticeservice.net | Tucows Domains Inc. | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 413 | malpracticedefenseservices.net | Tucows Domains Inc. | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 414 | malpracticedefenseservice.net | Tucows Domains Inc. | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 415 | malpracticeservice.com | Tucows Domains Inc. | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 416 | malpracticedefenseservice.com | Tucows Domains Inc. | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 417 | malpracticeservices.org | - | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 418 | malpracticeservice.org | - | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 419 | malpracticedefenseservices.org | - | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 420 | malpracticedefenseservice.org | - | 13 Mar 2006 | 13 Mar 2006 | 13 Mar 2017 |
| 421 | malpractices.com | GoDaddy.com, LLC | 19 Nov 2001 | 30 Oct 2024 | 19 Nov 2025 |
| 422 | malpracticenurse.com | - | 28 Mar 2023 | 29 Apr 2024 | 28 Mar 2024 |
| 423 | malpracticeinsure.com | GoDaddy.com, LLC | 13 May 2024 | 13 May 2024 | 13 May 2025 |
| 424 | malpracticekentucky.com | GoDaddy.com, LLC | 24 Mar 2016 | 27 Feb 2024 | 24 Mar 2025 |
| 425 | malpracticenegligent.com | Wild West Domains, LLC | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2017 |
| 426 | malpracticenegligence.com | Epik Inc. | 21 Jun 2022 | 2 Sep 2023 | 21 Jun 2023 |
| 427 | malpracticesepsis.com | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 428 | malpracticeforsepsis.com | GoDaddy.com, LLC | 30 Mar 2016 | 30 Mar 2016 | 30 Mar 2017 |
| 429 | malpracticedefense.com | Network Solutions, LLC | 18 May 1998 | 19 Mar 2024 | 18 May 2029 |
| 430 | malpracticelawyers.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 431 | malpracticelawyer.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Nov 2024 | 20 Dec 2024 | 2 Nov 2025 |
| 432 | malpracticeattorneys.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 433 | malpracticeattorneys.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 434 | malpracticelawyer.link | Uniregistrar Corp | 15 Apr 2016 | 26 May 2017 | 15 Apr 2017 |
| 435 | malpracticelawyer.click | Uniregistrar Corp | 15 Apr 2016 | 26 May 2017 | 15 Apr 2017 |
| 436 | malpracticeattorney.link | 1API GmbH | 29 Dec 2024 | 3 Jan 2025 | 29 Dec 2025 |
| 437 | malpracticeattorney.click | NameCheap, Inc. | 26 May 2022 | 7 Jul 2023 | 26 May 2023 |
| 438 | malpracticecounsel.com | Google, Inc. | 24 Jul 2019 | 24 Jul 2019 | 24 Jul 2020 |
| 439 | malpracticeattorneyil.com | Tucows Domains Inc. | 19 Apr 2012 | 19 Apr 2012 | 19 Apr 2017 |
| 440 | malpracticescreen.com | DropCatch.com 975 LLC | 18 May 2024 | 19 May 2024 | 18 May 2025 |
| 441 | malpracticelawspecialists.com | GoDaddy.com, LLC | 26 Apr 2016 | 27 Apr 2024 | 26 Apr 2025 |
| 442 | malpracticeclaims.xyz | NameCheap, Inc. | 3 May 2016 | 11 Apr 2017 | 3 May 2018 |
| 443 | malpracticeandnegligence.com | GoDaddy.com, LLC | 10 May 2016 | 10 May 2016 | 10 May 2017 |
| 444 | malpracticeinsuranceflorida.org | GoDaddy.com, LLC | 16 Dec 2009 | 17 Dec 2015 | 16 Dec 2016 |
| 445 | malpracticemitigators.com | GoDaddy.com, LLC | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 446 | malpracticelaw.lawyer | register.com, Inc. | 17 May 2016 | 17 May 2016 | 17 May 2017 |
| 447 | malpracticepremium.com | Name.com, Inc. | 21 May 2016 | 21 May 2016 | 21 May 2017 |
| 448 | malpracticeinsurance.xyz | NameCheap, Inc. | 21 Feb 2022 | 4 Apr 2023 | 21 Feb 2023 |
| 449 | malpracticelaw.xyz | NameKing.com Inc. | 12 Oct 2021 | 12 Oct 2021 | 12 Oct 2022 |
| 450 | malpracticelawsuit.xyz | GoDaddy.com, LLC | 25 May 2022 | 20 Jul 2023 | 25 May 2024 |
| 451 | malpracticelawyerlongisland.com | register.com, Inc. | 27 May 2016 | 8 May 2017 | 27 May 2018 |
| 452 | malpracticeattorneyorlando.com | - | 25 Jan 2024 | 17 Feb 2025 | 25 Jan 2026 |
| 453 | malpracticelawyersinpa.com | Namesilo, LLC | 2 Jun 2016 | 2 Jun 2016 | 2 Jun 2017 |
| 454 | malpracticeattorneymiami.org | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 455 | malpracticeattorneymiami.net | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 456 | malpracticeattorneymiami.info | GoDaddy.com, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 457 | malpracticelawyars.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 458 | malpracticeinsurence.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 459 | malpracticeatorney.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 460 | malpractice-lawyer.net | GoDaddy.com, LLC | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 461 | malpracticelawexpertise.com | GoDaddy.com, LLC | 16 Jun 2016 | 16 Jun 2016 | 16 Jun 2017 |
| 462 | malpracticelegalconsortium.xyz | NameCheap, Inc. | 26 Jun 2016 | 29 Jul 2016 | 26 Jun 2017 |
| 463 | malpracticelawyersnj.xyz | NameCheap, Inc. | 27 Jun 2016 | 29 Jul 2016 | 27 Jun 2017 |
| 464 | malpracticelawyersnearme.xyz | NameCheap, Inc. | 27 Jun 2016 | 29 Jul 2016 | 27 Jun 2017 |
| 465 | malpracticelawsuitcases.xyz | NameCheap, Inc. | 27 Jun 2016 | 29 Jul 2016 | 27 Jun 2017 |
| 466 | malpracticeattorneynearme.xyz | NameCheap, Inc. | 27 Jun 2016 | 29 Jul 2016 | 27 Jun 2017 |
| 467 | malpracticeinsurance.link | Uniregistrar Corp | 30 Jun 2016 | 10 Aug 2017 | 30 Jun 2017 |
| 468 | malpracticelegalclaim.com | GoDaddy.com, LLC | 15 May 2009 | 16 May 2024 | 15 May 2025 |
| 469 | malpracticed.xyz | NameKing.com Inc. | 20 Feb 2022 | 6 Apr 2023 | 20 Feb 2023 |
| 470 | malpracticelawyersinmd.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 471 | malpracticeattorneyspa.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 472 | malpracticelawyersmaryland.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 473 | malpracticelawyersnyc.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 474 | malpracticelawyersny.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 475 | malpracticelawsuits.xyz | GoDaddy.com, LLC | 17 Jun 2016 | 6 Dec 2017 | 17 Jun 2018 |
| 476 | malpracticeinsurance.top | GMO Internet Inc. | 21 Jun 2016 | 21 Jun 2016 | 21 Jun 2017 |
| 477 | malpracticemedical.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 478 | malpracticesurgery.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 479 | malpracticelawsuitagainstlawyer.xyz | Uniregistrar Corp | 14 Jun 2016 | 24 Sep 2016 | 14 Jun 2017 |
| 480 | malpracticeattorney.top | Dynadot, LLC | 22 Aug 2018 | 28 Sep 2018 | 22 Aug 2019 |
| 481 | malpracticelaw.guru | Network Solutions, LLC | 5 Feb 2014 | 11 Dec 2024 | 5 Feb 2026 |
| 482 | malpracticelawyer.guru | Network Solutions, LLC | 5 Feb 2014 | 11 Dec 2024 | 5 Feb 2026 |
| 483 | malpracticeattorney.reviews | GoDaddy.com, LLC | 7 Jun 2014 | 10 Jan 2017 | 7 Jun 2019 |
| 484 | malpractice-lawyer.biz | Domain.com, LLC | 17 Mar 2002 | 19 Mar 2024 | 16 Mar 2024 |
| 485 | malpracticekaiser.biz | GoDaddy.com, LLC | 12 Mar 2013 | 17 Mar 2017 | 11 Mar 2019 |
| 486 | malpracticedefense.law | Epik Inc. | 28 Jul 2016 | 28 Jul 2016 | 28 Jul 2017 |
| 487 | malpracticelawyersdirectory.xyz | 1&1 Internet AG | 4 Aug 2016 | 24 Sep 2016 | 4 Aug 2017 |
| 488 | malpracticeattorneygxtak.xyz | NameCheap, Inc. | 9 Aug 2016 | 14 Aug 2016 | 9 Aug 2017 |
| 489 | malpracticepr.info | Network Solutions, LLC | 16 Aug 2016 | 28 Sep 2017 | 16 Aug 2018 |
| 490 | malpracticeadvise.com | GoDaddy.com, LLC | 20 Aug 2016 | 21 Aug 2024 | 20 Aug 2025 |
| 491 | malpracticeguide.org | GoDaddy.com, LLC | 20 Aug 2016 | 4 Oct 2024 | 20 Aug 2025 |
| 492 | malpracticesettlements.org | GoDaddy.com, LLC | 20 Aug 2016 | 4 Oct 2024 | 20 Aug 2025 |
| 493 | malpracticeinsurancefornurses.com | GoDaddy.com, LLC | 23 Mar 2024 | 23 Mar 2024 | 23 Mar 2026 |
| 494 | malpracticeattorneysnewyork.xyz | NameCheap, Inc. | 23 Aug 2016 | 28 Aug 2016 | 23 Aug 2017 |
| 495 | malpracticeconsulting.com | Annulet LLC | 25 Aug 2016 | 7 Jul 2017 | 25 Aug 2018 |
| 496 | malpractice-laws.com | - | 3 Sep 2016 | 3 Sep 2016 | 3 Sep 2017 |
| 497 | malpractice-attorneys.net | - | 5 Sep 2016 | 5 Sep 2016 | 5 Sep 2017 |
| 498 | malpracticemedia.com | - | 6 Sep 2016 | 6 Sep 2016 | 6 Sep 2017 |
| 499 | malpractice-attorney-us.com | GMO Internet Inc. | 23 Feb 2018 | 23 Feb 2018 | 23 Feb 2019 |
| 500 | malpracticeattorneys.com | Dynadot, LLC | 11 Aug 1998 | 10 Feb 2024 | 10 Aug 2025 |
| 501 | malpracticeinjurylaw.com | GoDaddy.com, LLC | 5 Aug 2003 | 16 Jul 2024 | 5 Aug 2025 |
| 502 | malpracticefl.com | GoDaddy.com, LLC | 23 Nov 2021 | 16 Jun 2024 | 23 Nov 2026 |
| 503 | malpracticeinsurances.com | GoDaddy.com, LLC | 7 Jan 2009 | 18 Dec 2024 | 7 Jan 2026 |
| 504 | malpracticeutahlawyer.com | GoDaddy.com, LLC | 19 Jan 2007 | 19 Jan 2025 | 19 Jan 2026 |
| 505 | malpracticelawsuits.com | GoDaddy.com, LLC | 7 Jan 2000 | 8 Jan 2025 | 7 Jan 2026 |
| 506 | malpractice-hotline.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 507 | malpracticepennsylvania.com | Nameling.com LLC | 2 Sep 2012 | 3 Sep 2017 | 2 Sep 2018 |
| 508 | malpractice-lawyer.com | GoDaddy.com, LLC | 19 Nov 2003 | 18 Dec 2024 | 19 Nov 2025 |
| 509 | malpracticevictimsadvocate.com | GoDaddy.com, LLC | 27 Dec 2009 | 29 Apr 2015 | 27 Dec 2016 |
| 510 | malpracticekaiser.com | GoDaddy.com, LLC | 12 Mar 2013 | 12 Mar 2023 | 12 Mar 2025 |
| 511 | malpracticepress.com | Launchpad, Inc. | 13 Feb 2014 | 29 Jan 2017 | 13 Feb 2018 |
| 512 | malpracticeconsultants.com | Annulet LLC | 16 May 2010 | 19 Aug 2024 | 16 May 2025 |
| 513 | malpracticelawyerny.com | NameCheap, Inc. | 1 Dec 2022 | 1 Nov 2024 | 1 Dec 2025 |
| 514 | malpracticeinsurancerates.com | Uniregistrar Corp | 31 Mar 2021 | 3 May 2023 | 31 Mar 2024 |
| 515 | malpracticeattorneynewjersey.com | GoDaddy.com, LLC | 6 Aug 2012 | 7 Aug 2024 | 6 Aug 2025 |
| 516 | malpracticeutahlegal.com | GoDaddy.com, LLC | 19 Jan 2007 | 19 Jan 2025 | 19 Jan 2026 |
| 517 | malpracticeattorneysny.com | Dynadot, LLC | 8 May 2023 | 18 Jul 2024 | 8 May 2024 |
| 518 | malpracticewatch.com | Domain.com, LLC | 6 May 2005 | 23 Apr 2016 | 6 May 2025 |
| 519 | malpracticeattorneystatesboroga.com | Tucows Domains Inc. | 25 Aug 2011 | 29 Aug 2017 | 25 Aug 2017 |
| 520 | malpractice-insurance-texas.com | GoDaddy.com, LLC | 27 May 2010 | 9 Mar 2024 | 8 Mar 2025 |
| 521 | malpracticelawyerindianapolis.com | DropCatch.com 544 LLC | 9 Apr 2023 | 20 Jun 2024 | 9 Apr 2024 |
| 522 | malpracticedatabase.com | GoDaddy.com, LLC | 8 Apr 2011 | 19 Mar 2024 | 8 Apr 2025 |
| 523 | malpracticeinsurancecalifornia.com | Domain.com, LLC | 26 Apr 2009 | 9 Apr 2024 | 26 Apr 2025 |
| 524 | malpracticeattorneysuffolkcounty.com | GoDaddy.com, LLC | 9 Sep 2011 | 10 Sep 2016 | 9 Sep 2017 |
| 525 | malpracticelawfirms.com | GoDaddy.com, LLC | 21 Nov 2003 | 1 Nov 2024 | 21 Nov 2025 |
| 526 | malpractice-lawfirm.com | GoDaddy.com, LLC | 16 Nov 1997 | 14 Nov 2024 | 15 Nov 2025 |
| 527 | malpracticeattorneyscalifornia.com | Beijing Lanhai Jiye Technology Co., Ltd | 11 Oct 2023 | 12 Oct 2024 | 11 Oct 2025 |
| 528 | malpracticeinsuranceshopper.com | Network Solutions, LLC | 28 Aug 2007 | 13 Aug 2024 | 28 Aug 2025 |
| 529 | malpracticeinsuranceproviders.com | Annulet LLC | 11 Dec 2012 | 26 Jan 2017 | 11 Dec 2017 |
| 530 | malpracticelawyersnyc.com | GoDaddy.com, LLC | 27 Apr 2021 | 28 Apr 2024 | 27 Apr 2025 |
| 531 | malpracticeupdate.com | GoDaddy.com, LLC | 8 Feb 2007 | 8 Feb 2014 | 8 Feb 2017 |
| 532 | malpracticeinsuranceagency.com | Brandsight, Inc. | 5 Feb 2010 | 5 Jan 2025 | 5 Feb 2026 |
| 533 | malpractice1.com | GoDaddy.com, LLC | 2 May 2014 | 2 May 2024 | 2 May 2025 |
| 534 | malpracticeinsurance24.com | GoDaddy.com, LLC | 27 Feb 2012 | 27 Feb 2012 | 27 Feb 2022 |
| 535 | malpracticeattorneyla.com | GoDaddy.com, LLC | 12 May 2014 | 18 May 2023 | 12 May 2025 |
| 536 | malpracticeinsurancemassachusetts.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 537 | malpracticelawyerinflorida.com | 1&1 Internet AG | 9 Aug 2012 | 15 Mar 2018 | 9 Aug 2025 |
| 538 | malpracticeinsurancecosts.com | GoDaddy.com, LLC | 3 Dec 2007 | 13 Nov 2024 | 3 Dec 2025 |
| 539 | malpracticelawfirmny.com | GoDaddy.com, LLC | 20 Dec 2011 | 31 Jan 2025 | 20 Dec 2024 |
| 540 | malpracticemedicaldallaslawyer.com | GoDaddy.com, LLC | 22 Apr 2012 | 4 May 2024 | 22 Apr 2025 |
| 541 | malpracticelawyerlosangeles.com | - | 9 Jun 2024 | 18 Oct 2024 | 9 Jun 2025 |
| 542 | malpracticecasereview.com | GoDaddy.com, LLC | 8 Aug 2012 | 9 Aug 2024 | 8 Aug 2025 |
| 543 | malpracticecases.com | Dynadot, LLC | 8 Aug 2001 | 26 Jul 2024 | 8 Aug 2025 |
| 544 | malpracticeinsurancepolicies.com | GoDaddy.com, LLC | 11 Jun 2008 | 11 Apr 2024 | 11 Jun 2025 |
| 545 | malpracticeattorneychicago.com | GoDaddy.com, LLC | 2 Jan 2021 | 3 Jan 2025 | 2 Jan 2026 |
| 546 | malpracticeexperts.com | Network Solutions, LLC | 8 Aug 1997 | 9 Aug 2024 | 7 Aug 2029 |
| 547 | malpracticeinformation.com | GoDaddy.com, LLC | 2 Mar 2013 | 13 Apr 2023 | 2 Mar 2023 |
| 548 | malpracticesettlement.com | GoDaddy.com, LLC | 19 Sep 2005 | 30 Aug 2024 | 19 Sep 2025 |
| 549 | malpracticelapcholy.com | GoDaddy.com, LLC | 13 May 2003 | 14 May 2016 | 13 May 2017 |
| 550 | malpracticedisputes.com | Fabulous.com Pty Ltd. | 18 Nov 2009 | 20 Oct 2016 | 18 Nov 2017 |
| 551 | malpracticeiqcenter.com | eNom, Inc. | 26 Feb 2013 | 28 Jan 2014 | 26 Feb 2018 |
| 552 | malpracticeinsurancepolicy.com | GoDaddy.com, LLC | 7 Apr 2008 | 8 Apr 2024 | 7 Apr 2025 |
| 553 | malpracticesaltlakecityattorney.com | GoDaddy.com, LLC | 19 Jan 2007 | 19 Jan 2025 | 19 Jan 2026 |
| 554 | malpracticelawyersftlauderdale.com | GoDaddy.com, LLC | 6 Jan 2010 | 7 Jan 2025 | 6 Jan 2027 |
| 555 | malpracticereporter.com | eNom, Inc. | 21 Sep 2012 | 6 Sep 2016 | 21 Sep 2016 |
| 556 | malpracticehelpines.com | GoDaddy.com, LLC | 8 Dec 2010 | 9 Dec 2015 | 8 Dec 2020 |
| 557 | malpracticeguide.com | NameCheap, Inc. | 22 Jan 2000 | 1 Oct 2024 | 27 Apr 2026 |
| 558 | malpracticealert.com | 1&1 Internet AG | 27 Jul 2006 | 28 Jul 2024 | 27 Jul 2025 |
| 559 | malpracticefirms.com | GoDaddy.com, LLC | 6 Dec 2000 | 16 Nov 2024 | 6 Dec 2025 |
| 560 | malpracticeexpert.com | Domainhostingweb, LLC | 18 Nov 2016 | 19 Nov 2024 | 18 Nov 2025 |
| 561 | malpracticelawyers911.com | GoDaddy.com, LLC | 22 Nov 2009 | 23 Nov 2024 | 22 Nov 2026 |
| 562 | malpracticeinsurancepremiums.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2016 | 28 Mar 2017 |
| 563 | malpractice-website.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 564 | malpracticelegaladvice.com | Omnis Network, LLC | 10 Aug 2000 | 11 Jul 2016 | 10 Aug 2017 |
| 565 | malpracticelawyernc.com | FastDomain Inc. | 26 Sep 2009 | 11 Sep 2024 | 26 Sep 2025 |
| 566 | malpracticelitigation.com | GoDaddy.com, LLC | 23 Jan 1999 | 3 Jan 2025 | 23 Jan 2026 |
| 567 | malpractice-lawsuit.com | Fabulous.com Pty Ltd. | 28 Aug 2003 | 29 Aug 2017 | 28 Aug 2018 |
| 568 | malpracticelegalteam.com | Wild West Domains, LLC | 26 Aug 2002 | 18 Sep 2015 | 26 Aug 2016 |
| 569 | malpractice-insurance-california.com | GoDaddy.com, LLC | 27 May 2010 | 9 Mar 2024 | 8 Mar 2025 |
| 570 | malpracticedmedia.com | NetEarth One Inc. d/b/a NetEarth | 3 Apr 2010 | 26 Mar 2024 | 3 Apr 2025 |
| 571 | malpracticehaven.com | GoDaddy.com, LLC | 11 Jan 2012 | 11 Jan 2025 | 11 Jan 2026 |
| 572 | malpracticeliability.com | GoDaddy.com, LLC | 28 Nov 1999 | 22 Nov 2024 | 28 Nov 2025 |
| 573 | malpracticelawyersny.com | NameCheap, Inc. | 8 Dec 2022 | 8 Nov 2024 | 8 Dec 2025 |
| 574 | malpracticereports.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 9 Nov 2021 | 10 Nov 2021 | 9 Nov 2022 |
| 575 | malpracticelawoffices.com | Name.com, Inc. | 17 Dec 2011 | 18 Dec 2016 | 17 Dec 2017 |
| 576 | malpractice-lawsuits.com | Fabulous.com Pty Ltd. | 30 Jul 2003 | 31 Jul 2017 | 30 Jul 2018 |
| 577 | malpracticeclaimlawyers.com | GoDaddy.com, LLC | 16 Oct 2008 | 29 Oct 2024 | 16 Oct 2025 |
| 578 | malpracticeinjuryattorneys.com | GoDaddy.com, LLC | 18 Aug 2003 | 15 Sep 2024 | 18 Aug 2025 |
| 579 | malpracticeevaluation.com | GoDaddy.com, LLC | 6 Apr 2006 | 7 Apr 2015 | 6 Apr 2017 |
| 580 | malpracticeannuity.com | GoDaddy.com, LLC | 19 Apr 2012 | 26 Mar 2016 | 19 Apr 2017 |
| 581 | malpracticeinsurance1.com | GoDaddy.com, LLC | 7 Mar 2012 | 7 Mar 2012 | 7 Mar 2022 |
| 582 | malpracticelawyersfirm.com | GoDaddy.com, LLC | 12 May 2014 | 13 May 2016 | 12 May 2017 |
| 583 | malpracticeinsurancenorthcarolina.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 584 | malpracticeattorneyindianapolis.com | GoDaddy.com, LLC | 18 May 2007 | 24 Jan 2013 | 18 May 2018 |
| 585 | malpracticelawyersnj.com | register.com, Inc. | 20 Jul 2004 | 21 Jul 2024 | 20 Jul 2025 |
| 586 | malpracticeplaintiffs.com | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 May 2004 | 5 May 2016 | 11 May 2017 |
| 587 | malpracticelawbrooklyn.com | eNom, Inc. | 5 Sep 2013 | 7 Aug 2024 | 5 Sep 2025 |
| 588 | malpracticelawyer24-7.com | GoDaddy.com, LLC | 22 Nov 2009 | 23 Nov 2024 | 22 Nov 2026 |
| 589 | malpracticelawcenter.com | GoDaddy.com, LLC | 8 Aug 2012 | 9 Aug 2024 | 8 Aug 2025 |
| 590 | malpracticemoney.com | GoDaddy.com, LLC | 21 Jun 2024 | 21 Jun 2024 | 21 Jun 2025 |
| 591 | malpracticeresources.com | GoDaddy.com, LLC | 29 Nov 2011 | 10 Jan 2020 | 29 Nov 2020 |
| 592 | malpracticenj.com | NameCheap, Inc. | 10 Jan 2024 | 11 Jan 2025 | 10 Jan 2026 |
| 593 | malpracticeinsurancetips.com | GoDaddy.com, LLC | 20 Feb 2010 | 20 Feb 2016 | 20 Feb 2017 |
| 594 | malpracticeattorneyhouston.com | GoDaddy.com, LLC | 6 Aug 2012 | 11 Aug 2016 | 6 Aug 2016 |
| 595 | malpractice-med.com | Network Solutions, LLC | 15 Apr 2004 | 15 Aug 2017 | 15 Apr 2019 |
| 596 | malpracticesaltlakecity.com | GoDaddy.com, LLC | 2 Dec 2010 | 3 Dec 2015 | 2 Dec 2016 |
| 597 | malpracticeinfo.com | GoDaddy.com, LLC | 16 Sep 2004 | 18 Sep 2024 | 18 Sep 2026 |
| 598 | malpracticelawresources.com | GoDaddy.com, LLC | 23 Jun 2014 | 27 May 2016 | 23 Jun 2017 |
| 599 | malpracticemn.com | Moniker Online Services LLC | 10 Aug 2010 | 30 Jul 2016 | 10 Aug 2017 |
| 600 | malpracticestatuteoflimitations.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2016 | 28 Mar 2017 |
| 601 | malpracticeinsuranceservices.com | GoDaddy.com, LLC | 17 Jul 2014 | 18 Jul 2023 | 17 Jul 2026 |
| 602 | malpracticetestifyingtraining.com | NameCheap, Inc. | 27 Mar 2014 | 26 Feb 2024 | 27 Mar 2025 |
| 603 | malpracticelawyerboston.com | GoDaddy.com, LLC | 24 Apr 2010 | 25 Apr 2024 | 24 Apr 2025 |
| 604 | malpracticeinjurylawfirm.com | GoDaddy.com, LLC | 22 Sep 2012 | 7 Oct 2015 | 22 Sep 2016 |
| 605 | malpracticelawwebsite.com | GoDaddy.com, LLC | 21 Mar 2007 | 22 Mar 2024 | 21 Mar 2025 |
| 606 | malpracticemediator.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Mar 2019 | 29 Jun 2020 | 25 Mar 2025 |
| 607 | malpracticecover.com | GoDaddy.com, LLC | 5 Feb 2025 | 5 Feb 2025 | 5 Feb 2026 |
| 608 | malpracticedmusic.com | - | 11 Sep 2022 | 12 Sep 2023 | 11 Sep 2024 |
| 609 | malpracticegraphics.com | Network Solutions, LLC | 30 Nov 2006 | 18 Aug 2016 | 30 Nov 2016 |
| 610 | malpracticeornot.com | Tucows Domains Inc. | 10 Aug 2009 | 27 Jul 2017 | 10 Aug 2018 |
| 611 | malpracticewiki.com | Fabulous.com Pty Ltd. | 24 Sep 2012 | 27 Jul 2017 | 24 Sep 2018 |
| 612 | malpracticepr.com | GoDaddy.com, LLC | 6 Dec 2008 | 7 Dec 2024 | 6 Dec 2025 |
| 613 | malpractice-site.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 614 | malpracticecoverage.com | GoDaddy.com, LLC | 21 Sep 2004 | 1 Sep 2024 | 21 Sep 2025 |
| 615 | malpracticelawyer4u.com | GoDaddy.com, LLC | 5 Mar 2007 | 4 Sep 2022 | 5 Mar 2027 |
| 616 | malpracticelawyers101.com | GoDaddy.com, LLC | 12 Jan 2008 | 13 Jan 2025 | 12 Jan 2026 |
| 617 | malpracticeblog.com | GoDaddy.com, LLC | 13 Sep 2005 | 24 Aug 2024 | 13 Sep 2025 |
| 618 | malpracticeinsurancegroup.com | GoDaddy.com, LLC | 5 Jan 2011 | 6 Jan 2016 | 5 Jan 2017 |
| 619 | malpracticelog.com | GoDaddy.com, LLC | 13 Sep 2011 | 28 Apr 2015 | 8 Jan 2017 |
| 620 | malpracticeinsurancerate.com | eNom, Inc. | 10 May 2006 | 3 May 2024 | 10 May 2025 |
| 621 | malpracticelawinfo.com | GoDaddy.com, LLC | 21 Mar 2007 | 22 Mar 2024 | 21 Mar 2025 |
| 622 | malpracticecrisis.com | GoDaddy.com, LLC | 2 Mar 2005 | 11 Feb 2024 | 2 Mar 2025 |
| 623 | malpracticeattorneyphilly.com | eNom, Inc. | 20 May 2011 | 19 May 2024 | 20 May 2025 |
| 624 | malpracticeriskassessment.com | GoDaddy.com, LLC | 21 Nov 2005 | 25 Jun 2024 | 17 Jul 2025 |
| 625 | malpracticeohio.com | Network Solutions, LLC | 29 Jan 2001 | 30 Nov 2024 | 29 Jan 2027 |
| 626 | malpracticemedical.com | GoDaddy.com, LLC | 29 Dec 2001 | 9 Dec 2024 | 29 Dec 2025 |
| 627 | malpracticestephenupdegraff.com | GoDaddy.com, LLC | 23 Nov 2011 | 24 Nov 2024 | 23 Nov 2025 |
| 628 | malpracticesuitsagainstdoctors.com | DomainLocal LLC | 12 Jun 2013 | 13 Jun 2017 | 12 Jun 2018 |
| 629 | malpracticebulletin.com | Network Solutions, LLC | 4 Apr 2008 | 4 Feb 2024 | 4 Apr 2025 |
| 630 | malpracticeattorneybillings.com | Tucows Domains Inc. | 20 May 2010 | 24 May 2017 | 20 May 2017 |
| 631 | malpracticearbitration.com | Hosting Concepts B.V. dba Openprovider | 15 Aug 2021 | 15 Aug 2021 | 15 Aug 2022 |
| 632 | malpracticeinvestigations.com | Network Solutions, LLC | 14 Nov 2000 | 18 Nov 2024 | 14 Nov 2025 |
| 633 | malpracticetriallawyer.com | Moniker Online Services LLC | 18 Jun 2001 | 10 Apr 2019 | 18 Jun 2020 |
| 634 | malpractice-reports.com | Tucows Domains Inc. | 7 Jun 2014 | 11 Jun 2018 | 7 Jun 2018 |
| 635 | malpracticetv.com | Porkbun, LLC | 9 Jun 2013 | 19 Apr 2024 | 9 Jun 2025 |
| 636 | malpracticeattorneyny.com | - | 29 Aug 2022 | 23 Sep 2024 | 29 Aug 2025 |
| 637 | malpracticeattorneyspgh.com | Moniker Online Services LLC | 30 Jan 2009 | 4 Feb 2022 | 30 Jan 2023 |
| 638 | malpracticelawyerbrooklyn.com | DropCatch.com 1406 LLC | 5 May 2017 | 15 Jul 2017 | 5 May 2018 |
| 639 | malpracticemi.com | Chengdu West Dimension Digital Technology Co., Ltd… | 13 Oct 2023 | 26 Nov 2024 | 13 Oct 2024 |
| 640 | malpracticeattorneymiami.com | GoDaddy.com, LLC | 5 Feb 2007 | 7 Jun 2023 | 6 Jun 2025 |
| 641 | malpracticelawyersphoenix.com | GoDaddy.com, LLC | 8 Jan 2010 | 9 Jan 2025 | 8 Jan 2026 |
| 642 | malpracticedirectory.com | GoDaddy.com, LLC | 26 Oct 2001 | 16 Jun 2024 | 26 Oct 2028 |
| 643 | malpracticeinsuranceohio.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 644 | malpracticeconnection.com | GoDaddy.com, LLC | 11 May 2010 | 12 May 2024 | 11 May 2025 |
| 645 | malpracticelawattorneys.com | NameKing.com Inc. | 8 Jul 2024 | 23 Jan 2025 | 8 Jul 2025 |
| 646 | malpractice-medical-sawayalaw.com | DomainPeople, Inc. | 17 Mar 2005 | 17 Feb 2016 | 17 Mar 2017 |
| 647 | malpractice-medical-attorney.com | GoDaddy.com, LLC | 16 Nov 2010 | 17 Nov 2015 | 16 Nov 2016 |
| 648 | malpracticelawyersandattorneys.com | eNom, Inc. | 29 Aug 2010 | 1 Sep 2016 | 29 Aug 2016 |
| 649 | malpracticeattorney.com | GoDaddy.com, LLC | 2 Mar 1999 | 24 Feb 2024 | 2 Mar 2025 |
| 650 | malpracticelawfirm.com | TurnCommerce, Inc. DBA NameBright.com | 1 Jul 2014 | 25 Jun 2020 | 1 Jul 2025 |
| 651 | malpracticedirect.com | GoDaddy.com, LLC | 29 Sep 2006 | 30 Sep 2023 | 29 Sep 2025 |
| 652 | malpracticeatbirth.com | eNom, Inc. | 5 Jun 2013 | 26 May 2016 | 5 Jun 2017 |
| 653 | malpracticepolicies.com | GoDaddy.com, LLC | 21 Sep 2004 | 1 Sep 2024 | 21 Sep 2025 |
| 654 | malpracticepolls.com | GoDaddy.com, LLC | 20 Feb 2012 | 3 Mar 2016 | 20 Feb 2017 |
| 655 | malpracticedoc.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 656 | malpracticedoctor.com | DomainLadder LLC | 17 Apr 2023 | 21 Apr 2023 | 17 Apr 2025 |
| 657 | malpracticehouston.com | GoDaddy.com, LLC | 8 Apr 2013 | 9 Apr 2024 | 8 Apr 2025 |
| 658 | malpracticenyc.com | Namesilo, LLC | 18 Oct 2006 | 19 Oct 2024 | 18 Oct 2025 |
| 659 | malpracticeinsurancedirect.com | GoDaddy.com, LLC | 30 Nov 2010 | 23 Nov 2011 | 30 Nov 2016 |
| 660 | malpracticewebsite.com | DropCatch.com 538 LLC | 19 Jul 2018 | 19 Jul 2018 | 19 Jul 2019 |
| 661 | malpracticelawyermaryland.com | GoDaddy.com, LLC | 28 May 2021 | 29 May 2024 | 28 May 2026 |
| 662 | malpracticelegalnurseconsulting.com | register.com, Inc. | 11 Nov 2013 | 22 Oct 2015 | 11 Nov 2016 |
| 663 | malpracticeonline.com | register.com, Inc. | 14 Aug 1999 | 15 Jul 2024 | 14 Aug 2025 |
| 664 | malpracticeclinic.com | GoDaddy.com, LLC | 21 Sep 2005 | 24 Aug 2016 | 21 Sep 2017 |
| 665 | malpracticeattorneyspittsburgh.com | - | 20 Apr 2022 | 11 May 2024 | 20 Apr 2025 |
| 666 | malpracticequestions.com | GoDaddy.com, LLC | 13 Mar 2001 | 4 Apr 2010 | 13 Aug 2017 |
| 667 | malpracticesuits.com | GoDaddy.com, LLC | 6 Feb 2012 | 11 Feb 2025 | 6 Feb 2026 |
| 668 | malpracticeattorneycolumbus.com | NameCheap, Inc. | 21 Mar 2019 | 21 Mar 2019 | 21 Mar 2020 |
| 669 | malpracticeattorneynetwork.com | GoDaddy.com, LLC | 14 Jan 2003 | 1 Sep 2022 | 14 Jan 2027 |
| 670 | malpracticeinsurancefaq.com | eNom, Inc. | 27 Apr 2011 | 12 Apr 2016 | 27 Apr 2018 |
| 671 | malpracticeinsuranceflorida.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 672 | malpracticesettlements.com | Network Solutions, LLC | 28 Jul 2004 | 29 May 2023 | 28 Jul 2026 |
| 673 | malpracticeone.com | GoDaddy.com, LLC | 4 Jun 2014 | 5 Jun 2024 | 4 Jun 2026 |
| 674 | malpracticelawyerstpaul.com | Tucows Domains Inc. | 21 Dec 2010 | 25 Dec 2016 | 21 Dec 2016 |
| 675 | malpracticelaws.com | GoDaddy.com, LLC | 18 Jul 2001 | 28 Jun 2024 | 18 Jul 2025 |
| 676 | malpracticelawyermassachusetts.com | GoDaddy.com, LLC | 17 Mar 2020 | 16 Nov 2022 | 17 Mar 2025 |
| 677 | malpracticeadvice.com | GoDaddy.com, LLC | 3 Nov 2004 | 29 Aug 2024 | 3 Nov 2025 |
| 678 | malpracticeattorneysfinder.com | GoDaddy.com, LLC | 17 Feb 2014 | 18 Feb 2016 | 17 Feb 2017 |
| 679 | malpracticesolutions.com | eNom, Inc. | 14 Jul 2003 | 19 Jun 2024 | 14 Jul 2025 |
| 680 | malpracticevictim.com | GoDaddy.com, LLC | 4 Apr 2007 | 5 Apr 2024 | 4 Apr 2025 |
| 681 | malpractice-lawyers.com | GoDaddy.com, LLC | 13 Jun 1998 | 10 Jun 2024 | 12 Jun 2025 |
| 682 | malpractice-injury.com | eNom, Inc. | 18 Aug 2003 | 30 Sep 2017 | 18 Aug 2017 |
| 683 | malpracticeattorneysriverside.com | GoDaddy.com, LLC | 12 Nov 2009 | 13 Nov 2024 | 12 Nov 2025 |
| 684 | malpracticeinsurancecoverage.com | Dynadot, LLC | 9 May 2017 | 9 May 2017 | 9 May 2018 |
| 685 | malpracticeradiology.com | GoDaddy.com, LLC | 31 Oct 2019 | 31 Oct 2019 | 31 Oct 2020 |
| 686 | malpracticeinsuranceagents.com | GoDaddy.com, LLC | 9 Mar 2011 | 10 Mar 2016 | 9 Mar 2017 |
| 687 | malpracticeattorneyspages.com | GoDaddy.com, LLC | 13 Sep 2009 | 25 Nov 2024 | 13 Sep 2024 |
| 688 | malpracticeinsurancespecialist.com | GoDaddy.com, LLC | 7 Nov 2008 | 12 Nov 2015 | 7 Nov 2016 |
| 689 | malpracticelawcleveland.com | eNom, Inc. | 22 Jan 2014 | 24 Dec 2014 | 22 Jan 2017 |
| 690 | malpracticereport.com | GoDaddy.com, LLC | 4 Jul 2001 | 15 Jun 2024 | 4 Jul 2025 |
| 691 | malpracticeattorneyanthonyfiore.com | eNom, Inc. | 20 May 2011 | 19 May 2024 | 20 May 2025 |
| 692 | malpracticedoctors.com | Dot Holding Inc. | 17 Jul 2003 | 15 Aug 2024 | 14 Apr 2026 |
| 693 | malpracticeattorneyoregon.com | Tucows Domains Inc. | 17 Apr 2010 | 4 Jul 2024 | 17 Apr 2025 |
| 694 | malpracticeupdegraff.com | GoDaddy.com, LLC | 23 Nov 2011 | 24 Nov 2024 | 23 Nov 2025 |
| 695 | malpracticedefenselawyer.com | GoDaddy.com, LLC | 11 Sep 2004 | 31 Aug 2024 | 11 Sep 2025 |
| 696 | malpracticeorlando.com | GoDaddy.com, LLC | 14 Aug 2013 | 14 Aug 2024 | 14 Aug 2025 |
| 697 | malpracticelawyerohio.com | Cosmotown, Inc. | 25 Aug 2023 | 5 Oct 2024 | 25 Aug 2024 |
| 698 | malpracticeinsurancenewjersey.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 699 | malpracticeattorneysca.com | GoDaddy.com, LLC | 28 Feb 2014 | 5 May 2015 | 28 Feb 2017 |
| 700 | malpracticeattorneyportland.com | GoDaddy.com, LLC | 18 Jun 2009 | 30 Aug 2023 | 18 Jun 2023 |
| 701 | malpracticerisk.com | DomainAdministration.com, LLC | 19 Nov 2010 | 4 Jan 2025 | 19 Nov 2025 |
| 702 | malpracticeinsuranceutah.com | Domain.com, LLC | 26 Apr 2009 | 9 Apr 2024 | 26 Apr 2025 |
| 703 | malpracticeinsuranceillinois.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 704 | malpracticeoffers.com | GoDaddy.com, LLC | 17 Jul 2014 | 18 Jul 2023 | 17 Jul 2026 |
| 705 | malpracticeinfoblog.com | GoDaddy.com, LLC | 18 Sep 2008 | 19 Sep 2015 | 18 Sep 2016 |
| 706 | malpracticemodels.com | GoDaddy.com, LLC | 9 Nov 2012 | 10 Nov 2024 | 9 Nov 2025 |
| 707 | malpracticeesq.com | GoDaddy.com, LLC | 5 Jan 2013 | 6 Jan 2016 | 5 Jan 2018 |
| 708 | malpracticelawyersmissouri.com | GoDaddy.com, LLC | 25 Apr 2013 | 25 Apr 2013 | 25 Apr 2018 |
| 709 | malpracticecounselor.com | GoDaddy.com, LLC | 25 Oct 2010 | 26 Oct 2015 | 25 Oct 2016 |
| 710 | malpracticelaw.com | GoDaddy.com, LLC | 31 Dec 1995 | 10 Dec 2024 | 30 Dec 2026 |
| 711 | malpracticelitigator.com | Azdomainz LLC | 2 Jan 2013 | 17 Feb 2025 | 2 Jan 2026 |
| 712 | malpracticejudgements.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 2 Aug 2023 | 10 Aug 2024 | 2 Aug 2024 |
| 713 | malpracticelawyerdetroit.com | GoDaddy.com, LLC | 12 Aug 2010 | 2 May 2016 | 2 May 2017 |
| 714 | malpracticelawhelp.com | GoDaddy.com, LLC | 13 Mar 2014 | 27 Apr 2015 | 13 Mar 2017 |
| 715 | malpracticelawexpert.com | GoDaddy.com, LLC | 14 Feb 2000 | 15 Feb 2025 | 14 Feb 2026 |
| 716 | malpracticeinsuranceonline.com | Dynadot, LLC | 11 Jan 2023 | 20 Feb 2024 | 11 Jan 2024 |
| 717 | malpracticeinjury.com | GoDaddy.com, LLC | 21 May 2001 | 1 May 2024 | 21 May 2025 |
| 718 | malpractice2ndopinion.com | GoDaddy.com, LLC | 26 Jul 2013 | 27 Jul 2016 | 26 Jul 2017 |
| 719 | malpracticeattorneypgh.com | Moniker Online Services LLC | 30 Jan 2009 | 4 Feb 2022 | 30 Jan 2023 |
| 720 | malpracticequote.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jul 2017 | 19 Jul 2020 | 25 Jul 2025 |
| 721 | malpracticelawnewyork.com | eNom, Inc. | 5 Sep 2013 | 7 Aug 2024 | 5 Sep 2025 |
| 722 | malpracticeins.com | Porkbun, LLC | 13 Feb 2020 | 12 Feb 2025 | 13 Feb 2026 |
| 723 | malpracticetracker.com | GoDaddy.com, LLC | 31 Jul 2008 | 1 Aug 2023 | 31 Jul 2025 |
| 724 | malpracticesurvival.com | GoDaddy.com, LLC | 7 Feb 2006 | 9 Feb 2025 | 7 Feb 2026 |
| 725 | malpracticecarolina.com | register.com, Inc. | 11 May 2013 | 11 May 2013 | 11 May 2018 |
| 726 | malpracticemaryland.com | Dynadot, LLC | 4 Jan 2024 | 9 Jan 2025 | 4 Jan 2026 |
| 727 | malpracticepros.com | Network Solutions, LLC | 7 Sep 2001 | 15 Aug 2017 | 7 Sep 2018 |
| 728 | malpractice-medical.com | HiChina Zhicheng Technology Limited | 7 Jul 2018 | 8 Jul 2018 | 7 Jul 2019 |
| 729 | malpracticehotline.com | NameCheap, Inc. | 4 Mar 2014 | 3 Feb 2024 | 4 Mar 2025 |
| 730 | malpracticelawyermarylandblog.com | GoDaddy.com, LLC | 28 Apr 2009 | 2 Nov 2017 | 28 Apr 2021 |
| 731 | malpracticelawyerhouston.com | eNom, Inc. | 11 Apr 2012 | 13 Mar 2016 | 11 Apr 2017 |
| 732 | malpractice123.com | GoDaddy.com, LLC | 1 May 2014 | 2 May 2024 | 1 May 2025 |
| 733 | malpractice911.com | GoDaddy.com, LLC | 13 Jul 2007 | 14 Jul 2024 | 13 Jul 2026 |
| 734 | malpracticelawyersusa.com | GoDaddy.com, LLC | 30 Mar 2023 | 19 Feb 2024 | 30 Mar 2025 |
| 735 | malpracticesolution.com | GoDaddy.com, LLC | 11 May 2010 | 12 May 2024 | 11 May 2025 |
| 736 | malpracticeattorneyspringfieldma.com | register.com, Inc. | 14 Jun 2012 | 11 Oct 2015 | 14 Jun 2017 |
| 737 | malpracticeauthority.com | Network Solutions, LLC | 27 Dec 2013 | 28 Oct 2015 | 27 Dec 2016 |
| 738 | malpracticelawyerfinder.com | GoDaddy.com, LLC | 14 Jul 2014 | 15 Jul 2016 | 14 Jul 2017 |
| 739 | malpracticecosts.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2024 | 28 Mar 2025 |
| 740 | malpracticelawyers24-7.com | GoDaddy.com, LLC | 22 Nov 2009 | 23 Nov 2024 | 22 Nov 2026 |
| 741 | malpracticeattorneykalamazoo.com | Tucows Domains Inc. | 25 Feb 2011 | 27 Jan 2025 | 25 Feb 2026 |
| 742 | malpractice-dental.com | GoDaddy.com, LLC | 12 May 2006 | 13 May 2024 | 12 May 2025 |
| 743 | malpracticecancer.com | GoDaddy.com, LLC | 20 Jun 2007 | 21 Jun 2024 | 20 Jun 2025 |
| 744 | malpracticeattorneylosangeles.com | Go Canada Domains, LLC | 26 Apr 2011 | 15 Apr 2013 | 31 Dec 2016 |
| 745 | malpracticerightsguide.com | Network Solutions, LLC | 21 Dec 2007 | 22 Oct 2022 | 21 Dec 2025 |
| 746 | malpracticelawyellowpages.com | GoDaddy.com, LLC | 20 Mar 2004 | 14 Nov 2014 | 20 Dec 2016 |
| 747 | malpracticeinsurancemaryland.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 748 | malpracticeinjuries.com | GoDaddy.com, LLC | 21 May 2001 | 1 May 2024 | 21 May 2025 |
| 749 | malpracticecomplaints.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2024 | 28 Mar 2025 |
| 750 | malpracticeinsurancenewyork.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 751 | malpracticereview.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 16 May 2005 | 16 May 2024 | 16 May 2025 |
| 752 | malpracticepa.com | Jiangsu Bangning Science and technology Co. Ltd. | 10 Nov 2021 | 10 Nov 2021 | 10 Nov 2022 |
| 753 | malpracticeinsurancemedical.com | GoDaddy.com, LLC | 8 Jun 2013 | 24 Jun 2016 | 8 Jun 2017 |
| 754 | malpracticelawyerstlouis.com | GoDaddy.com, LLC | 25 Apr 2013 | 25 Apr 2013 | 25 Apr 2018 |
| 755 | malpracticeatty.com | GoDaddy.com, LLC | 4 Mar 2008 | 13 Feb 2024 | 4 Mar 2025 |
| 756 | malpracticenys.com | Network Solutions, LLC | 7 Sep 2011 | 8 Aug 2022 | 7 Sep 2025 |
| 757 | malpractice-attorneys.com | GoDaddy.com, LLC | 30 Jan 1999 | 25 Jan 2025 | 30 Jan 2026 |
| 758 | malpracticequotesonline.com | GoDaddy.com, LLC | 17 Jul 2014 | 18 Jul 2023 | 17 Jul 2026 |
| 759 | malpracticeinsurancearizona.com | Domain.com, LLC | 17 Feb 2009 | 28 Jan 2025 | 17 Feb 2026 |
| 760 | malpracticeinsurance.com | DNC Holdings, Inc. | 17 Sep 1997 | 3 Aug 2024 | 16 Sep 2025 |
| 761 | malpracticeattorneyutah.com | GoDaddy.com, LLC | 10 Aug 2014 | 22 Oct 2024 | 10 Aug 2024 |
| 762 | malpracticefordentists.com | GoDaddy.com, LLC | 4 Mar 2013 | 5 Mar 2023 | 4 Mar 2028 |
| 763 | malpracticelawyersphiladelphia.com | Wild West Domains, LLC | 27 Dec 2011 | 28 Dec 2024 | 27 Dec 2025 |
| 764 | malpracticelawyerschicago.com | DropCatch.com 661 LLC | 28 Mar 2024 | 19 Sep 2024 | 28 Mar 2025 |
| 765 | malpracticeinsuranceplan.com | GoDaddy.com, LLC | 31 May 2011 | 6 May 2024 | 31 May 2025 |
| 766 | malpracticefordoctors.com | GoDaddy.com, LLC | 4 Mar 2013 | 5 Mar 2023 | 4 Mar 2028 |
| 767 | malpracticestanger.com | Network Solutions, LLC | 7 Nov 2001 | 8 Sep 2022 | 7 Nov 2027 |
| 768 | malpracticelawyer.com | GoDaddy.com, LLC | 18 Sep 1999 | 30 Aug 2024 | 18 Sep 2025 |
| 769 | malpracticesanantonio.com | Namesilo, LLC | 28 Sep 2020 | 29 Sep 2020 | 28 Sep 2021 |
| 770 | malpracticecost.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2024 | 28 Mar 2025 |
| 771 | malpracticecase.com | GoDaddy.com, LLC | 8 Aug 2001 | 19 Jul 2024 | 8 Aug 2025 |
| 772 | malpracticeawards.com | Dynadot14 LLC | 13 Sep 2022 | 23 Nov 2023 | 13 Sep 2023 |
| 773 | malpracticelawyers.com | Uniregistrar Corp | 26 Sep 2000 | 17 Aug 2023 | 26 Sep 2031 |
| 774 | malpracticeinsurancefordoctors.com | GoDaddy.com, LLC | 7 May 2010 | 8 May 2024 | 7 May 2025 |
| 775 | malpracticelawhome.com | GoDaddy.com, LLC | 11 Jul 2007 | 12 Jul 2024 | 11 Jul 2025 |
| 776 | malpracticeattorneysin.com | GoDaddy.com, LLC | 6 Aug 2011 | 7 Aug 2024 | 6 Aug 2025 |
| 777 | malpractice-lawyer-new-york.com | Network Solutions, LLC | 19 Jul 2006 | 20 May 2021 | 19 Jul 2026 |
| 778 | malpracticelawyersinflorida.com | Network Solutions, LLC | 28 Jun 2011 | 10 Sep 2023 | 28 Jun 2023 |
| 779 | malpracticelawyerflorida.com | One.com A/S | 29 Jan 2025 | 29 Jan 2025 | 29 Jan 2026 |
| 780 | malpracticedepositions.com | GoDaddy.com, LLC | 1 Jan 2009 | 29 Apr 2024 | 1 Jan 2026 |
| 781 | malpractice-medical-insurance.com | 1&1 Internet AG | 19 Mar 2009 | 15 Mar 2018 | 19 Mar 2025 |
| 782 | malpractice-lawyer-news.com | Name.com, Inc. | 16 Nov 2008 | 6 Oct 2017 | 16 Nov 2018 |
| 783 | malpracticerates.com | Hosting Concepts B.V. dba Openprovider | 30 Dec 2021 | 31 Dec 2021 | 30 Dec 2022 |
| 784 | malpracticestangers.com | Network Solutions, LLC | 24 Sep 2015 | 16 Oct 2017 | 15 Dec 2018 |
| 785 | malpracticemd.com | GoDaddy.com, LLC | 21 Oct 2010 | 22 Oct 2024 | 21 Oct 2025 |
| 786 | malpracticeinsurancebrokers.com | GoDaddy.com, LLC | 21 Aug 2014 | 22 Aug 2024 | 21 Aug 2025 |
| 787 | malpracticelawyerbaltimore.com | GoDaddy.com, LLC | 16 Mar 2009 | 17 Mar 2024 | 16 Mar 2025 |
| 788 | malpracticeinsurancecompany.com | GoDaddy.com, LLC | 25 Mar 2010 | 5 Mar 2024 | 25 Mar 2025 |
| 789 | malpracticesuite.com | 1&1 Internet AG | 24 Aug 2010 | 25 Aug 2016 | 24 Aug 2018 |
| 790 | malpracticecom.com | Rebel.com Corp. | 10 Nov 2006 | 15 Dec 2015 | 10 Nov 2016 |
| 791 | malpracticeattorneyspa.com | Moniker Online Services LLC | 30 Jan 2009 | 4 Feb 2022 | 30 Jan 2023 |
| 792 | malpractice-law-firm.com | GoDaddy.com, LLC | 31 Aug 2009 | 16 Mar 2024 | 15 Mar 2025 |
| 793 | malpracticequotes.com | GoDaddy.com, LLC | 14 Feb 2006 | 15 Feb 2025 | 14 Feb 2026 |
| 794 | malpracticebroker.com | GoDaddy.com, LLC | 6 Apr 2009 | 15 Mar 2024 | 6 Apr 2025 |
| 795 | malpracticeinflorida.com | TierraNet Inc. d/b/a DomainDiscover | 29 Aug 2004 | 30 Aug 2016 | 29 Aug 2016 |
| 796 | malpracticeteam.com | GoDaddy.com, LLC | 14 Sep 2012 | 12 Sep 2022 | 14 Sep 2027 |
| 797 | malpracticewarrior.com | Network Solutions, LLC | 23 Mar 2000 | 21 Jan 2025 | 23 Mar 2027 |
| 798 | malpracticeclaims.com | Network Solutions, LLC | 12 Apr 2003 | 15 May 2024 | 12 Apr 2026 |
| 799 | malpracticeinsurancecost.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2024 | 28 Mar 2025 |
| 800 | malpracticeinsurancenys.com | Network Solutions, LLC | 7 Sep 2011 | 8 Aug 2022 | 7 Sep 2025 |
| 801 | malpracticeattorneynewyork.com | DropCatch.com 497 LLC | 4 Jun 2024 | 7 Nov 2024 | 4 Jun 2025 |
| 802 | malpracticeoklahoma.com | GoDaddy.com, LLC | 16 Sep 2010 | 17 Sep 2024 | 16 Sep 2025 |
| 803 | malpracticelattorneyswv.com | GoDaddy.com, LLC | 9 Jul 2008 | 10 Jul 2016 | 9 Jul 2017 |
| 804 | malpracticeattorneysmaryland.com | - | 26 May 2022 | 24 Jun 2024 | 26 May 2025 |
| 805 | malpracticespecialist.com | GoDaddy.com, LLC | 15 Oct 2005 | 3 Oct 2024 | 15 Oct 2025 |
| 806 | malpracticestatutes.com | Fabulous.com Pty Ltd. | 23 Oct 2009 | 16 Oct 2017 | 23 Oct 2018 |
| 807 | malpracticemiami.com | - | 17 Feb 2025 | 17 Feb 2025 | 17 Feb 2026 |
| 808 | malpracticehelpline.com | GoDaddy.com, LLC | 10 Nov 2010 | 11 Nov 2022 | 10 Nov 2027 |
| 809 | malpracticeattorneyohio.com | Dynadot, LLC | 28 Nov 2023 | 7 Feb 2025 | 28 Nov 2024 |
| 810 | malpracticeprotection.com | NameKing.com Inc. | 7 Jun 2024 | 28 Oct 2024 | 7 Jun 2025 |
| 811 | malpractice-lapcholy.com | GoDaddy.com, LLC | 13 May 2003 | 14 May 2016 | 13 May 2017 |
| 812 | malpracticeattorneytexas.com | GoDaddy.com, LLC | 19 Aug 2011 | 20 Aug 2024 | 19 Aug 2025 |
| 813 | malpractice-expert.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 814 | malpracticeinvestigator.com | GoDaddy.com, LLC | 27 Apr 2013 | 28 Apr 2016 | 27 Apr 2017 |
| 815 | malpracticeattorneyregistry.com | GoDaddy.com, LLC | 10 Apr 2008 | 11 Apr 2024 | 10 Apr 2025 |
| 816 | malpracticemediation.com | Dynadot, LLC | 28 Dec 2023 | 19 Dec 2024 | 28 Dec 2025 |
| 817 | malpracticema.com | GoDaddy.com, LLC | 23 Nov 2021 | 16 Jun 2024 | 23 Nov 2026 |
| 818 | malpracticelawyersmedical.com | NameCheap, Inc. | 6 Feb 2025 | 6 Feb 2025 | 6 Feb 2026 |
| 819 | malpracticeprevention.com | NameCheap, Inc. | 18 Oct 2022 | 18 Oct 2022 | 18 Oct 2023 |
| 820 | malpracticeinsurancepennsylvania.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 821 | malpracticeutahattorney.com | GoDaddy.com, LLC | 19 Jan 2007 | 19 Jan 2025 | 19 Jan 2026 |
| 822 | malpracticeinsurancenevada.com | Domain.com, LLC | 4 Mar 2009 | 9 Feb 2024 | 4 Mar 2025 |
| 823 | malpracticepoll.com | GoDaddy.com, LLC | 20 Feb 2012 | 3 Mar 2016 | 20 Feb 2017 |
| 824 | malpracticemichigan.com | DropCatch.com 918 LLC | 30 Mar 2018 | 30 Mar 2018 | 30 Mar 2019 |
| 825 | malpracticereviews.com | CloudFlare, Inc. | 5 Sep 2021 | 17 Oct 2024 | 5 Sep 2025 |
| 826 | malpractice-law.com | GoDaddy.com, LLC | 12 Nov 1997 | 11 Nov 2024 | 11 Nov 2025 |
| 827 | malpracticeinsurancegeorgia.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 828 | malpracticebima.com | Dynadot, LLC | 26 Mar 2012 | 27 Aug 2024 | 26 Mar 2026 |
| 829 | malpracticelawyeryellowpages.com | GoDaddy.com, LLC | 5 May 2004 | 14 Nov 2014 | 20 Dec 2016 |
| 830 | malpracticepolicy.com | Epik Inc. | 25 Oct 2019 | 19 Oct 2021 | 25 Oct 2025 |
| 831 | malpracticevirginialawyer.com | GoDaddy.com, LLC | 4 Aug 2008 | 5 Aug 2015 | 4 Aug 2017 |
| 832 | malpractice-insurance.com | NameCheap, Inc. | 22 Aug 2024 | 11 Dec 2024 | 22 Aug 2025 |
| 833 | malpracticeattorneyfinder.com | GoDaddy.com, LLC | 5 Apr 2017 | 28 Mar 2018 | 5 Apr 2019 |
| 834 | malpracticeattorneylasvegas.com | NameCheap, Inc. | 24 May 2023 | 5 Aug 2024 | 24 May 2024 |
| 835 | malpracticeattorneygainesvillega.com | Tucows Domains Inc. | 23 Jun 2010 | 27 Jun 2017 | 23 Jun 2017 |
| 836 | malpractice-legal.com | GoDaddy.com, LLC | 8 Oct 2012 | 9 Oct 2015 | 8 Oct 2016 |
| 837 | malpracticeforcpas.com | GoDaddy.com, LLC | 11 Mar 2013 | 12 Mar 2023 | 11 Mar 2028 |
| 838 | malpracticeattorneyschicago.com | Google, Inc. | 20 Apr 2022 | 21 Apr 2023 | 20 Apr 2024 |
| 839 | malpracticelawyers247.com | Moniker Online Services LLC | 26 Jan 2005 | 24 Jan 2025 | 26 Jan 2026 |
| 840 | malpracticeattorneysbrooklyn.com | register.com, Inc. | 11 Jul 2007 | 16 Jul 2010 | 11 Jul 2018 |
| 841 | malpracticelawsite.com | GoDaddy.com, LLC | 21 Mar 2007 | 22 Mar 2024 | 21 Mar 2025 |
| 842 | malpracticemedicalattorney.com | GoDaddy.com, LLC | 24 Aug 2010 | 8 Sep 2022 | 24 Aug 2025 |
| 843 | malpracticelawyerpennsylvania.com | ! #1 Host Japan, Inc. | 13 Sep 2024 | 13 Sep 2024 | 13 Sep 2025 |
| 844 | malpractice-case.com | NameCheap, Inc. | 5 Apr 2011 | 6 Mar 2024 | 5 Apr 2025 |
| 845 | malpracticeintexas.com | Network Solutions, LLC | 20 Mar 2012 | 25 Apr 2017 | 20 Mar 2018 |
| 846 | malpracticemedicalinsurance.com | 1&1 Internet AG | 19 Mar 2009 | 15 Mar 2018 | 19 Mar 2025 |
| 847 | malpracticesutahlawyers.com | GoDaddy.com, LLC | 19 Jan 2007 | 19 Jan 2025 | 19 Jan 2026 |
| 848 | malpracticeboston.com | DropCatch.com 564 LLC | 27 Dec 2018 | 27 Dec 2018 | 27 Dec 2019 |
| 849 | malpracticelawyersmaryland.com | GoDaddy.com, LLC | 11 Oct 2012 | 12 Oct 2024 | 11 Oct 2025 |
| 850 | malpracticeinsurancevirginia.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 851 | malpracticeband.com | DropCatch.com 738 LLC | 1 May 2023 | 28 May 2024 | 1 May 2025 |
| 852 | malpracticelawyersbocaraton.com | GoDaddy.com, LLC | 6 Jan 2010 | 7 Jan 2025 | 6 Jan 2027 |
| 853 | malpracticeclaimlawyer.com | GoDaddy.com, LLC | 18 Oct 2008 | 28 Sep 2024 | 18 Oct 2025 |
| 854 | malpracticeinsuranceny.com | GoDaddy.com, LLC | 12 Jul 2010 | 12 Jul 2010 | 12 Jul 2020 |
| 855 | malpracticedefenseflorida.com | Fabulous.com Pty Ltd. | 28 Feb 2011 | 21 Jan 2025 | 28 Feb 2026 |
| 856 | malpracticedeath.com | GoDaddy.com, LLC | 4 Aug 2003 | 15 Jul 2024 | 4 Aug 2025 |
| 857 | malpracticespecialists.com | Rabbitsfoot.com LLC d/b/a Oxygen.nyc | 8 Jun 2005 | 26 Jun 2024 | 8 Jun 2025 |
| 858 | malpracticedds.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 859 | malpracticeattorneypa.com | - | 20 Apr 2022 | 11 May 2024 | 20 Apr 2025 |
| 860 | malpractice-law-group.com | GoDaddy.com, LLC | 22 Nov 2010 | 23 Nov 2016 | 22 Nov 2018 |
| 861 | malpracticeinsurancesouthcarolina.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 862 | malpracticebook.com | GoDaddy.com, LLC | 1 May 2008 | 21 Sep 2024 | 16 Sep 2026 |
| 863 | malpracticeadvance.com | - | 7 Jul 2022 | 7 Jul 2023 | 7 Jul 2024 |
| 864 | malpracticejudgments.com | GoDaddy.com, LLC | 12 Feb 2010 | 9 Feb 2015 | 12 Feb 2017 |
| 865 | malpracticecanada.com | GoDaddy.com, LLC | 15 Apr 2011 | 9 Sep 2022 | 15 Apr 2025 |
| 866 | malpracticeinsurancecompanies.com | GoDaddy.com, LLC | 29 Jul 2005 | 30 Jul 2024 | 29 Jul 2025 |
| 867 | malpracticeinsurancequote.com | GoDaddy.com, LLC | 9 Apr 2010 | 20 Mar 2024 | 9 Apr 2025 |
| 868 | malpracticeinoregon.com | GoDaddy.com, LLC | 25 May 2006 | 26 May 2016 | 25 May 2017 |
| 869 | malpracticelegalinfo.com | GoDaddy.com, LLC | 21 Mar 2007 | 22 Mar 2024 | 21 Mar 2025 |
| 870 | malpracticeattorneysonline.com | GoDaddy.com, LLC | 13 Sep 2003 | 24 Aug 2024 | 13 Sep 2025 |
| 871 | malpracticelosangeles.com | eNom, Inc. | 19 Jan 2009 | 21 Dec 2024 | 19 Jan 2026 |
| 872 | malpractice4docs.com | Network Solutions, LLC | 19 Feb 2000 | 20 Dec 2024 | 19 Feb 2026 |
| 873 | malpracticelawsuit.com | GoDaddy.com, LLC | 5 Feb 2004 | 16 Jan 2025 | 5 Feb 2026 |
| 874 | malpracticelawyermichigan.com | Cosmotown, Inc. | 25 Aug 2023 | 5 Oct 2024 | 25 Aug 2024 |
| 875 | malpractice-plaintiffs.com | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 May 2004 | 5 May 2016 | 11 May 2017 |
| 876 | malpracticelegal.com | Network Solutions, LLC | 11 Oct 2003 | 9 Jul 2024 | 11 Oct 2025 |
| 877 | malpracticeattorneyomaha.com | Tucows Domains Inc. | 25 Feb 2013 | 1 Mar 2018 | 25 Feb 2018 |
| 878 | malpracticeresolution.com | Network Solutions, LLC | 10 Nov 2023 | 23 Dec 2024 | 10 Nov 2024 |
| 879 | malpracticesandiego.com | Dynadot, LLC | 16 Jan 2024 | 20 Jan 2025 | 16 Jan 2026 |
| 880 | malpracticeinsuranceforsurgeons.com | Google, Inc. | 9 Apr 2023 | 9 Jun 2024 | 9 Apr 2024 |
| 881 | malpracticelink.com | register.com, Inc. | 8 Dec 2004 | 8 Dec 2004 | 8 Dec 2018 |
| 882 | malpracticefacts.com | GoDaddy.com, LLC | 9 Mar 2006 | 9 Mar 2024 | 9 Mar 2025 |
| 883 | malpracticesaltlakecitylawyer.com | GoDaddy.com, LLC | 19 Jan 2007 | 19 Jan 2025 | 19 Jan 2026 |
| 884 | malpracticeattorney4u.com | GoDaddy.com, LLC | 5 Mar 2007 | 4 Sep 2022 | 5 Mar 2027 |
| 885 | malpracticebasics.com | GoDaddy.com, LLC | 16 Sep 2009 | 16 Sep 2024 | 16 Sep 2026 |
| 886 | malpracticeinsurancefordentist.com | Network Solutions, LLC | 19 Jun 2013 | 20 Sep 2017 | 19 Jun 2018 |
| 887 | malpracticedefenseattorney.com | register.com, Inc. | 25 Mar 2005 | 25 Mar 2024 | 25 Mar 2025 |
| 888 | malpracticela.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 Aug 2022 | 1 Sep 2023 | 31 Aug 2024 |
| 889 | malpracticedrupdegraff.com | GoDaddy.com, LLC | 23 Nov 2011 | 24 Nov 2024 | 23 Nov 2025 |
| 890 | malpracticephysician.com | GoDaddy.com, LLC | 16 Mar 2007 | 18 Apr 2015 | 16 Mar 2017 |
| 891 | malpracticeamerica.com | Namesilo, LLC | 18 Oct 2006 | 17 Nov 2017 | 18 Oct 2018 |
| 892 | malpracticeinsurancecolorado.com | Domain.com, LLC | 1 May 2009 | 11 Apr 2024 | 1 May 2025 |
| 893 | malpracticelawga.com | GoDaddy.com, LLC | 25 Dec 2010 | 26 Dec 2015 | 25 Dec 2016 |
| 894 | malpracticedetective.com | GoDaddy.com, LLC | 3 Sep 2006 | 3 Sep 2016 | 3 Sep 2017 |
| 895 | malpracticeflorida.com | GoDaddy.com, LLC | 19 Mar 2000 | 19 Mar 2024 | 19 Mar 2025 |
| 896 | malpracticelawyerla.com | GoDaddy.com, LLC | 3 Jan 2014 | 4 Jan 2025 | 3 Jan 2026 |
| 897 | malpracticeinsurance-api.com | Wild West Domains, LLC | 29 Sep 2010 | 4 Oct 2024 | 29 Sep 2026 |
| 898 | malpracticesuit.com | GoDaddy.com, LLC | 21 Jun 2003 | 1 Jun 2024 | 21 Jun 2025 |
| 899 | malpracticeconnections.com | GoDaddy.com, LLC | 11 May 2010 | 12 May 2024 | 11 May 2025 |
| 900 | malpracticeconsult.com | GoDaddy.com, LLC | 18 Oct 2018 | 19 Oct 2024 | 18 Oct 2025 |
| 901 | malpracticelawyersmanhattan.com | Dot Holding Inc. | 3 Aug 2004 | 15 Sep 2023 | 3 Aug 2023 |
| 902 | malpractice360.com | GoDaddy.com, LLC | 6 Sep 2005 | 7 Aug 2016 | 6 Sep 2017 |
| 903 | malpracticelawyershawaii.com | register.com, Inc. | 3 Oct 2011 | 4 Oct 2024 | 3 Oct 2025 |
| 904 | malpracticelawyernewjersey.com | GoDaddy.com, LLC | 17 Mar 2020 | 16 Nov 2022 | 17 Mar 2025 |
| 905 | malpracticepayments.com | GoDaddy.com, LLC | 19 Apr 2012 | 30 Mar 2016 | 19 Apr 2017 |
| 906 | malpracticereviewer.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 907 | malpracticeattorneyphiladelphia.com | GoDaddy.com, LLC | 27 Apr 2011 | 27 Apr 2024 | 27 Apr 2025 |
| 908 | malpracticelawyersbrooklyn.com | Cosmotown, Inc. | 8 Aug 2023 | 18 Sep 2024 | 8 Aug 2024 |
| 909 | malpracticeguru.com | - | 4 Aug 2022 | 5 Aug 2023 | 4 Aug 2024 |
| 910 | malpracticerecovery.com | GoDaddy.com, LLC | 28 Feb 2007 | 29 Feb 2024 | 28 Feb 2025 |
| 911 | malpracticefirm.com | GoDaddy.com, LLC | 6 Dec 2000 | 14 Jan 2025 | 6 Dec 2026 |
| 912 | malpracticelawyerphiladelphia.com | GoDaddy.com, LLC | 14 Feb 2009 | 15 Feb 2025 | 14 Feb 2026 |
| 913 | malpracticenewyork.com | TurnCommerce, Inc. DBA NameBright.com | 30 Jul 2009 | 31 Aug 2024 | 30 Jul 2024 |
| 914 | malpractice-insurance-arizona.com | Domain.com, LLC | 9 Mar 2009 | 23 Feb 2024 | 9 Mar 2025 |
| 915 | malpracticeinmedicine.com | register.com, Inc. | 28 Oct 2008 | 28 Oct 2008 | 28 Oct 2017 |
| 916 | malpracticelawyerslosangeles.com | GoDaddy.com, LLC | 22 Jul 2011 | 6 Jul 2016 | 22 Jul 2017 |
| 917 | malpracticeinsurancenow.com | GoDaddy.com, LLC | 3 Sep 2010 | 9 Jul 2014 | 3 Sep 2017 |
| 918 | malpracticeclaim.com | GoDaddy.com, LLC | 29 Jun 2004 | 9 Jun 2024 | 29 Jun 2025 |
| 919 | malpracticeconsultant.com | TurnCommerce, Inc. DBA NameBright.com | 15 Nov 2021 | 26 Jan 2025 | 15 Nov 2024 |
| 920 | malpracticesecondopinion.com | GoDaddy.com, LLC | 26 Jul 2013 | 27 Jul 2016 | 26 Jul 2017 |
| 921 | malpracticeinfosite.com | GoDaddy.com, LLC | 6 Jul 2006 | 7 Jul 2024 | 6 Jul 2025 |
| 922 | malpracticeconcepts.com | Name.com, Inc. | 11 Jun 2011 | 18 May 2017 | 11 Jun 2018 |
| 923 | malpracticetexas.com | GoDaddy.com, LLC | 1 Oct 2002 | 12 Sep 2024 | 1 Oct 2025 |
| 924 | malpracticecomplaint.com | GoDaddy.com, LLC | 28 Mar 2007 | 8 Mar 2024 | 28 Mar 2025 |
| 925 | malpracticenetwork.com | GoDaddy.com, LLC | 19 Mar 2000 | 19 Mar 2024 | 19 Mar 2025 |
| 926 | malpracticeinjuryhelpline.com | GoDaddy.com, LLC | 9 Jul 2010 | 9 Jul 2016 | 9 Jul 2017 |
| 927 | malpracticeinsuranceforobgyn.com | GoDaddy.com, LLC | 28 Jan 2011 | 29 Jan 2014 | 28 Jan 2017 |
| 928 | malpracticedmd.com | GoDaddy.com, LLC | 5 Jul 2006 | 6 Jul 2024 | 5 Jul 2025 |
| 929 | malpracticesc.com | register.com, Inc. | 11 May 2013 | 11 May 2013 | 11 May 2018 |
| 930 | malpracticeattorneyspennsylvania.com | GoDaddy.com, LLC | 1 Feb 2009 | 15 Nov 2024 | 1 Feb 2028 |
| 931 | malpracticerecords.com | GoDaddy.com, LLC | 8 Feb 2003 | 19 Jan 2025 | 8 Feb 2026 |
| 932 | malpracticecentral.com | Dynadot, LLC | 1 Jun 2000 | 27 Jun 2024 | 1 Jun 2025 |
| 933 | malpracticelawyernewyork.com | GoDaddy.com, LLC | 17 Mar 2020 | 16 Nov 2022 | 17 Mar 2025 |
| 934 | malpracticehelp.com | GoDaddy.com, LLC | 8 Apr 2003 | 6 May 2024 | 8 Apr 2025 |
| 935 | malpractice-tampa.com | DomainRegistry.com, Inc. | 12 Jan 2001 | 13 Jan 2025 | 12 Jan 2026 |
| 936 | malpracticelawetc.com | Wild West Domains, LLC | 18 Nov 2011 | 14 Nov 2014 | 18 Nov 2016 |
| 937 | malpracticegroup.com | GoDaddy.com, LLC | 26 Aug 2007 | 30 Oct 2024 | 26 Aug 2025 |
| 938 | malpractice-attorney.com | GoDaddy.com, LLC | 23 Nov 2023 | 22 Dec 2024 | 23 Nov 2025 |
| 939 | malpracticemaster.com | TurnCommerce, Inc. DBA NameBright.com | 28 Oct 2009 | 10 Jan 2025 | 28 Oct 2024 |
| 940 | malpracticelawyerlubbock.com | Launchpad, Inc. | 12 Sep 2016 | 24 Oct 2017 | 12 Sep 2017 |
| 941 | malpracticelawyers.link | Uniregistrar Corp | 15 Sep 2016 | 23 Aug 2017 | 15 Sep 2018 |
| 942 | malpractice-attorney-king.com | Key-Systems GmbH | 24 Sep 2016 | 29 Oct 2017 | 24 Sep 2018 |
| 943 | malpractices.net | DropCatch.com 859 LLC | 25 Apr 2019 | 9 Sep 2024 | 25 Apr 2025 |
| 944 | malpractice-attorney-queen.com | Key-Systems GmbH | 4 Oct 2016 | 8 Nov 2017 | 4 Oct 2018 |
| 945 | malpracticeinsuranceplans.link | Uniregistrar Corp | 4 Oct 2016 | 9 Oct 2016 | 4 Oct 2017 |
| 946 | malpracticehelp.us | Uniregistrar Corp | 5 Oct 2016 | 5 Oct 2016 | 4 Oct 2017 |
| 947 | malpracticelaw.us | Uniregistrar Corp | 6 Oct 2016 | 22 Feb 2017 | 5 Oct 2017 |
| 948 | malpracticeexpert.us | - | 7 Oct 2016 | 7 Oct 2016 | 6 Oct 2017 |
| 949 | malpractice-lawyers.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2016 | 9 Oct 2016 | 8 Oct 2017 |
| 950 | malpractice-law.info | Network Solutions, LLC | 31 Jan 2002 | 23 Sep 2015 | 31 Jan 2017 |
| 951 | malpractice-med.info | Network Solutions, LLC | 31 Jan 2002 | 23 Sep 2015 | 31 Jan 2017 |
| 952 | malpracticeconnection.info | GoDaddy.com, LLC | 11 May 2010 | 12 May 2020 | 11 May 2021 |
| 953 | malpractice-lawyer.info | Domain.com, LLC | 7 May 2002 | 20 Jul 2023 | 7 May 2023 |
| 954 | malpractice-legal.info | GoDaddy.com, LLC | 8 Oct 2012 | 19 Nov 2017 | 8 Oct 2018 |
| 955 | malpracticeattorney.info | GoDaddy.com, LLC | 1 May 2022 | 12 Jun 2023 | 1 May 2023 |
| 956 | malpracticeohio.info | Network Solutions, LLC | 8 Apr 2014 | 8 Feb 2020 | 8 Apr 2025 |
| 957 | malpracticelawyersfirm.info | GoDaddy.com, LLC | 12 May 2014 | 13 May 2020 | 12 May 2021 |
| 958 | malpracticekaiser.info | GoDaddy.com, LLC | 12 Mar 2013 | 26 Jun 2024 | 12 Mar 2025 |
| 959 | malpracticeconnections.info | GoDaddy.com, LLC | 11 May 2010 | 12 May 2020 | 11 May 2021 |
| 960 | malpracticelawyer.info | Name.com, Inc. | 28 Mar 2020 | 28 Mar 2020 | 28 Mar 2021 |
| 961 | malpracticeadvice.info | GoDaddy.com, LLC | 6 Dec 2011 | 19 Sep 2013 | 6 Dec 2018 |
| 962 | malpracticekaiser.mobi | GoDaddy.com, LLC | 12 Mar 2013 | 17 Mar 2017 | 12 Mar 2019 |
| 963 | malpracticeattorneyrefferals.com | - | 11 Oct 2016 | 11 Oct 2016 | 11 Oct 2017 |
| 964 | malpracticebulletin.net | Network Solutions, LLC | 4 Apr 2008 | 4 Feb 2024 | 4 Apr 2025 |
| 965 | malpractice-lawyers.net | GoDaddy.com, LLC | 16 Jun 1999 | 4 Oct 2024 | 3 Oct 2025 |
| 966 | malpracticenj.net | Wild West Domains, LLC | 6 Sep 2006 | 16 Sep 2016 | 6 Sep 2017 |
| 967 | malpracticeinsuranceny.net | GoDaddy.com, LLC | 12 Jul 2010 | 12 Jul 2010 | 12 Jul 2020 |
| 968 | malpracticemediation.net | Dynadot, LLC | 6 Sep 2012 | 7 Sep 2016 | 6 Sep 2016 |
| 969 | malpracticerightsguide.net | Network Solutions, LLC | 21 Dec 2007 | 22 Oct 2022 | 21 Dec 2025 |
| 970 | malpracticelawyers.net | DropCatch.com 1026 LLC | 11 May 2024 | 12 May 2024 | 11 May 2025 |
| 971 | malpracticeintexas.net | Network Solutions, LLC | 20 Mar 2012 | 29 Jan 2015 | 20 Mar 2017 |
| 972 | malpractice-illinois.net | Network Solutions, LLC | 7 Sep 1999 | 3 Aug 2017 | 7 Sep 2020 |
| 973 | malpracticelawsuit.net | eNom, Inc. | 23 Jan 2006 | 11 Jul 2016 | 23 Jan 2017 |
| 974 | malpractice1.net | GoDaddy.com, LLC | 2 May 2014 | 2 May 2024 | 2 May 2025 |
| 975 | malpracticeinfo.net | GoDaddy.com, LLC | 6 Dec 2011 | 19 Sep 2013 | 6 Dec 2018 |
| 976 | malpracticekaiser.net | GoDaddy.com, LLC | 12 Mar 2013 | 12 Mar 2023 | 12 Mar 2025 |
| 977 | malpracticelawsuits.net | eNom, Inc. | 18 Apr 2008 | 11 Jul 2016 | 18 Apr 2017 |
| 978 | malpracticemediators.net | Dynadot, LLC | 6 Sep 2012 | 7 Sep 2016 | 6 Sep 2016 |
| 979 | malpracticeinsuranceagents.net | GoDaddy.com, LLC | 5 Feb 2014 | 13 Sep 2016 | 5 Feb 2018 |
| 980 | malpracticeinsuranceagency.net | GoDaddy.com, LLC | 5 Feb 2010 | 13 Sep 2016 | 5 Feb 2017 |
| 981 | malpracticeattorneys.net | Fabulous.com Pty Ltd. | 8 May 2004 | 6 Apr 2024 | 8 May 2025 |
| 982 | malpracticemediator.net | Dynadot, LLC | 6 Sep 2012 | 7 Sep 2016 | 6 Sep 2016 |
| 983 | malpracticesettlement.net | GoDaddy.com, LLC | 10 Jun 2008 | 11 Jun 2015 | 10 Jun 2017 |
| 984 | malpracticelawfirm.net | GoDaddy.com, LLC | 21 Jan 2003 | 4 Jan 2025 | 3 Jan 2026 |
| 985 | malpracticelawyer.net | eNom, Inc. | 6 Apr 2000 | 8 Mar 2024 | 6 Apr 2025 |
| 986 | malpracticelaw.net | Network Solutions, LLC | 16 Jul 1997 | 10 Jul 2024 | 12 Jul 2025 |
| 987 | malpracticelawyerchicago.net | 1&1 Internet AG | 5 Mar 2010 | 5 Mar 2016 | 5 Mar 2017 |
| 988 | malpracticeflorida.net | GoDaddy.com, LLC | 19 Mar 2000 | 19 Mar 2024 | 19 Mar 2025 |
| 989 | malpracticeattorneyschicago.net | 1&1 Internet AG | 5 Mar 2010 | 5 Mar 2016 | 5 Mar 2017 |
| 990 | malpracticeattorneychicago.net | 1&1 Internet AG | 5 Mar 2010 | 5 Mar 2016 | 5 Mar 2017 |
| 991 | malpracticeconsultant.net | GoDaddy.com, LLC | 6 Dec 2011 | 19 Sep 2013 | 6 Dec 2018 |
| 992 | malpracticeattorney.net | GoDaddy.com, LLC | 7 Mar 2004 | 16 Feb 2024 | 7 Mar 2025 |
| 993 | malpracticelawyersmanhattan.net | 1&1 Internet AG | 27 Sep 2009 | 28 Sep 2016 | 27 Sep 2017 |
| 994 | malpracticelitigation.net | GoDaddy.com, LLC | 27 May 2011 | 27 May 2024 | 27 May 2025 |
| 995 | malpracticerates.net | GoDaddy.com, LLC | 22 Mar 2010 | 23 Mar 2024 | 22 Mar 2025 |
| 996 | malpracticedirect.net | GoDaddy.com, LLC | 29 Sep 2006 | 30 Sep 2023 | 29 Sep 2025 |
| 997 | malpractice123.net | GoDaddy.com, LLC | 1 May 2014 | 2 May 2024 | 1 May 2025 |
| 998 | malpracticelawfirms.net | GoDaddy.com, LLC | 8 Jun 2014 | 23 Apr 2016 | 8 Jun 2017 |
| 999 | malpracticeinsurance.net | Network Solutions, LLC | 5 May 2002 | 15 Aug 2023 | 5 May 2026 |
| 1000 | malpracticenews.net | GoDaddy.com, LLC | 28 Feb 2007 | 29 Feb 2024 | 28 Feb 2025 |
Displaying 1,000 out of 1,865 domains starting with the keyword "MALPRACTICE". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=malpractice
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |