Our database now contains whois records of 601 Million (601,632,713) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [601 Million Domains] $10,000 Details

Keyword: OFFICECLEANING

Reverse Whois » KEYWORD [officecleaning ]  { 2,402 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1officecleaning.infoeNom, Inc.17 Jan 20097 Jan 202517 Jan 2026
2officecleaning.suppliesTucows Domains Inc.24 Jul 201428 Jul 202324 Jul 2024
3officecleaning.tipsGoDaddy.com, LLC28 Jul 20192 Aug 201928 Jul 2020
4officecleaning.solutionsGoDaddy.com, LLC20 Dec 202331 Jan 202520 Dec 2024
5officecleaning.londonGoDaddy.com, LLC14 Mar 20249 Jun 202414 Mar 2025
6officecleaning.rocksGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
7officecleaning.melbourneCrazy Domains FZ-LLC25 Jul 201712 Oct 201725 Jul 2018
8officecleaning.sydneyCrazy Domains FZ-LLC17 Feb 201514 Feb 202317 Feb 2025
9officecleaning.walesGoDaddy.com, LLC10 Mar 201510 Mar 201510 Mar 2016
10officecleaning.ninjaGoDaddy.com, LLC13 Apr 201513 Apr 201513 Apr 2016
11officecleaning.websiteGoDaddy.com, LLC9 Jul 202429 Aug 20249 Jul 2025
12officecleaning.irishBlacknight Internet Solutions Ltd.30 Jun 201530 Jun 201530 Jun 2016
13officecleaning.linkUniregistrar Corp5 Dec 20155 Dec 20155 Dec 2016
14officecleaning.topGoDaddy.com, LLC30 Mar 202426 Jun 202430 Mar 2025
15officecleaning.orgAnnulet LLC6 Mar 201627 Jan 20246 Mar 2025
16officecleaning.scotMarcaria.com International, Inc.23 Sep 2014-23 Sep 2016
17officecleaning.contractorsCrazy Domains FZ-LLC5 Mar 201419 Apr 20165 Mar 2017
18officecleaning.companyGoDaddy.com, LLC28 Mar 20202 Apr 202028 Mar 2021
19officecleaning.jobsName Share, Inc.4 Feb 201021 Mar 20164 Feb 2017
20officecleaning.cleaningCrazy Domains FZ-LLC19 Jun 201419 Jun 201619 Jun 2017
21officecleaning.bidGo China Domains, LLC9 Jun 20149 Jun 20168 Jun 2017
22officecleaning.servicesGoDaddy.com, LLC9 Jul 20149 Jul 20249 Jul 2025
23officecleaning.bizregister.com, Inc.27 Mar 20021 Mar 202426 Mar 2025
24officecleaning.comGoDaddy.com, LLC3 Nov 19973 Nov 20242 Nov 2025
25officecleaning.siteGoDaddy.com, LLC4 Feb 20245 Feb 20254 Feb 2026
26officecleaning.mobiGoDaddy.com, LLC10 May 200721 Jul 202410 May 2024
27officecleaning.netUniregistrar Corp9 Mar 19997 Oct 20249 Mar 2025
28officecleaning.xyzGoDaddy.com, LLC20 Jan 202421 Jan 202520 Jan 2026
29officecleaning.cityNameCheap, Inc.4 May 201729 Sep 20174 May 2018
30officecleaning.org.uk-19 Dec 201020 Dec 202419 Dec 2025
31officecleaning.co.uk-23 Feb 200424 Jan 202523 Feb 2026
32officecleaning.expertGoDaddy.com, LLC28 Mar 20202 Apr 202028 Mar 2021
33officecleaning.laReserved for non-billable transactions where Regis…26 Jun 201826 Sep 201826 Jun 2019
34officecleaning.clubGoDaddy.com, LLC3 Dec 202314 Jan 20253 Dec 2024
35officecleaning.proRegional Network Information Center, JSC dba RU-CE…16 Jul 202421 Jul 202416 Jul 2025
36officecleaning.agencyGoDaddy.com, LLC25 Jan 202425 Jan 202525 Jan 2026
37officecleaning.onlineGoDaddy.com, LLC30 Jan 20244 Feb 202530 Jan 2026
38officecleaning.plusGoogle, Inc.12 Mar 202126 Apr 202412 Mar 2025
39officecleaning.usNameKing.com Inc.23 Sep 202130 Aug 202423 Sep 2025
40officecleaning.spaceGoDaddy.com, LLC26 Jan 202427 Jan 202526 Jan 2026
41officecleaning.teamNetwork Solutions, LLC15 Jul 202215 Jul 202215 Jul 2023
42officecleaning.cfd-3 Jan 20253 Jan 20253 Jan 2026
43officecleaning.be-30 Jul 2018--
44officecleaning.storeAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Aug 20241 Sep 20242 Aug 2025
45officecleaning.liveGoDaddy.com, LLC4 Jul 20249 Jul 20244 Jul 2025
46officecleaning.ie-11 May 200816 Dec 202412 May 2025
47officecleaning.co.inGoDaddy.com, LLC24 Dec 20189 Jan 202324 Dec 2032
48officecleaning.miamiGoDaddy.com, LLC20 Jun 202425 Jun 202420 Jun 2027
49officecleaning.nl-24 Jun 201224 Apr 2023-
50officecleaning.co.nzKey-Systems GmbH16 Jan 202425 Dec 2024-
51officecleaning.vipNameCheap, Inc.25 Oct 202030 Sep 202425 Oct 2025
52officecleaning.ro-22 Jan 2020-3 Jan 2026
53officecleaning.todayGoDaddy.com, LLC21 Sep 202426 Sep 202421 Sep 2025
54officecleaning.greenNameCheap, Inc.27 Jul 20237 Sep 202427 Jul 2024
55officecleaning.bondKey-Systems, LLC20 Dec 202330 Jan 202420 Dec 2024
56officecleaning.wikiNameCheap, Inc.2 Jan 202417 Jan 20252 Jan 2025
57officecleaning.homesGoDaddy.com, LLC24 Jan 202429 Jan 202524 Jan 2026
58officecleaning.latGoDaddy.com, LLC25 Jan 202426 Jan 202525 Jan 2026
59officecleaning.funGoDaddy.com, LLC26 Jan 202427 Jan 202526 Jan 2026
60officecleaning.skinGoDaddy.com, LLC30 Jan 20244 Feb 202530 Jan 2026
61officecleaning.lifeGoDaddy.com, LLC2 Feb 20247 Feb 20252 Feb 2026
62officecleaning.monsterGoDaddy.com, LLC2 Feb 20247 Feb 20252 Feb 2026
63officecleaning.ltdGoDaddy.com, LLC5 Feb 20245 Feb 20255 Feb 2026
64officecleaning.buzzGoDaddy.com, LLC23 Feb 202411 Jun 202423 Feb 2025
65officecleaning.worldGoDaddy.com, LLC23 Feb 202428 Feb 202423 Feb 2025
66officecleaning.asiaDNSPod, Inc.6 Mar 202431 Dec 20246 Mar 2025
67officecleaning.digitalGoDaddy.com, LLC6 Mar 202411 Mar 20246 Mar 2025
68officecleaning.techAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Mar 202415 Apr 202412 Mar 2025
69officecleaning.pics1API GmbH30 Mar 202414 Aug 202430 Mar 2025
70officecleaning.blogGoDaddy.com, LLC2 Apr 202411 Jun 20242 Apr 2025
71officecleaning.lol1API GmbH2 Apr 202414 Aug 20242 Apr 2025
72officecleaning.cloudAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Apr 202415 Apr 202410 Apr 2025
73officecleaning.telName.com, Inc.22 Sep 201718 Sep 202422 Sep 2025
74officecleaning.uk-24 Jun 201925 May 202424 Jun 2025
75officecleaning.pl-21 Oct 202322 Sep 202421 Oct 2025
76officecleaning.shopGoDaddy.com, LLC24 Jan 20248 Feb 202524 Jan 2026
77officecleaning.fitDNSPod, Inc.24 Apr 202431 Dec 202424 Apr 2025
78officecleaning.icuDNSPod, Inc.24 Apr 202429 Apr 202424 Apr 2025
79officecleaning.ru-21 Jun 2017-21 Jun 2025
80officecleaning.rentGoDaddy.com, LLC18 Jun 202430 Jul 202418 Jun 2025
81officecleaning.collegeGoDaddy.com, LLC18 Jun 202430 Jul 202418 Jun 2025
82officecleaning.helpeNom, Inc.14 Aug 202410 Sep 202414 Aug 2025
83officecleaning.pinkDynadot, LLC17 Sep 20243 Nov 202417 Sep 2025
84officecleaningplus.comHostinger, UAB28 Jan 202528 Jan 202528 Jan 2026
85officecleaningmanagement.comeNom, Inc.2 Nov 20112 Feb 20152 Nov 2015
86officecleaningstlouis.comGoDaddy.com, LLC20 May 201630 Apr 202320 May 2026
87officecleaningintulsa.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
88officecleaningintulsa.infoGoDaddy.com, LLC30 Oct 201431 Oct 201730 Oct 2018
89officecleaningphoenix.comGoDaddy.com, LLC22 Apr 202223 Apr 202422 Apr 2025
90officecleaningcontracts.infoPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 201012 Mar 201515 Aug 2015
91officecleaningsuccess.comLimited Liability Company "Registrar of domain nam…1 Dec 20211 Dec 20211 Dec 2022
92officecleaningintulsa.netGoDaddy.com, LLC30 Oct 201431 Oct 201630 Oct 2017
93officecleaningmaryland.comGoDaddy.com, LLC13 Oct 202225 Dec 202413 Oct 2024
94officecleaninglongbeach.comGoDaddy.com, LLC16 May 201717 May 202416 May 2025
95officecleaningphoenixaz.netGoDaddy.com, LLC7 Jun 20138 Jun 20157 Jun 2016
96officecleaningnyc.netGoDaddy.com, LLC11 Jun 201312 Jun 201511 Jun 2016
97officecleaningmaidenhead.comGoDaddy.com, LLC20 Aug 201421 Aug 202420 Aug 2026
98officecleaningmiltonkeynes.comeNom, Inc.19 Sep 201819 Sep 201819 Sep 2019
99officecleaningmelbourne.comNameBrew LLC6 Feb 20237 Feb 20256 Feb 2025
100officecleaningpennsylvania.comTucows Domains Inc.13 Jan 201517 Jan 201613 Jan 2017
101officecleaningperth.com-9 Dec 20225 Jan 20259 Dec 2025
102officecleaningjanitorial.comGoDaddy.com, LLC21 Aug 201422 Aug 202421 Aug 2025
103officecleaningharrisburg.comNameCheap, Inc.7 Nov 20147 Oct 20247 Nov 2025
104officecleaningdfw.com1&1 Internet AG5 Sep 20235 Sep 20235 Sep 2025
105officecleaningsingapore.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Aug 201425 Aug 201724 Aug 2018
106officecleaningnewportbeach.comGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2015
107officecleaninganaheim.comGoDaddy.com, LLC14 Nov 201414 Nov 201614 Nov 2017
108officecleaningvegas.comGoDaddy.com, LLC12 Sep 201413 Aug 201612 Sep 2017
109officecleaningnashville.netWild West Domains, LLC12 Sep 20142 Dec 20241 Dec 2025
110officecleaningservicechicago.comName.com, Inc.14 Nov 20149 May 201714 Nov 2017
111officecleaningserviceeastlansing.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
112officecleaningservicelansing.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
113officecleaningglasgow.comNameCheap, Inc.17 Jan 201818 Dec 202417 Jan 2026
114officecleaningserviceokemos.infoGoDaddy.com, LLC17 Sep 201417 Sep 201417 Sep 2015
115officecleaningchicago.comWild West Domains, LLC6 Sep 20142 Dec 20241 Dec 2025
116officecleaningwilmington.comeNom, Inc.2 Oct 20141 Sep 20152 Oct 2016
117officecleaningoxford.netPDR Ltd. d/b/a PublicDomainRegistry.com15 Mar 201515 Mar 201515 Mar 2016
118officecleaningweston.comTucows Domains Inc.7 Sep 201011 Sep 20147 Sep 2015
119officecleaningfullerton.comTucows Domains Inc.19 Sep 201122 Sep 201419 Sep 2015
120officecleaningzrt.comeNom, Inc.21 Nov 201421 Nov 201421 Nov 2015
121officecleaningdallas.netWild West Domains, LLC25 Sep 20142 Dec 20241 Dec 2025
122officecleaningandjanitorialservices.comGoDaddy.com, LLC11 Oct 201412 Oct 202411 Oct 2025
123officecleaningjacksonville.comGoDaddy.com, LLC5 Oct 20245 Oct 20245 Oct 2025
124officecleaningindallas.comMoniker Online Services LLC26 Sep 201427 Sep 201726 Sep 2018
125officecleaningderby.comSquarespace Domains LLC10 Jun 202410 Jun 202410 Jun 2027
126officecleaningglasgow.netInternetters Limited20 Jan 201116 Oct 201420 Jan 2015
127officecleaning-memphis.comregister.com, Inc.14 Oct 201414 Oct 201414 Oct 2015
128officecleaningsurrey.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
129officecleaningservicesnashville.comGoDaddy.com, LLC30 Nov 20141 Dec 202430 Nov 2025
130officecleaningpittsburgh.comNameCheap, Inc.28 Mar 202428 Mar 202428 Mar 2025
131officecleaningservicessingapore.comGoDaddy.com, LLC4 Dec 20144 Dec 20144 Dec 2015
132officecleaningservicestoronto.comTucows Domains Inc.6 Mar 202320 Feb 20246 Mar 2025
133officecleaningwestchester.comGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
134officecleaningservicestoronto.netGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
135officecleaningservicestoronto.orgGoDaddy.com, LLC6 Dec 20146 Dec 20146 Dec 2015
136officecleaningli.comGoDaddy.com, LLC10 Dec 201410 Dec 201410 Dec 2016
137officecleaningwilliston.comGoDaddy.com, LLC15 Dec 201416 Dec 202415 Dec 2025
138officecleaningorlando.comGoDaddy.com, LLC6 Oct 20246 Oct 20246 Oct 2025
139officecleaningbath.com1&1 Internet AG16 Dec 201417 Mar 201816 Dec 2025
140officecleaningwestjordan.comNameCheap, Inc.22 Dec 20142 Feb 202522 Dec 2024
141officecleaningservicegreenville.comeNom, Inc.22 Dec 201422 Dec 201422 Dec 2015
142officecleanings.netWild West Domains, LLC21 Dec 20142 Jan 202521 Dec 2025
143officecleaningcanberra.cleaningCrazy Domains FZ-LLC25 Jun 201425 Jun 202325 Jun 2024
144officecleaninglondon.londonMinds + Machines Registrar Limited22 Sep 20148 Oct 201422 Sep 2015
145officecleaningmontreal.contractorsNetwork Solutions, LLC15 Nov 201420 Sep 202415 Nov 2025
146officecleaningboston.servicesGoDaddy.com, LLC7 Dec 201421 Jan 20177 Dec 2017
147officecleaninghauppauge.comTucows Domains Inc.12 Aug 201516 Aug 201812 Aug 2018
148officecleaningtouch.comGoDaddy.com, LLC7 Jan 20157 Jan 20157 Jan 2017
149officecleaningsandiego.comGoDaddy.com, LLC11 May 201712 May 202411 May 2025
150officecleaningbusiness.orgPDR Ltd. d/b/a PublicDomainRegistry.com6 Jan 20156 Jan 20156 Jan 2016
151officecleaningboston.comGo China Domains, LLC15 Jan 20159 Jan 202515 Jan 2027
152officecleaningservice.london-10 May 201510 May 201510 May 2017
153officecleaningbuzz.melbourneMelbourne IT, Ltd15 Jul 201517 Nov 201515 Jul 2017
154officecleaninginsunbury.comParagon Internet Group Ltd t/a Paragon Names23 Jan 201520 Jan 201723 Jan 2018
155officecleaningservices.bizNetwork Solutions, LLC19 Aug 201519 Aug 201518 Aug 2016
156officecleaningbrooklyn.comGoDaddy.com, LLC2 Jun 20201 Jul 20242 Jun 2025
157officecleaningcontractorlondon.comGoDaddy.com, LLC2 Feb 20152 Feb 20152 Feb 2016
158officecleaninglansing.comregister.com, Inc.5 Feb 201526 Jan 20215 Feb 2027
159officecleaningserviceslocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
160officecleaningnychq.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
161officecleaninglocalexperts.comGoDaddy.com, LLC20 Aug 201520 Aug 201520 Aug 2016
162officecleaningcarpet.comGoDaddy.com, LLC10 Feb 201511 Feb 201510 Feb 2016
163officecleaningservices.orgGoDaddy.com, LLC10 Sep 201925 Oct 202410 Sep 2029
164officecleaningliverpool.comWebfusion Ltd.16 Feb 201529 Apr 202416 Feb 2024
165officecleaning-citywest.comEveryones Internet, Ltd. dba SoftLayer18 Feb 201518 Feb 201718 Feb 2018
166officecleaning-london.netTucows Domains Inc.15 Feb 201319 Feb 201515 Feb 2016
167officecleaningintoronto.comeNom, Inc.22 Feb 201523 Feb 201522 Feb 2016
168officecleaninginhollywoodfl.comeNom, Inc.23 Feb 201523 Feb 201523 Feb 2016
169officecleaninginbrentwoodca.comeNom, Inc.23 Feb 201523 Feb 201523 Feb 2016
170officecleaningredding.comGoDaddy.com, LLC2 Mar 20152 Mar 20152 Mar 2017
171officecleaningmatthews.comTucows Domains Inc.4 Mar 20138 Mar 20154 Mar 2016
172officecleaningwarnerrobinsga.comeNom, Inc.24 Aug 201526 Jul 201724 Aug 2017
173officecleaningintuckerga.comeNom, Inc.24 Aug 201524 Aug 201524 Aug 2016
174officecleaningservicesmarthasvineyard.comGoDaddy.com, LLC13 Mar 201525 Mar 202413 Mar 2025
175officecleaningauthority.comGoDaddy.com, LLC14 Mar 201515 Mar 202414 Mar 2025
176officecleaningcompany.orgGoDaddy.com, LLC16 Mar 201517 Mar 201716 Mar 2018
177officecleaningofmiami.comWix.com Ltd.30 Mar 202029 Feb 202430 Mar 2025
178officecleaninginwarnerrobinsga.comeNom, Inc.19 Mar 201519 Mar 201519 Mar 2016
179officecleaningofmiami.netNetwork Solutions, LLC18 Mar 201516 Mar 201718 Mar 2018
180officecleaningsouthend.com1&1 Internet AG20 Mar 201521 Mar 201720 Mar 2018
181officecleaningbossiercityla.comeNom, Inc.20 Mar 201520 Mar 201520 Mar 2016
182officecleaningbromsgrove.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Aug 201526 Oct 201526 Aug 2016
183officecleaningsanjose.comNameKing.com Inc.12 Jun 202012 Jun 202012 Jun 2021
184officecleaningcentralfl.comTucows Domains Inc.24 Aug 201128 Aug 201524 Aug 2016
185officecleaningleeds.netTucows Domains Inc.24 Mar 201428 Mar 201524 Mar 2016
186officecleaningco.comDynadot, LLC12 Jan 202512 Jan 202512 Jan 2026
187officecleaningcharleston.comGoDaddy.com, LLC6 Oct 20246 Oct 20246 Oct 2025
188officecleaning-charlotte.comregister.com, Inc.31 Mar 201531 Mar 201531 Mar 2016
189officecleaningservicesma.comGoDaddy.com, LLC6 Apr 20156 Apr 20156 Apr 2016
190officecleaninginorangecountyca.comeNom, Inc.7 Apr 20157 Apr 20157 Apr 2016
191officecleaningboston.infoGoDaddy.com, LLC5 Apr 2015-5 Apr 2016
192officecleaningfromcleanpro.netregister.com, Inc.7 Apr 20157 Apr 20157 Apr 2018
193officecleaningworcestershire.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Apr 20159 Apr 20159 Apr 2016
194officecleaningsanbernardino.comNameCheap, Inc.6 Jan 20247 Jan 20256 Jan 2025
195officecleaningriversidecalifornia.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
196officecleaningranchocucamonga.comNameCheap, Inc.10 Dec 202110 Nov 202410 Dec 2025
197officecleaningontariocalifornia.comNameCheap, Inc.10 Dec 202110 Nov 202410 Dec 2025
198officecleaninginorangecounty.comGoDaddy.com, LLC10 Apr 201510 Apr 201510 Apr 2016
199officecleaninginlandempire.comNameCheap, Inc.23 Aug 202124 Jul 202423 Aug 2025
200officecleaningservicesnashvilletn.comGoDaddy.com, LLC13 Apr 201514 Apr 202413 Apr 2025
201officecleaningservicenashvilletn.comGoDaddy.com, LLC13 Apr 201513 Apr 201513 Apr 2016
202officecleaningmelville.comTucows Domains Inc.4 Sep 20158 Sep 20174 Sep 2017
203officecleaningservicessouthflorida.comGoDaddy.com, LLC14 Apr 201514 Apr 201514 Apr 2017
204officecleaningwa.comLaunchpad, Inc.16 Apr 201516 Apr 201516 Apr 2016
205officecleaningestimatenashvilletn.comGoDaddy.com, LLC7 Sep 20157 Sep 20157 Sep 2017
206officecleaningestimatenashville.comGoDaddy.com, LLC7 Sep 20157 Sep 20157 Sep 2017
207officecleaninglexingtonky.comGoDaddy.com, LLC21 Apr 20153 Jul 202421 Apr 2024
208officecleaningtampafl.comTucows Domains Inc.25 Apr 201529 Apr 201925 Apr 2019
209officecleaninglondon.mobiGoDaddy.com, LLC27 Apr 201527 Apr 201527 Apr 2016
210officecleaningprofessionals.comGoDaddy.com, LLC15 Feb 201816 Feb 202515 Feb 2026
211officecleaningcompanieslosangeles.comWild West Domains, LLC2 May 20152 May 20152 May 2016
212officecleaningnorthsydney.comeNom, Inc.5 May 20153 May 20175 May 2019
213officecleaningbros.comGoDaddy.com, LLC5 May 20155 May 20155 May 2016
214officecleaningestimatesnashvilletn.comGoDaddy.com, LLC10 Sep 201510 Sep 201510 Sep 2017
215officecleaningestimatesnashville.comGoDaddy.com, LLC10 Sep 201510 Sep 201510 Sep 2017
216officecleaningwestpalmbeach.com1&1 Internet AG7 Oct 20187 Oct 20187 Oct 2019
217officecleaningsquad.comNameCheap, Inc.21 Jul 202121 Jul 202421 Jul 2025
218officecleaningservicesteam.comGoDaddy.com, LLC11 May 201512 May 202411 May 2025
219officecleaninginlanghornepa.comDynadot, LLC23 Sep 202123 Sep 202123 Sep 2022
220officecleaningfortmyersfl.comGoDaddy.com, LLC11 May 201511 May 201511 May 2016
221officecleaningandbuildingmaint.comTucows Domains Inc.8 May 201412 May 20158 May 2016
222officecleaningsa.comWild West Domains, LLC11 Sep 201511 Sep 201511 Sep 2016
223officecleaningdeerpark.comTucows Domains Inc.11 Sep 201515 Sep 201811 Sep 2018
224officecleaningbayshore.comTucows Domains Inc.11 Sep 201515 Sep 201811 Sep 2018
225officecleaningmarlow.comMesh Digital Limited15 May 201515 May 201515 May 2016
226officecleaninghighwycombe.comTucows Domains Inc.25 Apr 20226 Jul 202325 Apr 2023
227officecleaningbucks.comMesh Digital Limited15 May 201515 May 201515 May 2016
228officecleaningtacoma.comGoDaddy.com, LLC18 May 201518 May 201518 May 2016
229officecleaningandjanitorialservice.comGoDaddy.com, LLC19 May 201519 May 202419 May 2025
230officecleaningbaltimore.comGoDaddy.com, LLC2 Jun 20201 Jul 20242 Jun 2025
231officecleaninginsanantoni.comGoogle, Inc.29 May 201529 May 201529 May 2016
232officecleaningnewyorkcity.netGoDaddy.com, LLC29 May 201529 May 201529 May 2016
233officecleaningplainview.comTucows Domains Inc.15 Sep 201519 Sep 201715 Sep 2017
234officecleaninggardencity.comTucows Domains Inc.15 Sep 201519 Sep 201715 Sep 2017
235officecleaningportersville.comGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
236officecleaninglas.comGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
237officecleaningdelano.comGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
238officecleaningcalifornia.comNameCheap, Inc.12 May 2020-12 May 2021
239officecleaningbakersfield.comGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
240officecleaningperth.netNetwork Solutions, LLC9 Jun 20159 Jun 20159 Jun 2016
241officecleaninglasvegas.orgGoDaddy.com, LLC9 Jun 20159 Jun 20159 Jun 2016
242officecleaningservicesnewyorkcity.comGoDaddy.com, LLC10 Jun 201510 Jun 201510 Jun 2016
243officecleaningfranchise.comGoDaddy.com, LLC2 Jan 20203 Jan 20242 Jan 2026
244officecleaninghollywoodfl.comeNom, Inc.17 Jun 201517 Jun 201517 Jun 2016
245officecleaningannarbormi.comTucows Domains Inc.17 Sep 201121 Sep 201517 Sep 2016
246officecleaningaustin.comGoDaddy.com, LLC18 Sep 202418 Sep 202418 Sep 2025
247officecleaningservicesarizona.comTucows Domains Inc.21 Sep 201125 Sep 201521 Sep 2016
248officecleaningbohemia.comTucows Domains Inc.24 Sep 201528 Sep 201724 Sep 2017
249officecleaningsmithtown.comTucows Domains Inc.6 Jul 201510 Jul 20196 Jul 2019
250officecleaningnm.comGoDaddy.com, LLC25 Sep 20158 Oct 202425 Sep 2025
251officecleaninginaberdeen.comTucows Domains Inc.29 Feb 202429 Feb 202428 Feb 2026
252officecleaningcharlotte.netWild West Domains, LLC13 Jul 20152 Dec 20241 Dec 2025
253officecleaningbyrenee.comGoDaddy.com, LLC16 Jul 201516 Jul 201516 Jul 2016
254officecleaninginsandiegoca.comNameCheap, Inc.17 Jul 201517 Jun 202417 Jul 2025
255officecleaninglongisland.netTucows Domains Inc.20 Jul 201524 Jul 201920 Jul 2019
256officecleaninginleesburgva.comNameCheap, Inc.23 Jul 201523 Jun 202423 Jul 2025
257officecleaningdynamics.comGoDaddy.com, LLC4 Jan 20185 Jan 20254 Jan 2026
258officecleaningjohannesburg.comTucows Domains Inc.29 Jul 20142 Aug 201529 Jul 2016
259officecleaningcash.comGoDaddy.com, LLC3 Aug 20153 Aug 20153 Aug 2016
260officecleaninginhoustontx.comeNom, Inc.2 Oct 20153 Sep 20162 Oct 2017
261officecleaningfortlauderdalefl.comeNom, Inc.4 Aug 20154 Aug 20154 Aug 2016
262officecleaningsacramento.comUniregistrar Corp19 May 202016 May 202219 May 2026
263officecleaningincincinnatioh.comeNom, Inc.5 Aug 20155 Aug 20155 Aug 2016
264officecleaninginbedminsternj.comeNom, Inc.7 Aug 20156 Jul 20167 Aug 2018
265officecleaningservicesllc.comGoDaddy.com, LLC25 Mar 201825 Mar 202425 Mar 2025
266officecleaningserviceeastlansing.usGoDaddy.com, LLC8 Oct 20158 Oct 20157 Oct 2016
267officecleaninginlasvegas.comNameCheap, Inc.15 May 201715 May 201715 May 2018
268officecleaningservicesdenver.comGoDaddy.com, LLC21 Oct 201521 Oct 201521 Oct 2016
269officecleaningservicesdenver.mobiGoDaddy.com, LLC21 Oct 201516 Oct 201621 Oct 2017
270officecleaningmn.comNetwork Solutions, LLC27 Oct 201527 Oct 201527 Oct 2016
271officecleaningbrisbane.cityCrazy Domains FZ-LLC27 Oct 20159 Jan 202527 Oct 2024
272officecleaningserviceslondon.comGoDaddy.com, LLC30 Oct 201530 Oct 201530 Oct 2016
273officecleaningtulsa.comTucows Domains Inc.28 Oct 20101 Nov 201528 Oct 2016
274officecleaninginpdx.comeNom, Inc.31 Oct 201514 Nov 201631 Oct 2017
275officecleaningindfw.comeNom, Inc.31 Oct 201514 Nov 201631 Oct 2017
276officecleaningappleton.comTucows Domains Inc.29 Oct 20102 Nov 201529 Oct 2016
277officecleaningkian.comGoDaddy.com, LLC3 Nov 20153 Nov 20153 Nov 2016
278officecleaningintaylorsvilleut.comeNom, Inc.5 Nov 20155 Nov 20155 Nov 2016
279officecleaningbroward.comGoDaddy.com, LLC9 Nov 20159 Nov 20159 Nov 2018
280officecleaningsolution.comGoDaddy.com, LLC27 Feb 201928 Feb 202427 Feb 2025
281officecleaninginnewhavenct.comeNom, Inc.18 Nov 201517 Oct 201618 Nov 2017
282officecleaningservicesmiami.comALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED22 Jan 202122 Jan 202122 Jan 2022
283officecleaninginsaltlakecityut.comeNom, Inc.23 Nov 201522 Oct 201623 Nov 2017
284officecleaningsc.comGoDaddy.com, LLC2 Dec 20152 Dec 20152 Dec 2016
285officecleaningguru.comGoDaddy.com, LLC7 Mar 20177 Mar 20177 Mar 2018
286officecleaningservicebrooklyn.com1&1 Internet AG5 Dec 20155 Dec 20155 Dec 2016
287officecleaningatlanta.useNom, Inc.9 Dec 20159 Dec 20158 Dec 2016
288officecleaningaustralia.comCrazy Domains FZ-LLC19 Nov 201122 Aug 201719 Nov 2017
289officecleaningmaplegrovemn.comTucows Domains Inc.13 Dec 201117 Dec 201513 Dec 2016
290officecleaning-chicago.comGoDaddy.com, LLC16 Dec 201517 Dec 202416 Dec 2025
291officecleaningsraleigh.comGoDaddy.com, LLC22 Dec 201522 Dec 201522 Dec 2016
292officecleaning4london.comTucows Domains Inc.20 Dec 200224 Dec 201520 Dec 2016
293officecleaningla.comGoDaddy.com, LLC6 Jan 201619 Mar 20246 Jan 2024
294officecleaningdc.comTucows Domains Inc.3 Jan 20137 Jan 20163 Jan 2017
295officecleaninghoover.comTucows Domains Inc.6 Jan 201110 Jan 20166 Jan 2017
296officecleaningpros.bizTucows Domains Inc.15 Jan 201618 Jan 202214 Jan 2022
297officecleaningseattletacoma.comTucows Domains Inc.11 Jan 201115 Jan 201611 Jan 2017
298officecleaningkentauburnsumner.comTucows Domains Inc.11 Jan 201115 Jan 201611 Jan 2017
299officecleaningky.comLaunchpad, Inc.16 Jan 20161 Jan 201716 Jan 2018
300officecleaningserviceburlington.comeNom, Inc.19 Jan 201619 Jan 201619 Jan 2017
301officecleaningaz.comGoDaddy.com, LLC18 Jan 202418 Jan 202418 Jan 2027
302officecleaningwest.comName.com, Inc.30 Jan 201630 Jan 201630 Jan 2017
303officecleaningsj.comWeb Commerce Communications Limited dba WebNic.cc8 Jul 202217 Sep 20238 Jul 2023
304officecleaningexperts.netHostinger, UAB3 Jun 20243 Aug 20243 Jun 2026
305officecleaningboston.orgGoDaddy.com, LLC29 Dec 201830 Dec 202429 Dec 2025
306officecleaningkenosha.comTucows Domains Inc.11 Feb 201115 Feb 201611 Feb 2017
307officecleaningbournemouth.comregister.com, Inc.18 Feb 201618 Feb 201618 Feb 2017
308officecleaningobx.comGoDaddy.com, LLC24 Feb 201624 Feb 202424 Feb 2025
309officecleaninglondon.netWebfusion Ltd.27 Feb 201613 Apr 202327 Feb 2023
310officecleaningmia.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
311officecleaningfl.comGoDaddy.com, LLC29 Jan 202529 Jan 202529 Jan 2026
312officecleaningcincinnatioh.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
313officecleaninghouston.comGoDaddy.com, LLC5 Oct 20186 Oct 20245 Oct 2025
314officecleaningbybrown.comGoogle, Inc.3 Mar 20163 Mar 20163 Mar 2017
315officecleaningjanitorialboise.comNetwork Solutions, LLC8 Mar 20166 Mar 20178 Mar 2018
316officecleaningatlanticcounty.comTucows Domains Inc.4 Mar 20118 Mar 20164 Mar 2017
317officecleaningdivas.comTucows Domains Inc.8 Mar 201412 Mar 20168 Mar 2017
318officecleaninghollywood.comTucows Domains Inc.14 Mar 201214 Mar 201214 Mar 2017
319officecleaningbonitasprings.comTucows Domains Inc.17 Mar 201117 Mar 201117 Mar 2017
320officecleaningmonmouthnj.comTucows Domains Inc.21 Mar 201121 Mar 201121 Mar 2017
321officecleaningri.comGoDaddy.com, LLC27 Mar 20162 Apr 202427 Mar 2025
322officecleaningperth.bizCrazy Domains FZ-LLC2 Apr 20162 Apr 20161 Apr 2018
323officecleaningspringfield.comTucows Domains Inc.31 Mar 201131 Mar 201131 Mar 2017
324officecleaningsanfrancisco.netGoDaddy.com, LLC14 Apr 201614 Apr 202414 Apr 2025
325officecleaningftlauderdaleboca.comTucows Domains Inc.12 Apr 201212 Apr 201212 Apr 2017
326officecleaningwilliamsville.comTucows Domains Inc.18 Apr 201622 Apr 201718 Apr 2017
327officecleaninglancaster.comTucows Domains Inc.18 Apr 201622 Apr 201718 Apr 2017
328officecleaningamherst.comTucows Domains Inc.18 Apr 201622 Apr 201718 Apr 2017
329officecleaningsvc.comGoDaddy.com, LLC3 Jun 20213 Jun 20213 Jun 2022
330officecleaningdenver.orgeNom, Inc.3 Dec 20102 Dec 20163 Dec 2017
331officecleaningservicesbrisbane.comCrazy Domains FZ-LLC12 Apr 201212 Apr 201212 Apr 2017
332officecleaningsydney.com-9 Jul 202112 Jul 20249 Jul 2025
333officecleaningedinburgh.comNameCheap, Inc.12 Jul 202312 Jun 202412 Jul 2025
334officecleaningoklahomacity.comeNom, Inc.19 May 201619 May 201619 May 2017
335officecleaninginlondon.comNameCheap, Inc.3 Feb 202317 Mar 20243 Feb 2024
336officecleaningknoxville.comTucows Domains Inc.25 May 201125 May 201125 May 2017
337officecleaningminneapolismn.comTucows Domains Inc.27 May 201131 May 201727 May 2017
338officecleaningdevon.comGoDaddy.com, LLC6 Jun 20166 Jun 20166 Jun 2017
339officecleaningnorwich.comeNom, Inc.13 Jun 201614 Jun 202413 Jun 2025
340officecleaningleicester.com1&1 Internet AG21 Mar 202021 Mar 202021 Mar 2021
341officecleaningservicedetroit.comeNom, Inc.20 Jun 201620 Jun 201620 Jun 2017
342officecleaningfortlauderdale.comGoDaddy.com, LLC20 Dec 202420 Dec 202420 Dec 2025
343officecleaningtylertexas.comGoDaddy.com, LLC21 Jul 201921 Jul 201921 Jul 2020
344officecleaningsalford.comWebfusion Ltd.30 Jun 20165 Jul 201830 Jun 2018
345officecleaningincorporated.comGoDaddy.com, LLC3 Jul 20163 Jul 20163 Jul 2017
346officecleaninggroup.comGoDaddy.com, LLC25 Jul 202130 Jul 202425 Jul 2025
347officecleaningdirectory.comGoDaddy.com, LLC6 Oct 20196 Oct 20246 Oct 2029
348officecleaningelkhart.comregister.com, Inc.7 Jun 201620 Jul 20247 Jun 2024
349officecleaningservices.xyzGoDaddy.com, LLC21 Feb 20247 Sep 202421 Feb 2025
350officecleaningservicenewyork.comAbove.com Pty Ltd.4 Sep 202315 Nov 20244 Sep 2024
351officecleaningservicestowson.comTucows Domains Inc.11 Jul 201615 Jul 202111 Jul 2021
352officecleaningfellspoint.comTucows Domains Inc.11 Jul 201615 Jul 202111 Jul 2021
353officecleaningmelbourne.cleaningCrazy Domains FZ-LLC19 Jun 201419 Jun 201619 Jun 2017
354officecleaningcompany.londonMesh Digital Limited27 Aug 201420 Aug 201527 Aug 2016
355officecleaningcompanies.londonMesh Digital Limited27 Aug 201420 Aug 201527 Aug 2016
356officecleaningservices.londonMesh Digital Limited27 Aug 201420 Aug 201527 Aug 2016
357officecleaningin.londonTucows Domains Inc.12 Sep 201413 Aug 201512 Sep 2016
358officecleaningservice.bizGoogle, Inc.11 Nov 201916 Nov 201911 Nov 2020
359officecleaningmemphis.bizGoDaddy.com, LLC14 Sep 201125 Oct 202413 Sep 2024
360officecleaninglondon.bizMesh Digital Limited3 Apr 200816 May 20232 Apr 2023
361officecleaninginlondon.bizTucows Domains Inc.11 Jun 201217 May 202410 Jun 2026
362officecleaningconnection.bizGoDaddy.com, LLC5 Feb 201323 Jun 20244 Feb 2025
363officecleaningcompanies.bizGoDaddy.com, LLC14 Dec 20114 Dec 201513 Dec 2016
364officecleaningmontreal.bizNetwork Solutions, LLC24 Sep 201331 Jul 202423 Sep 2025
365officecleaningbrooklyncenter.comregister.com, Inc.18 Jul 201618 Jul 201618 Jul 2018
366officecleaninginnyc.comenom451, Incorporated21 Oct 20242 Nov 202421 Oct 2025
367officecleaningmontreal.comNetwork Solutions, LLC14 Dec 200915 Oct 202414 Dec 2026
368officecleaningmarietta.comGoDaddy.com, LLC9 Aug 201610 Aug 20249 Aug 2025
369officecleaningportsmouth.comGoDaddy.com, LLC18 Apr 202018 Apr 202018 Apr 2021
370officecleaningsouthampton.comWebfusion Ltd.12 Aug 201912 Aug 201912 Aug 2020
371officecleaningindiana.com-10 Aug 201610 Aug 201610 Aug 2017
372officecleaningintarrytown.infoGoDaddy.com, LLC13 Aug 201624 Sep 201713 Aug 2018
373officecleaninginwhiteplains.infoGoDaddy.com, LLC13 Aug 201624 Sep 201713 Aug 2018
374officecleaningtarrytown.infoGoDaddy.com, LLC13 Aug 201624 Sep 201713 Aug 2018
375officecleaningwhiteplains.infoGoDaddy.com, LLC13 Aug 201624 Sep 201713 Aug 2018
376officecleaningit.xyzGoDaddy.com, LLC14 Aug 201624 Sep 201614 Aug 2017
377officecleaningcorpuschristi.comGoDaddy.com, LLC16 May 201916 May 201916 May 2020
378officecleaninginspections.com-16 Aug 201616 Aug 201616 Aug 2017
379officecleaningserviceflatrockmi.comeNom, Inc.18 Aug 201630 Sep 201718 Aug 2017
380officecleaningservicecincinnati.comeNom, Inc.19 Aug 20161 Oct 201719 Aug 2017
381officecleaninghelp.comPorkbun, LLC25 Apr 202425 Apr 202425 Apr 2025
382officecleaningcolorado.comDropCatch.com 1215 LLC18 Nov 202118 Nov 202118 Nov 2022
383officecleaningsicklerville.comName.com, Inc.1 Sep 201626 Sep 20171 Sep 2018
384officecleaningservicesperth.comregister.com, Inc.1 Sep 201616 Aug 20171 Sep 2018
385officecleaningoklahoma.com-6 Sep 20166 Sep 20166 Sep 2017
386officecleaningbayport.comTucows Domains Inc.12 Sep 201616 Sep 201712 Sep 2017
387officecleaningridge.comTucows Domains Inc.12 Sep 201616 Sep 201712 Sep 2017
388officecleaningserviceschicago.comWild West Domains, LLC15 Sep 201616 Aug 202415 Sep 2025
389officecleaning247.comNameCheap, Inc.31 Jan 201227 Aug 202431 Jan 2026
390officecleaninghuddersfield.comEasyspace LTD28 Apr 201425 Apr 201728 Apr 2018
391officecleaningwolverhampton.com1&1 Internet AG24 Feb 201225 Feb 201724 Feb 2018
392officecleaningsantacruz.comNameCheap, Inc.17 Jul 201417 Jun 202417 Jul 2025
393officecleaning-longisland.comDomain.com, LLC28 Feb 201213 Feb 201728 Feb 2018
394officecleaningsouthmelbourne.comeNom, Inc.8 Jun 201010 Jun 20178 Jun 2018
395officecleaningvancouver.comDropCatch.com 1379 LLC29 Dec 20245 Jan 202529 Dec 2025
396officecleaningny.comGoDaddy.com, LLC16 Feb 202328 Apr 202416 Feb 2024
397officecleaningsource.comGoDaddy.com, LLC11 Oct 201011 Sep 201511 Oct 2017
398officecleaningservicesmaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
399officecleaningservicedenver.comGoDaddy.com, LLC5 Nov 20126 Nov 20245 Nov 2025
400officecleaningflorida.comGoDaddy.com, LLC15 Jun 202220 Oct 202415 Jun 2025
401officecleaninghonolulu.comGoDaddy.com, LLC23 Nov 200924 Nov 201523 Nov 2017
402officecleaningservicesftmyers.comGoDaddy.com, LLC22 Feb 20125 Sep 20153 Sep 2018
403officecleaningoakland.comNameCheap, Inc.24 Jun 201424 May 202424 Jun 2025
404officecleaningservicesfl.comTucows Domains Inc.17 Jan 201121 Jan 201717 Jan 2017
405officecleaningmi.comGoogle, Inc.10 Feb 202110 Feb 202110 Feb 2022
406officecleaningqueens.comeNom, Inc.29 Aug 201210 Oct 201729 Aug 2017
407officecleaningsaintlouis.comTucows Domains Inc.7 Mar 20146 Feb 20257 Mar 2026
408officecleaning-newyorkcity.comDomain.com, LLC28 Feb 201213 Feb 201728 Feb 2018
409officecleaninglady.comGoDaddy.com, LLC18 Jan 201019 Jan 202518 Jan 2026
410officecleaningrocklandcountyny.comOmnis Network, LLC18 Jan 201019 Jan 202518 Jan 2026
411officecleaningservicesinfortmyers.comGoDaddy.com, LLC28 Nov 201112 Nov 202428 Nov 2025
412officecleaningbusiness.comGoDaddy.com, LLC11 Oct 200521 Sep 202411 Oct 2025
413officecleaningleads.comGoDaddy.com, LLC30 Mar 20124 Apr 202430 Mar 2025
414officecleaninggta.comFastDomain Inc.15 Apr 201415 May 202315 Apr 2028
415officecleaningincairo.comMesh Digital Limited11 Aug 201416 Aug 201611 Aug 2016
416officecleaningofcolumbus.comGoDaddy.com, LLC26 Aug 200810 May 201620 May 2017
417officecleaningboise.comGoDaddy.com, LLC21 Sep 20233 Dec 202421 Sep 2024
418officecleaningsuppliers.comWebfusion Ltd.3 Apr 200814 Feb 20123 Apr 2017
419officecleaningbrisbane.comGoDaddy.com, LLC14 Apr 200916 Apr 202414 Apr 2025
420officecleaningutah.comAlpnames Limited14 Feb 201814 Feb 201814 Feb 2019
421officecleaningcollegeville.comDropCatch.com 482 LLC16 Sep 202116 Sep 202116 Sep 2022
422officecleaningzionsville.comGoDaddy.com, LLC7 Nov 201018 Aug 20157 Nov 2016
423officecleaningandjanitorial.comGoDaddy.com, LLC25 Mar 201326 Mar 201625 Mar 2017
424officecleaningmeridian.comGoDaddy.com, LLC13 Jun 201325 Jul 202313 Jun 2023
425officecleaningkansascity.comDynadot, LLC14 May 20229 May 202414 May 2025
426officecleaningprices.comGoDaddy.com, LLC28 Oct 201121 Oct 202428 Oct 2025
427officecleaningfargo.comWild West Domains, LLC9 Jan 201214 Jan 20169 Jan 2018
428officecleaninginbonitasprings.comGoDaddy.com, LLC9 Nov 201228 Oct 20159 Nov 2016
429officecleaningindianapolis.comGoDaddy.com, LLC3 Apr 20243 Apr 20243 Apr 2025
430officecleaningwithlove.comeNom, Inc.7 Jul 20092 Jul 20157 Jul 2017
431officecleaningsiouxfalls.com1API GmbH19 Feb 20145 Apr 202319 Feb 2026
432officecleaningbrighton.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Jan 201410 Jan 20259 Jan 2026
433officecleaningeastbrunswick.comeNom, Inc.17 Jun 201330 Aug 201617 Jun 2017
434officecleaningontario.comMat Bao Trading & Service Company Limited d/b/a Ma…22 Sep 202123 Sep 202122 Sep 2022
435officecleaningcolchester.comeNom, Inc.6 Jan 20118 Dec 20146 Jan 2019
436officecleaningfrisco.comGoDaddy.com, LLC21 Jul 200921 Jul 202321 Jul 2025
437officecleaning-brooklyn.comDomain.com, LLC28 Feb 201213 Feb 201728 Feb 2018
438officecleaningservicesboston.comGoDaddy.com, LLC23 Apr 201823 Apr 202423 Apr 2025
439officecleaningnyc.comHostinger, UAB4 Feb 20237 Dec 20234 Feb 2026
440officecleaningspecialist.comNameCheap, Inc.3 May 20101 Aug 20243 May 2025
441officecleaningbusinesshelp.comGoDaddy.com, LLC5 Nov 200815 Oct 20155 Nov 2016
442officecleaningstafford.comEasyspace LTD18 May 201018 May 202418 May 2025
443officecleaningmorriscounty.comGoDaddy.com, LLC21 Feb 201210 Feb 202321 Feb 2025
444officecleaningservicenashville.comeNom, Inc.5 Nov 201229 Oct 20175 Nov 2018
445officecleaninglosangeles.comGoDaddy.com, LLC27 Jul 201428 Jul 202427 Jul 2025
446officecleaningindy.comGoDaddy.com, LLC23 Jan 201324 Jan 201623 Jan 2017
447officecleaningprosmi.comeNom, Inc.26 Oct 201230 Oct 201726 Oct 2018
448officecleaningservicesinmaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
449officecleaning4u.comGoDaddy.com, LLC9 Sep 201227 Aug 20249 Sep 2025
450officecleaningnaplesfl.comGoDaddy.com, LLC21 Mar 201422 Mar 202421 Mar 2025
451officecleaninghull.comGoDaddy.com, LLC1 Mar 20112 Mar 20241 Mar 2025
452officecleaningscarborough.comLCN.COM Ltd.15 Mar 201313 Jul 201715 Mar 2019
453officecleaningcompanyboston.comWild West Domains, LLC21 Jan 201421 Jan 202521 Jan 2026
454officecleaningservices.comTucows Domains Inc.11 Nov 199912 Oct 202411 Nov 2025
455officecleaningchattanooga.comGoDaddy.com, LLC20 Oct 201221 Oct 201420 Oct 2016
456officecleaningbury.comWebfusion Ltd.17 Mar 201410 Mar 201617 Mar 2018
457officecleaningsystem.comeNom, Inc.14 Feb 201320 Mar 201614 Feb 2017
458officecleaninginplano.com-25 Nov 202425 Nov 202425 Nov 2025
459officecleaningdallas.comGoDaddy.com, LLC21 Jul 200921 Jul 202421 Jul 2026
460officecleaningsarasota.comGoDaddy.com, LLC14 Nov 201015 Nov 201514 Nov 2016
461officecleaningcardiff.com1&1 Internet AG23 Mar 200824 Mar 201623 Mar 2017
462officecleaningipswich.comeNom, Inc.6 Jan 20118 Dec 20146 Jan 2019
463officecleaninginc.comGoogle, Inc.28 Mar 202227 Apr 202328 Mar 2023
464officecleaningservicelongisland.comGoDaddy.com, LLC26 Oct 201327 Oct 202426 Oct 2025
465officecleaninginftmyers.comGoDaddy.com, LLC28 Nov 201128 Oct 201528 Nov 2016
466officecleaningmiami.comNameCheap, Inc.28 Mar 202428 Mar 202428 Mar 2025
467officecleaningservicesnj.comGoDaddy.com, LLC11 Jul 200912 Jul 201611 Jul 2021
468officecleaningservicesfortlauderdale.comFastDomain Inc.7 Jun 20137 Jun 20177 Jun 2018
469officecleaningbuffalo.comGoDaddy.com, LLC16 Sep 201015 Sep 201516 Sep 2016
470officecleaningedison.comGoDaddy.com, LLC28 Jul 201328 Jul 202428 Jul 2025
471officecleaningofcentralwi.comTucows Domains Inc.9 Mar 201013 Mar 20229 Mar 2022
472officecleaningprofits.comGoDaddy.com, LLC3 Nov 20054 Nov 20153 Nov 2016
473officecleaningpasadena.comBeijing Lanhai Jiye Technology Co., Ltd30 Aug 202218 Dec 202430 Aug 2025
474officecleaning-phoenixaz.comGMO Internet Inc.10 Jun 201419 May 201710 Jun 2018
475officecleaningminneapolis.comGoDaddy.com, LLC2 Jun 20201 Jul 20242 Jun 2025
476officecleaningfranchises.comeNom, Inc.2 Jan 201325 Apr 202311 Feb 2023
477officecleaningnj.comGoDaddy.com, LLC11 Jul 200912 Jul 202411 Jul 2025
478officecleaningguide.comGoDaddy.com, LLC10 Sep 201911 Sep 202410 Sep 2029
479officecleaningcrystallakeillinios.com1&1 Internet AG22 Nov 201323 Nov 201622 Nov 2017
480officecleaningphoenixaz.comGoDaddy.com, LLC9 May 201120 May 20159 May 2017
481officecleaningrocklandcounty.comOmnis Network, LLC22 Jun 201222 Jun 202422 Jun 2025
482officecleaningincapecoral.comGoDaddy.com, LLC5 Nov 20111 Nov 20245 Nov 2025
483officecleaning-nyc.comGoDaddy.com, LLC25 Nov 200910 Jan 20249 Jan 2027
484officecleaningsf.comGoDaddy.com, LLC6 Sep 20117 Sep 20246 Sep 2025
485officecleaningbrampton.comFastDomain Inc.15 Apr 201415 May 202315 Apr 2028
486officecleaningbusinesses.comGoDaddy.com, LLC1 Dec 200511 Nov 20241 Dec 2025
487officecleaningnewhaven.comeNom, Inc.18 Oct 20134 Oct 201418 Oct 2016
488officecleaningmaine.comNamesilo, LLC23 Jul 201924 Jul 201923 Jul 2020
489officecleaningnewyork.comGoDaddy.com, LLC4 Jul 20174 Jul 20244 Jul 2025
490officecleaningct.comGoDaddy.com, LLC11 Dec 202124 Oct 202411 Dec 2025
491officecleaningdepot.comDomain.com, LLC4 Sep 20204 Sep 20204 Sep 2021
492officecleaningiowa.com1&1 Internet AG7 Jun 20118 Jun 20167 Jun 2017
493officecleaningvaughan.comFastDomain Inc.15 Apr 201415 May 202315 Apr 2028
494officecleaningessex.comNameCheap, Inc.17 Aug 201210 Aug 202317 Aug 2024
495officecleaningmemphis.comGoDaddy.com, LLC14 Sep 201115 Sep 202414 Sep 2025
496officecleaningmanhattan.comGoDaddy.com, LLC9 Jan 201310 Jan 20249 Jan 2027
497officecleaningapp.comGoDaddy.com, LLC17 Jan 20111 Jan 201517 Jan 2017
498officecleaning-miltonkeynes.comMesh Digital Limited2 Feb 201128 Jan 20162 Feb 2018
499officecleaningcompaniesinbattersea.com1&1 Internet AG28 Nov 201329 Nov 201528 Nov 2016
500officecleaningstartup.comeNom, Inc.1 May 20115 Apr 20161 May 2017
501officecleaningact.comNetwork Solutions, LLC3 Aug 201416 Oct 20243 Aug 2024
502officecleaningcolumbus.comNameCheap, Inc.30 Aug 20247 Sep 202430 Aug 2025
503officecleaningcompany.comGoDaddy.com, LLC23 Sep 20063 Sep 202423 Sep 2025
504officecleaningexpert.comGoDaddy.com, LLC25 Aug 202425 Aug 202425 Aug 2027
505officecleaningrochester.comPorkbun, LLC20 Jan 201129 Sep 202420 Jan 2027
506officecleaningportland.comGoDaddy.com, LLC13 Oct 20108 Sep 202213 Oct 2030
507officecleaningcontracts.comTucows Domains Inc.9 Aug 200913 Aug 20219 Aug 2021
508officecleaningequipment.com-21 Feb 20212 Feb 202421 Feb 2025
509officecleaningmanchester.comDreamHost, LLC28 Apr 201811 Jul 202428 Apr 2024
510officecleaningusa.comGoDaddy.com, LLC18 Nov 20128 Nov 20247 Nov 2025
511officecleaningbuffalony.comGoDaddy.com, LLC16 Sep 201015 Sep 201516 Sep 2016
512officecleaningquote.comGoDaddy.com, LLC11 Mar 201012 Mar 202411 Mar 2025
513officecleaningtoronto.comFastDomain Inc.15 Apr 201415 May 202315 Apr 2028
514officecleaningdenverco.comGoDaddy.com, LLC30 May 201031 May 201630 May 2017
515officecleaningdetroit.comGoDaddy.com, LLC4 Oct 20244 Oct 20244 Oct 2025
516officecleaningsouthflorida.comGoDaddy.com, LLC29 Jan 201329 Jan 201529 Jan 2017
517officecleaninglouisville.comGoDaddy.com, LLC8 Oct 20218 Oct 20218 Oct 2022
518officecleaning-bergennj.comGoDaddy.com, LLC29 Nov 201016 Sep 202429 Nov 2025
519officecleaninguk.comTucows Domains Inc.20 Jan 200024 Jan 202520 Jan 2026
520officecleaningbirmingham.comTucows Domains Inc.23 Mar 200723 Mar 202423 Mar 2025
521officecleaningbostonco.comGoDaddy.com, LLC18 May 201224 Jan 201318 May 2018
522officecleaning4you.comGoDaddy.com, LLC24 Feb 200825 Feb 202424 Feb 2029
523officecleaningbids.comGoDaddy.com, LLC25 Feb 201126 Feb 202425 Feb 2025
524officecleaningproducts.comeNom, Inc.1 May 20122 Apr 20241 May 2025
525officecleaningserviceslosangeles.comTucows Domains Inc.24 Nov 202424 Nov 202424 Nov 2025
526officecleaningin.comGoDaddy.com, LLC4 Nov 201128 Oct 20154 Nov 2016
527officecleaningmarkham.comFastDomain Inc.15 Apr 201415 Apr 201715 Apr 2018
528officecleaningwaukesha.comGoDaddy.com, LLC12 Feb 201313 Feb 202512 Feb 2026
529officecleaninginfortmyers.comGoDaddy.com, LLC5 Nov 20111 Nov 20245 Nov 2025
530officecleaningofatlanta.comGoDaddy.com, LLC6 Sep 20117 Sep 20166 Sep 2017
531officecleaningbedford.comTucows Domains Inc.19 Aug 201119 Apr 202419 Aug 2025
532officecleaningvideos.comGoDaddy.com, LLC7 Nov 201128 Oct 20157 Nov 2016
533officecleaningbrokers.comCrazy Domains FZ-LLC28 Feb 201128 Feb 201728 Feb 2019
534officecleaningkettering.comMesh Digital Limited25 Feb 201410 Feb 201625 Feb 2017
535officecleaningnassau.comGoDaddy.com, LLC13 Mar 200914 Mar 202313 Mar 2025
536officecleaningmedfordoregon.comGoDaddy.com, LLC26 Jul 20119 Sep 202226 Jul 2025
537officecleaningcanberra.comCrazy Domains FZ-LLC18 Oct 201230 Dec 202318 Oct 2023
538officecleaning-london.comGoDaddy.com, LLC6 Jun 201316 Jun 20156 Jun 2017
539officecleaningnaples.comGoDaddy.com, LLC14 Mar 201115 Mar 202414 Mar 2025
540officecleaningorangecounty.comGoDaddy.com, LLC6 Nov 200810 Nov 20156 Nov 2016
541officecleaning-services.comGoDaddy.com, LLC8 Dec 20109 Dec 20248 Dec 2026
542officecleaningservicesnewjersey.comeNom, Inc.27 Apr 201229 Mar 201527 Apr 2018
543officecleaningbristol.comGoDaddy.com, LLC29 Oct 202310 Jan 202529 Oct 2024
544officecleaningleeds.comWebfusion Ltd.26 Feb 20133 Jan 202426 Feb 2026
545officecleaninginmarin.comGoDaddy.com, LLC5 Jun 20136 Jun 20165 Jun 2017
546officecleaningconcord.comFastDomain Inc.15 Apr 201415 May 202315 Apr 2028
547officecleaningspokane.comGoDaddy.com, LLC12 Jun 201113 Jun 201512 Jun 2017
548officecleaningaustintx.comGoDaddy.com, LLC9 May 201120 May 20159 May 2017
549officecleaninglongisland.comGoDaddy.com, LLC13 Mar 200914 Mar 202313 Mar 2025
550officecleaningservicestlouis.comGoDaddy.com, LLC5 Nov 20126 Nov 20245 Nov 2025
551officecleaningnorthampton.comMesh Digital Limited25 Feb 201410 Feb 201625 Feb 2017
552officecleaningconnection.comGoDaddy.com, LLC5 Feb 20136 Feb 20255 Feb 2026
553officecleaningfresno.comGoDaddy.com, LLC11 Jul 20137 Jul 201611 Jul 2018
554officecleaningdenver.comGoDaddy.com, LLC8 Nov 20189 Nov 20238 Nov 2028
555officecleaningbraintree.com1&1 Internet AG9 Nov 200910 Nov 20169 Nov 2017
556officecleaningatlanta.comGoDaddy.com, LLC18 May 20078 Nov 20247 Nov 2025
557officecleaningpalmbeach.comGoDaddy.com, LLC15 Mar 201016 Mar 202415 Mar 2025
558officecleaningsd.comNameCheap, Inc.21 Jun 20134 Jun 202421 Jun 2026
559officecleaningnashvilletn.comTucows Domains Inc.14 Mar 201318 Mar 202014 Mar 2020
560officecleaningandjanitorialboise.comGoDaddy.com, LLC7 Sep 20117 Sep 20247 Sep 2025
561officecleaningvictoriabc.comBeijing Lanhai Jiye Technology Co., Ltd21 May 201430 Dec 202421 May 2025
562officecleaningjobs.comGoDaddy.com, LLC21 Jun 20051 Jun 202421 Jun 2025
563officecleaningspecialists.comGoDaddy.com, LLC12 Feb 201112 Feb 202512 Feb 2027
564officecleaningedmonton.comNetwork Solutions, LLC8 Mar 201412 Jul 20178 Mar 2018
565officecleaningboulder.comGoDaddy.com, LLC9 Sep 20099 Sep 20249 Sep 2027
566officecleaningservice.comGoDaddy.com, LLC31 Dec 199911 Dec 202431 Dec 2025
567officecleaningsussex.comHosting Concepts B.V. dba Openprovider16 Jul 202420 Oct 202416 Jul 2025
568officecleaningservicesnyc.comGoDaddy.com, LLC24 Oct 201210 Jan 20259 Jan 2026
569officecleaningwashingtondc.comGoDaddy.com, LLC24 Oct 201225 Oct 202424 Oct 2026
570officecleaningservicenorthpalmbeach.comTucows Domains Inc.4 Oct 20138 Oct 20184 Oct 2018
571officecleaningcarmel.comGoDaddy.com, LLC7 Nov 201018 Aug 20157 Nov 2016
572officecleaningcentralcoast.comeNom, Inc.2 Dec 201016 Mar 20161 Dec 2018
573officecleaningaylesbury.comTucows Domains Inc.19 Aug 201119 Aug 202319 Aug 2025
574officecleaningfortmyer.comGoDaddy.com, LLC15 Apr 201329 Mar 202415 Apr 2025
575officecleaninginmckinney.com1&1 Internet AG23 Aug 201017 Mar 201823 Aug 2025
576officecleaningkent.comGoDaddy.com, LLC28 May 202429 May 202428 May 2025
577officecleaningtampa.comGoDaddy.com, LLC6 Oct 20246 Oct 20246 Oct 2025
578officecleaningseattle.comGo Canada Domains, LLC4 Mar 20145 Mar 20244 Mar 2025
579officecleaningeastyorkshire.comGoDaddy.com, LLC1 Mar 20112 Mar 20241 Mar 2025
580officecleaningswansea.comMesh Digital Limited7 Jun 201220 Jun 20177 Jun 2018
581officecleaningnashville.comGoDaddy.com, LLC10 Sep 201031 Aug 202410 Sep 2025
582officecleaningsomerset.comGoDaddy.com, LLC17 Aug 201317 Aug 202417 Aug 2025
583officecleaningcalgary.comGoDaddy.com, LLC18 Sep 201818 Sep 201818 Sep 2019
584officecleaningsupply.com-17 Jun 202318 Jun 202417 Jun 2025
585officecleaningservicecoloradosprings.comGoDaddy.com, LLC10 Jun 20146 Jun 201610 Jun 2017
586officecleaningbid.comGoDaddy.com, LLC24 Dec 20122 Jan 202524 Dec 2026
587officecleanings.comTurnCommerce, Inc. DBA NameBright.com7 Mar 201121 Apr 20207 Mar 2025
588officecleaningservicewestpalm.comTucows Domains Inc.10 Dec 200914 Dec 201610 Dec 2016
589officecleaningjob.comGoDaddy.com, LLC5 Oct 200629 Sep 20155 Oct 2016
590officecleaningpro.comGoDaddy.com, LLC29 Dec 201130 Dec 202429 Dec 2025
591officecleaningccc.comTucows Domains Inc.12 May 201013 Apr 202412 May 2025
592officecleaningsolutions.comTucows Domains Inc.24 Mar 200224 Feb 202424 Mar 2025
593officecleaningexperts.comGoDaddy.com, LLC1 Feb 20171 Feb 20251 Feb 2026
594officecleaningaugusta.comeNom, Inc.20 Jun 201419 May 201520 Jun 2017
595officecleaningsanfrancisco.comGoDaddy.com, LLC5 Sep 20106 Sep 20245 Sep 2025
596officecleaningmississauga.comEnomnz, Inc.22 May 202122 May 202122 May 2022
597officecleaningcompanies.comGoDaddy.com, LLC7 Jan 200312 Jan 20257 Jan 2026
598officecleaningsupplies.comGoDaddy.com, LLC27 Jun 200321 Jun 202427 Jun 2025
599officecleaningmcallen.comGMO Internet Inc.6 Aug 20216 Aug 20216 Aug 2022
600officecleaningblog.comGoDaddy.com, LLC22 Nov 201128 Oct 201522 Nov 2016
601officecleaninghaverhill.comWild West Domains, LLC7 May 20128 May 20197 May 2020
602officecleaningma.comHongkong Domain Name Information Management Co., L…6 Jan 20216 Jan 20216 Jan 2022
603officecleaningservicemaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
604officecleaninglondon.comGoDaddy.com, LLC20 Jan 200021 Jan 202520 Jan 2026
605officecleaningjanitorialservices.comGoDaddy.com, LLC10 Jun 200821 Jan 201620 Jan 2021
606officecleaningserviceil.comTucows Domains Inc.22 Feb 201126 Feb 201722 Feb 2017
607officecleaningdandenong.comNameCheap, Inc.27 Aug 202427 Aug 202427 Aug 2025
608officecleaningsuffolk.comGoDaddy.com, LLC13 Mar 200914 Mar 201513 Mar 2017
609officecleaningwaltham.com1&1 Internet AG9 Nov 200917 Mar 20189 Nov 2025
610officecleaning-pro.comGoDaddy.com, LLC4 Oct 20128 Sep 20154 Oct 2016
611officecleaningcorby.comMesh Digital Limited25 Feb 201410 Feb 201625 Feb 2017
612officecleaningplano.comGoDaddy.com, LLC20 Jul 200921 Jul 202320 Jul 2025
613officecleaninginmelbourne.comCrazy Domains FZ-LLC8 Apr 201119 Apr 20228 Apr 2022
614officecleaningcharlotte.comGoDaddy.com, LLC5 Apr 20246 Oct 20245 Apr 2026
615officecleaningraleigh.comGoDaddy.com, LLC4 Oct 20244 Oct 20244 Oct 2025
616officecleaningirving.comGoDaddy.com, LLC21 Jul 200921 Jul 201521 Jul 2017
617officecleaningwimbledon.comEasyspace LTD27 May 20107 Sep 201727 May 2018
618officecleaningcompaniesanaheim.comWild West Domains, LLC1 May 20132 May 20161 May 2017
619officecleaninglasvegas.comGoDaddy.com, LLC29 Jun 201430 Jun 202429 Jun 2025
620officecleaningtampabay.comGoDaddy.com, LLC9 May 201120 May 20159 May 2017
621officecleaningcontractor.comDropCatch.com 380 LLC4 Mar 202431 Oct 20244 Mar 2025
622officecleaning-southjersey.comDomainPeople, Inc.8 Dec 20109 Nov 20168 Dec 2017
623officecleaningnewyorkcity.comCloud Yuqu LLC17 Apr 202017 Apr 202017 Apr 2021
624officecleaningservicenj.comGoDaddy.com, LLC11 Jul 200912 Jul 201611 Jul 2021
625officecleaningaberdeen.comTucows Domains Inc.13 Feb 202018 Feb 202313 Feb 2023
626officecleaning-boston.comGoDaddy.com, LLC22 Oct 201123 Oct 202422 Oct 2026
627officecleaningamerica.comName.com, Inc.1 Oct 201227 Oct 20171 Oct 2017
628officecleaningservicenyc.comWild West Domains, LLC20 Nov 201321 Nov 202420 Nov 2025
629officecleaningdoncaster.comWebfusion Ltd.23 Mar 201021 Feb 201723 Mar 2018
630officecleaningpros.comGoDaddy.com, LLC7 Aug 20108 Aug 20247 Aug 2025
631officecleaning-queens.comChengdu West Dimension Digital Technology Co., Ltd…21 May 201921 May 201921 May 2020
632officecleaningfishers.comGoDaddy.com, LLC7 Nov 201018 Aug 20157 Nov 2016
633officecleaningstamford.comMesh Digital Limited25 Feb 201410 Feb 201625 Feb 2017
634officecleaningcompaniesnyc.comGoDaddy.com, LLC14 Jul 201415 Jul 202414 Jul 2025
635officecleaningcrew.comGoDaddy.com, LLC21 May 200722 May 202421 May 2027
636officecleaningatlantaga.comTucows Domains Inc.25 Jun 201029 Jun 201725 Jun 2017
637officecleaninginchicago.comNameCheap, Inc.17 Apr 201218 Mar 202417 Apr 2025
638officecleaningeugene.comGoDaddy.com, LLC14 Dec 201214 Dec 202414 Dec 2026
639officecleaninginmaine.comeNom, Inc.15 Apr 200916 Feb 201715 Apr 2018
640officecleaningrichardson.comGoDaddy.com, LLC21 Jul 200921 Jul 202321 Jul 2025
641officecleaningirvine.comGoDaddy.com, LLC6 Nov 200810 Nov 20156 Nov 2016
642officecleaningnottingham.comWebfusion Ltd.21 Feb 201022 Feb 202421 Feb 2025
643officecleaningalbuquerque.comeNom, Inc.3 Nov 20128 Oct 20153 Nov 2016
644officecleaninggreenville.comGoDaddy.com, LLC21 Jul 20116 May 201621 Jul 2017
645officecleaningcharlottenc.com1&1 Internet AG7 Jan 201417 Mar 20187 Jan 2026
646officecleaninginnaples.comGoDaddy.com, LLC5 Nov 201128 Oct 20155 Nov 2016
647officecleaningbostonma.comGoDaddy.com, LLC15 Aug 201216 Aug 202415 Aug 2026
648officecleaninginmanchester.comWebfusion Ltd.15 Oct 200916 Oct 202415 Oct 2025
649officecleaningmansfield.comGoDaddy.com, LLC7 Sep 20128 Sep 20167 Sep 2017
650officecleaningcork.com-19 Sep 201619 Sep 201619 Sep 2017
651officecleaning786.comLaunchpad, Inc.21 Sep 20162 Nov 201721 Sep 2017
652officecleaning954.comLaunchpad, Inc.21 Sep 20162 Nov 201721 Sep 2017
653officecleaning305.comLaunchpad, Inc.21 Sep 20162 Nov 201721 Sep 2017
654officecleaning754.comLaunchpad, Inc.21 Sep 20162 Nov 201721 Sep 2017
655officecleaningandservices.comGoDaddy.com, LLC22 Sep 201623 Sep 201722 Sep 2018
656officecleaninginmiami.comGoDaddy.com, LLC25 Sep 201625 Sep 202425 Sep 2026
657officecleaningdoral.comGoDaddy.com, LLC20 Jun 202420 Jun 202420 Jun 2027
658officecleaningqueensland.comeNom, Inc.26 Sep 201615 Oct 201726 Sep 2018
659officecleaningcompany.netGoogle, Inc.23 Jul 202123 Jul 202123 Jul 2022
660officecleaningmelbourne.infoCrazy Domains FZ-LLC26 Jun 20138 Aug 202426 Jun 2024
661officecleaningcompany.infoGoDaddy.com, LLC27 Sep 20129 Oct 201627 Sep 2017
662officecleaningsantarosa.infoGoDaddy.com, LLC5 Mar 201326 Jun 20245 Mar 2025
663officecleaningwashingtondc.infoGoDaddy.com, LLC24 Oct 20128 Dec 202424 Oct 2025
664officecleaningservices.infoVautron Rechenzentrum AG26 Jun 201410 Aug 202426 Jun 2025
665officecleaningnashville.infoGoDaddy.com, LLC24 Oct 20128 Dec 202424 Oct 2025
666officecleaningconnection.infoGoDaddy.com, LLC5 Feb 20135 Feb 20255 Feb 2026
667officecleaningcompanies.netPDR Ltd. d/b/a PublicDomainRegistry.com11 Oct 20162 Jun 201711 Oct 2017
668officecleaningmelbourne.net1&1 Internet AG16 Jul 202028 Aug 202016 Jul 2025
669officecleaningindiana.netGoDaddy.com, LLC7 Nov 201018 Aug 20157 Nov 2016
670officecleaninglosangeles.netName.com, Inc.7 Feb 20129 Feb 20257 Feb 2025
671officecleaningservices.netGoDaddy.com, LLC26 Feb 20186 Feb 202526 Feb 2026
672officecleaninginlondon.netHosting Concepts B.V. dba Openprovider13 Apr 201023 Aug 202413 Apr 2026
673officecleaningconnection.netGoDaddy.com, LLC5 Feb 20136 Feb 20255 Feb 2026
674officecleaningindianapolis.netGoDaddy.com, LLC13 Jun 20101 Apr 201613 Jun 2017
675officecleaningservice.netNetwork Solutions, LLC28 Oct 202313 Oct 202428 Oct 2025
676officecleaningfortmyers.netGoDaddy.com, LLC17 Oct 201119 Sep 201517 Oct 2016
677officecleaningchicago.netWild West Domains, LLC18 Aug 200919 Aug 201618 Aug 2017
678officecleaningnewyork.netName.com, Inc.29 Mar 201129 Feb 201629 Mar 2017
679officecleaningbristol.netRally Cry Domains, LLC19 May 20232 Jul 202419 May 2024
680officecleaningservicelondon.neteNom, Inc.1 May 20125 May 20171 May 2018
681officecleaningcontracts.netTucows Domains Inc.22 Aug 200926 Aug 201922 Aug 2019
682officecleaningtips.netGoDaddy.com, LLC14 Nov 201128 Oct 201514 Nov 2016
683officecleaningboston.net1&1 Internet AG7 Jul 20067 Dec 20177 Jul 2025
684officecleaninglasvegas.netGoDaddy.com, LLC8 Oct 20248 Oct 20248 Oct 2025
685officecleaningmemphis.netTucows Domains Inc.14 Feb 201318 Feb 201714 Feb 2017
686officecleaningpros.netGoDaddy.com, LLC28 Mar 20119 Sep 202228 Mar 2026
687officecleaning-nyc.netDomain.com, LLC28 Feb 201213 Feb 201728 Feb 2018
688officecleaningtampa.netregister.com, Inc.5 Jan 20135 Jan 20135 Jan 2019
689officecleaningbonitasprings.netGoDaddy.com, LLC17 Oct 201119 Sep 201517 Oct 2016
690officecleaningserviceslondon.neteNom, Inc.1 May 20125 May 20171 May 2018
691officecleaninghonolulu.netGoDaddy.com, LLC23 Nov 200924 Nov 201523 Nov 2017
692officecleaninglondon.orgMesh Digital Limited17 Sep 200521 Nov 202417 Sep 2025
693officecleaningindianapolis.orgGoDaddy.com, LLC28 Dec 201012 Dec 201628 Dec 2017
694officecleaningservice.orgGoDaddy.com, LLC18 Oct 200819 Oct 201718 Oct 2018
695officecleaningbrisbane.orgeNom, Inc.20 Mar 20138 Mar 201620 Mar 2017
696officecleaningconnection.orgGoDaddy.com, LLC5 Feb 20135 Feb 20255 Feb 2026
697officecleaning-london.orgMoniker Online Services LLC25 Jan 201314 Jan 201725 Jan 2018
698officecleaningmemphis.orgGoDaddy.com, LLC14 Sep 201129 Oct 202414 Sep 2025
699officecleaningsupplies.org-16 Jan 202517 Jan 202516 Jan 2026
700officecleaningnashville.orgGoDaddy.com, LLC24 Oct 20128 Dec 202424 Oct 2026
701officecleaningservice.usNameCheap, Inc.22 Jan 201928 Dec 202422 Jan 2026
702officecleaningproducts.xyzNameCheap, Inc.17 Sep 201526 Sep 201617 Sep 2017
703officecleaninghome.xyzUniregistrar Corp1 Jun 201623 Sep 20161 Jun 2017
704officecleaningsupplies.xyzGoDaddy.com, LLC16 Mar 202410 Sep 202416 Mar 2025
705officecleaningwebsites.com-26 Oct 201626 Oct 201626 Oct 2017
706officecleaningwales.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…29 Aug 20146 Sep 201629 Aug 2018
707officecleaningcanarywharf.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 201616 Dec 20174 Nov 2017
708officecleaningportlandmaine.comWild West Domains, LLC8 Nov 20169 Nov 20248 Nov 2025
709officecleaningservicesmontreal.comDomain.com, LLC17 Nov 201617 Nov 201617 Nov 2017
710officecleaningserviceslaval.comDomain.com, LLC17 Nov 201620 Nov 201717 Nov 2017
711officecleaningservicesottawa.comDomain.com, LLC17 Nov 201620 Nov 201717 Nov 2017
712officecleaningserviceslongueuil.comDomain.com, LLC17 Nov 201620 Nov 201717 Nov 2017
713officecleaningtamworth.comGoDaddy.com, LLC17 Nov 201617 Nov 201617 Nov 2017
714officecleaningservicesoncall.comGoDaddy.com, LLC18 Nov 201618 Nov 201618 Nov 2019
715officecleaningrichmond.comPorkbun, LLC13 Jan 202513 Jan 202513 Jan 2026
716officecleaningcompanynyc.comNetwork Solutions, LLC7 Dec 201617 Mar 20177 Dec 2018
717officecleaningwestjordan.netTucows Domains Inc.20 Dec 201624 Dec 201820 Dec 2018
718officecleaningcentralpoint.comGoDaddy.com, LLC31 Dec 201631 Dec 202331 Dec 2028
719officecleaningservicepros.comGoDaddy.com, LLC30 Dec 201631 Dec 202430 Dec 2025
720officecleaningmedford.comGoDaddy.com, LLC31 Dec 201631 Dec 202331 Dec 2028
721officecleaningsutherlandshire.comGoDaddy.com, LLC5 Jan 20175 Jan 20175 Jan 2018
722officecleaningservicessutherlandshire.comGoDaddy.com, LLC5 Jan 20175 Jan 20175 Jan 2018
723officecleaningcornwall.comeNom, Inc.16 Jan 201717 Jan 201816 Jan 2018
724officecleaningcambridge.comNameCheap, Inc.12 Sep 201913 Aug 202412 Sep 2025
725officecleaningofco.comInterweb Advertising D.B.A. Profile Builder26 Jan 201726 Jan 201726 Jan 2018
726officecleaningofcolorado.comTucows Domains Inc.20 Jan 201729 Mar 201720 Jan 2018
727officecleaningquotes.comNameCheap, Inc.21 Aug 20222 Nov 202321 Aug 2023
728officecleaningmilwaukee.comGoDaddy.com, LLC1 Feb 201714 Jan 20251 Feb 2026
729officecleaning58801.comGoDaddy.com, LLC11 Feb 201712 Feb 202511 Feb 2026
730officecleaningwinnipeg.comGoDaddy.com, LLC23 Feb 20174 Sep 202424 Sep 2025
731officecleaningcindy.comNameCheap, Inc.26 Feb 201726 Feb 201726 Feb 2018
732officecleaningsnashvilletn.comregister.com, Inc.1 Mar 20171 Mar 20171 Mar 2018
733officecleaningkc.comGoDaddy.com, LLC2 Mar 20172 Mar 20242 Mar 2025
734officecleaningclermont.com1&1 Internet AG24 Mar 20178 Oct 201824 Mar 2025
735officecleaningsoftware.comGoDaddy.com, LLC5 Sep 20245 Sep 20245 Sep 2025
736officecleaningorlandofl.comTucows Domains Inc.10 Apr 201714 Apr 202010 Apr 2020
737officecleaningjobs.org.uk-5 Aug 201014 Aug 20175 Aug 2018
738officecleaningstcharles.comGoDaddy.com, LLC19 Apr 201719 Apr 201719 Apr 2018
739officecleaningtn.comGoogle, Inc.19 Apr 201723 Apr 202419 Apr 2025
740officecleaninggurus.comWild West Domains, LLC20 Apr 201720 Apr 202420 Apr 2025
741officecleaningnow.com1&1 Internet AG5 Sep 20235 Sep 20235 Sep 2025
742officecleaningoakland.orgWild West Domains, LLC25 Apr 201725 Jun 201725 Apr 2018
743officecleaningsvcs.com1&1 Internet AG29 May 202213 Jun 202229 May 2025
744officecleaninggainesville.comGoDaddy.com, LLC8 May 20172 May 20248 May 2025
745officecleaningspecialist.infoFastDomain Inc.10 May 20179 Jul 201710 May 2018
746officecleaningsolutionsdfw.comPDR Ltd. d/b/a PublicDomainRegistry.com12 May 20178 May 202412 May 2025
747officecleaningdallastx.comNameCheap, Inc.5 Jan 20216 Dec 20245 Jan 2026
748officecleaningcompaniesnashville.comGoDaddy.com, LLC21 May 201721 May 202321 May 2025
749officecleaningphiladelphia.comGoDaddy.com, LLC2 Jun 20201 Jul 20242 Jun 2025
750officecleaningservicesraleighnc.comGoDaddy.com, LLC17 Jan 202017 Jan 202017 Jan 2021
751officecleaningraleighnc.comGoDaddy.com, LLC29 May 201729 May 201729 May 2018
752officecleaninginphoenix.comGoogle, Inc.8 Jun 20178 Jun 20178 Jun 2018
753officecleaningandhandymanpros.comGoDaddy.com, LLC10 Jun 201710 Jun 201710 Jun 2018
754officecleaning-hampshire.comURL Solutions, Inc.12 Jun 20175 Jan 201812 Jun 2018
755officecleaningsaltlakecity.comGoDaddy.com, LLC30 Jun 201730 Jun 201730 Jun 2018
756officecleaningbocaratonfl.comHiChina Zhicheng Technology Limited20 Sep 201821 Sep 201820 Sep 2019
757officecleaningwhiteplains.comGoDaddy.com, LLC19 Dec 201919 Dec 201919 Dec 2020
758officecleaningreadingpa.comGoogle, Inc.19 Aug 201719 Aug 201719 Aug 2018
759officecleaningwyomissingpa.comGoogle, Inc.19 Aug 201719 Aug 201719 Aug 2018
760officecleaningextonpa.comGoogle, Inc.19 Aug 201719 Aug 201719 Aug 2018
761officecleaningspringridgepa.comGoogle, Inc.19 Aug 201719 Aug 201719 Aug 2018
762officecleaningsolutions.netTucows Domains Inc.20 Jan 202424 Jan 202520 Jan 2026
763officecleaningbocaraton.com1&1 Internet AG30 Oct 202430 Oct 202430 Oct 2025
764officecleaningservicenh.comGoogle, Inc.13 Sep 201713 Sep 201713 Sep 2018
765officecleaningportsmouth.co.uk-8 Feb 20133 Apr 20188 Feb 2019
766officecleaningsouthampton.co.uk-9 Jan 201426 Sep 20169 Jan 2018
767officecleaningserviceblog.infoGoDaddy.com, LLC12 Oct 201712 Oct 201712 Oct 2018
768officecleaningglasgow.co.uk-10 Jul 202218 Jul 202410 Jul 2025
769officecleaningauburndale.comTucows Domains Inc.9 Nov 201713 Nov 20189 Nov 2018
770officecleaningonline.comDomain.com, LLC21 Nov 201721 Nov 201721 Nov 2018
771officecleaningwaukegan.comGoDaddy.com, LLC27 Nov 201728 Nov 202427 Nov 2025
772officecleaningsinc.comNetwork Solutions, LLC14 Dec 201714 Dec 201714 Dec 2018
773officecleaningtamworth.co.uk-29 Dec 20236 Sep 202429 Dec 2025
774officecleaninglondon.co.uk-28 Dec 201726 Dec 202428 Dec 2025
775officecleaninglondon.uk-31 Jan 20231 Feb 202431 Jan 2025
776officecleaningservicesottawa.ca-16 Nov 201631 Dec 201716 Nov 2018
777officecleaningaberdeen.ukClick Registrar, Inc. d/b/a publicdomainregistry.c…12 May 201620 Nov 201712 May 2018
778officecleaningservices.co.uk-16 Feb 200827 Aug 202416 Feb 2025
779officecleaning-manchester.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
780officecleaningerdington.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
781officecleaningmidland.co.uk-23 Mar 200723 Mar 202423 Mar 2025
782officecleaning-pro.co.uk-13 Apr 201210 Aug 202413 Apr 2025
783officecleaningcorby.co.uk-2 Feb 20113 Feb 20172 Feb 2019
784officecleaningdoncaster.co.uk-8 Jun 201210 Apr 20248 Jun 2026
785officecleaningrugby.co.uk-25 Apr 20224 Aug 202325 Apr 2024
786officecleaninghuntingdon.co.uk-13 Feb 201714 Feb 202513 Feb 2026
787officecleaningamersham.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…11 Jan 20134 Jan 201711 Jan 2019
788officecleaningbournemouth.co.uk-27 Jan 200928 Feb 201727 Jan 2019
789officecleaninginsunbury.co.uk-23 Jan 20154 Feb 201523 Jan 2018
790officecleaninglondonuk.co.uk-28 Nov 201229 Oct 202428 Nov 2026
791officecleaning-kent.uk-24 Oct 201725 Oct 202424 Oct 2025
792officecleaningreading.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
793officecleaningbath.co.uk-16 Dec 201415 Dec 202416 Dec 2025
794officecleaningbirmingham.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…27 Mar 201023 Jan 201627 Mar 2018
795officecleaningaldridge.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
796officecleaning-solihull.co.ukReserved11 Sep 201010 Sep 201611 Sep 2018
797officecleaningmanchester.co.uk-13 Sep 202314 Sep 202413 Sep 2024
798officecleaningfelixstowe.co.uk-11 Aug 201611 Aug 201611 Aug 2018
799officecleaningbromsgrove.co.ukReserved21 Nov 201119 Dec 201721 Nov 2019
800officecleaningcannock.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
801officecleaningserviceslondon.org.ukHello Internet Corp.1 May 201229 Apr 20161 May 2018
802officecleaningrosyth.co.uk-9 Feb 201426 Jan 20179 Feb 2018
803officecleaningteam.co.uk-2 Feb 20203 Sep 20242 Feb 2025
804officecleaning-aberdeen.co.uk-10 Mar 20119 Feb 201710 Mar 2018
805officecleaningcambridge.co.ukHello Internet Corp.9 Jun 201510 May 20179 Jun 2018
806officecleaning-sheffield.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
807officecleaningbishopsstortford.co.ukHello Internet Corp.14 Jan 201420 Jan 201714 Jan 2018
808officecleaningloughborough.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Jun 20163 Jun 201710 Jun 2018
809officecleaningsaffronwalden.co.uk-29 Jul 202229 Jul 202229 Jul 2023
810officecleaningabingdon.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…31 Jul 201225 Jul 201631 Jul 2018
811officecleaningcontractors.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…1 Mar 201223 Feb 20161 Mar 2018
812officecleaningslough.co.uk-11 Jan 201311 Jan 202511 Jan 2027
813officecleaning-kent.co.uk-10 Dec 201011 Dec 202410 Dec 2026
814officecleaningcompany.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…1 Oct 201122 Aug 20171 Oct 2018
815officecleaningwestmidlands.co.uk-11 Sep 201230 Sep 202411 Sep 2025
816officecleaningbridgend.co.ukReserved17 Jan 200917 Mar 201717 Jan 2019
817officecleaningnorwich.co.uk-26 Jan 20123 Feb 201726 Jan 2018
818officecleaninghalifax.co.uk-16 Feb 201616 Feb 202516 Feb 2026
819officecleaningsurvey.co.ukReserved28 Jul 201427 Jul 201628 Jul 2018
820officecleaningsandwell.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
821officecleaningsouthport.co.uk-7 Jun 20121 Jun 20177 Jun 2018
822officecleaning-site.co.uk-18 Sep 200316 Sep 202418 Sep 2025
823officecleaningwithcare.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Apr 20089 Apr 201616 Apr 2018
824officecleaningnorthampton.co.uk-14 Mar 202214 Mar 202414 Mar 2024
825officecleaningbristol.co.uk-14 Jan 202215 Dec 202414 Jan 2026
826officecleaningbelfast.co.uk-23 Jun 201722 Jun 202323 Jun 2024
827officecleaningleeds.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
828officecleaningnorthlondon.co.uk-17 Jul 202417 Jul 202417 Jul 2025
829officecleaningpoole.co.ukLCN.COM Ltd.11 Dec 201320 Nov 201711 Dec 2019
830officecleaning-bedford.co.uk-24 May 201224 May 201624 May 2018
831officecleaningcentral-london.co.uk-9 Dec 20119 Nov 20179 Dec 2019
832officecleaninghemelhempstead.co.uk-19 Aug 201119 Aug 202319 Aug 2025
833officecleaningclerkenwell.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…19 Mar 201312 Mar 201719 Mar 2018
834officecleaningdevon.co.uk-6 Jun 201626 Jun 20246 Jun 2026
835officecleaningcambridge.uk-17 Jan 20172 Jan 201817 Jan 2019
836officecleaningnewport.co.ukReserved17 Jan 200917 Mar 201717 Jan 2019
837officecleaningbristol.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
838officecleaningliverpool.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
839officecleaninghitchin.co.uk-19 Aug 201119 Aug 202319 Aug 2025
840officecleaningchelmsford.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
841officecleaningmaidavale.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…19 Mar 201312 Mar 201719 Mar 2018
842officecleaningincheshire.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…2 Feb 201229 Jun 20162 Feb 2018
843officecleaningleicester.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
844officecleaningcomlimited.co.uk-2 Mar 200931 Jan 20172 Mar 2018
845officecleaningoxford.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
846officecleaningcoventry.co.uk-18 Jan 202218 Jan 202418 Jan 2025
847officecleaningstourbridge.co.uk-9 Mar 20118 Feb 20179 Mar 2018
848officecleaningsheffield.co.uk-29 Dec 202429 Dec 202429 Dec 2025
849officecleaningbuckingham.co.uk-20 Sep 201220 Sep 202420 Sep 2026
850officecleaninguk.co.uk-28 Jan 200029 Dec 202328 Jan 2026
851officecleaningswansea.co.ukReserved17 Jan 200916 Mar 201717 Jan 2019
852officecleaningjobs.co.uk-8 Jul 20108 Jun 20248 Jul 2025
853officecleaningmerryhill.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
854officecleaningessex.co.uk-16 Jan 201411 Jan 201616 Jan 2020
855officecleaninginlondon.co.uk-14 Aug 202325 Aug 202314 Aug 2025
856officecleaningwalsall.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
857officecleaningtelford.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…24 Feb 201217 Feb 201624 Feb 2018
858officecleaning-leeds.co.uk-12 May 20216 May 202412 May 2025
859officecleaning-services.co.uk-3 May 20102 May 20243 May 2026
860officecleaningperth.co.uk-17 Jun 201717 Jun 201717 Jun 2018
861officecleaningipswich.co.uk-11 Aug 201611 Aug 201611 Aug 2018
862officecleaning-nottingham.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
863officecleaningchorley.co.uk-9 Nov 201725 Oct 20249 Nov 2025
864officecleaningpro.co.uk-31 Jan 20129 Dec 202431 Jan 2026
865officecleaningeastmidlands.co.uk-9 Mar 20107 Aug 20249 Mar 2025
866officecleaningmaidenhead.co.uk-11 Jan 201311 Jan 202511 Jan 2027
867officecleaningwatford.co.uk-13 Sep 201013 Sep 202413 Sep 2026
868officecleaningbirmingham.co.uk-27 Jan 202328 Dec 202427 Jan 2026
869officecleaningwindsor.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…29 May 201323 May 201729 May 2019
870officecleaningliverpool.co.uk-15 Jul 201220 Sep 202415 Jul 2025
871officecleaningderby.co.uk-9 Mar 201012 Aug 20249 Mar 2025
872officecleaningservice.co.uk-13 Aug 202417 Jan 202513 Aug 2025
873officecleaning-birmingham.co.ukReserved11 Sep 201010 Sep 201611 Sep 2018
874officecleaningbicester.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…31 Jul 201224 Jul 201631 Jul 2018
875officecleaningdudley.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
876officecleaningmarlow.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…11 Jan 20134 Jan 201711 Jan 2019
877officecleaningkettering.co.uk-2 Feb 20113 Feb 20172 Feb 2019
878officecleaninginessex.co.ukReserved27 Apr 201226 Apr 201727 Apr 2018
879officecleaninghalesowen.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
880officecleaningessex.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
881officecleaning-london.co.uk-1 Feb 20002 Jan 20241 Feb 2026
882officecleaningprices.co.uk-2 Feb 202018 Jan 20252 Feb 2026
883officecleaningsuttoncoldfield.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
884officecleaningcompanies.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…1 Oct 201122 Aug 20171 Oct 2018
885officecleaning-london.org.uk-12 Jan 201013 Nov 202412 Jan 2025
886officecleaninginverkeithing.co.uk-9 Feb 201426 Jan 20179 Feb 2018
887officecleaninglondoncity.co.uk-11 Oct 201612 Oct 202411 Oct 2025
888officecleaningderby.org.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
889officecleaningbradford.co.ukeNom, Inc.8 Mar 20178 Mar 20178 Mar 2018
890officecleaningburton.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Dec 20153 Dec 201710 Dec 2018
891officecleaningedinburgh.co.uk-23 Mar 20116 Jan 202523 Mar 2025
892officecleaning-maidstone.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…24 Oct 201727 Nov 201724 Oct 2019
893officecleaningleeds.co.uk-14 Apr 20234 Dec 202314 Apr 2024
894officecleaningnottinghill.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…19 Mar 201312 Mar 201719 Mar 2018
895officecleaningwolverhampton.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…25 Dec 201125 Aug 201725 Dec 2018
896officecleaningladies.co.uk-19 Feb 201315 Feb 201619 Feb 2022
897officecleaningcroydon.co.uk-20 Sep 201222 Aug 201720 Sep 2018
898officecleaningwestbromwich.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
899officecleaningco.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Dec 200915 Dec 201710 Dec 2017
900officecleaningleicester.co.uk-21 Mar 202012 Feb 202521 Mar 2025
901officecleaningwellingborough.co.uk-2 Feb 20113 Feb 20172 Feb 2019
902officecleaningcoalville.co.uk-10 Feb 201710 Feb 201710 Feb 2018
903officecleaningkidderminster.co.ukReserved24 Feb 201223 Feb 201624 Feb 2018
904officecleaningbury.co.ukHello Internet Corp.27 Apr 201027 Apr 201727 Apr 2018
905officecleaningcompany.co.uk-23 Apr 202428 Nov 202423 Apr 2025
906officecleaningcompaniesinbattersea.co.uk-28 Nov 201327 Nov 202328 Nov 2025
907officecleaningdaventry.co.uk-24 May 201224 May 201624 May 2018
908officecleaningbolton.co.ukHello Internet Corp.18 Aug 201718 Aug 201718 Aug 2018
909officecleaningwestminster.co.ukReserved24 Feb 201724 Feb 201724 Feb 2018
910officecleaningdunfermline.co.uk-9 Feb 201426 Jan 20179 Feb 2018
911officecleaninginbirmingham.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Oct 20129 Oct 201616 Oct 2018
912officecleaningborehamwood.co.uk-19 Aug 201119 Aug 202319 Aug 2025
913officecleaning-ln.co.uk-5 Apr 20052 Sep 20245 Apr 2025
914officecleaninginsunderland.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Jun 20139 Jun 201716 Jun 2018
915officecleaninginoxford.co.uk-29 Apr 202124 May 202429 Apr 2025
916officecleaningoldham.co.ukHello Internet Corp.16 Jun 201116 Jun 201716 Jun 2018
917officecleaningmiltonkeynes.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Jul 20099 Jul 201716 Jul 2019
918officecleaningcheltenham.co.uk-15 Mar 20113 Jul 202415 Mar 2025
919officecleaningdorking.co.uk-5 Dec 20236 Dec 20245 Dec 2025
920officecleaningscarborough.co.ukLCN.COM Ltd.2 Oct 200711 Sep 20172 Oct 2019
921officecleaningdidcot.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…31 Jul 201224 Jul 201631 Jul 2018
922officecleaningrochdale.co.uk-17 Mar 20147 Jul 202417 Mar 2025
923officecleaninglimited.co.uk-2 Mar 200931 Jan 20172 Mar 2018
924officecleaningcontracts.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…1 Dec 201324 Nov 20161 Dec 2018
925officecleaningservicekent.co.uk-19 Oct 201019 Oct 202419 Oct 2025
926officecleaninghuddersfield.co.uk-13 Jul 20068 Jul 202213 Jul 2024
927officecleaningservicesinbirmingham.co.ukeNom, Inc.6 Aug 201531 Jul 20176 Aug 2018
928officecleaningstalbans.co.uk-19 Aug 201119 Aug 202319 Aug 2025
929officecleaningleicestershire.co.uk-8 Aug 202216 Jul 20248 Aug 2024
930officecleaninghighwycombe.co.uk-11 Jan 201311 Jan 202511 Jan 2027
931officecleaningmidlands.co.uk-14 Jan 201019 Jun 202414 Jan 2026
932officecleaningluton.co.uk-13 Sep 201013 Sep 202413 Sep 2026
933officecleaning-maidstone.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…10 Dec 20103 Dec 201610 Dec 2018
934officecleaningdurham.co.ukHello Internet Corp.7 Jul 20177 Jul 20177 Jul 2018
935officecleaningfranchise.co.ukReserved23 Sep 201422 Sep 201623 Sep 2018
936officecleaning247.co.uk-31 Jan 20129 Dec 202431 Jan 2026
937officecleaningaberdeen.co.ukClick Registrar, Inc. d/b/a publicdomainregistry.c…16 Jan 201816 Jan 201816 Jan 2019
938officecleaningsandiego.infoGoDaddy.com, LLC27 Jan 201827 Jan 201827 Jan 2019
939officecleaningtoledo.comNameCheap, Inc.8 Feb 20188 Feb 20188 Feb 2019
940officecleaningbrighton.co.uk-14 Feb 201815 Feb 201814 Feb 2019
941officecleaningcompanylondon.co.uk-16 Feb 201816 Feb 201816 Feb 2020
942officecleaningcheltenham.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…16 Oct 20171 Mar 201816 Oct 2019
943officecleaningleslieville.comTucows Domains Inc.9 Mar 201813 Mar 20199 Mar 2019
944officecleaningnottingham.co.uk-7 Mar 20186 Mar 20247 Mar 2025
945officecleaninggreektown.comTucows Domains Inc.9 Mar 201813 Mar 20199 Mar 2019
946officecleaningcompany-london.co.ukThe Registry at Info Avenue, LLC d/b/a Spirit Comm…13 Mar 201813 Mar 201813 Mar 2019
947officecleaningexperts.co.uk-13 Mar 201820 Jul 202413 Mar 2025
948officecleaningspecialist.netDomain.com, LLC21 Mar 20185 Mar 202421 Mar 2025
949officecleaningmagic.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Mar 201828 Mar 201828 Mar 2019
950officecleaningnorthwales.co.uk-31 Mar 201831 Mar 201831 Mar 2019
951officecleaningbromley.co.ukClick Registrar, Inc. d/b/a publicdomainregistry.c…27 Apr 201830 Apr 201827 Apr 2019
952officecleaningoxford.co.uk-27 Apr 201827 Apr 201827 Apr 2019
953officecleaningsurrey.co.ukeNom, Inc.2 May 20182 May 20182 May 2019
954officecleaningcontractors.comGoDaddy.com, LLC20 Aug 201921 Aug 202420 Aug 2025
955officecleaningwala.onlineGoDaddy.com, LLC17 May 201817 May 201817 May 2019
956officecleaningsuffolk.co.ukClick Registrar, Inc. d/b/a publicdomainregistry.c…5 Jun 20185 Jun 20185 Jun 2019
957officecleaningjobs.netGoDaddy.com, LLC11 Jun 201812 Jun 202411 Jun 2025
958officecleaningjensenbeach.comTucows Domains Inc.26 Jun 201830 Jun 201926 Jun 2019
959officecleaningincome.comNameCheap, Inc.28 Jun 201828 Jun 201828 Jun 2019
960officecleaningmacquariepark.sydneyGoDaddy.com, LLC12 Jul 201817 Jul 201812 Jul 2019
961officecleaninggrandeprairie.comTucows Domains Inc.17 Jul 201821 Jul 201917 Jul 2019
962officecleaningclairmont.comTucows Domains Inc.17 Jul 201821 Jul 201917 Jul 2019
963officecleaningcroydon.comeNom, Inc.2 Aug 20182 Aug 20182 Aug 2019
964officecleaningparramatta.comInstra Corporation Pty Ltd.13 Jan 202215 Jan 202513 Jan 2026
965officecleaningnearme.comGoDaddy.com, LLC4 Aug 201818 Aug 20244 Aug 2025
966officecleaningdownsview.comTucows Domains Inc.8 Aug 201812 Aug 20198 Aug 2019
967officecleaningcommercialcleaning.comGoDaddy.com, LLC20 Aug 201820 Aug 202420 Aug 2026
968officecleaningverobeach.comGoDaddy.com, LLC17 Sep 201817 Sep 201817 Sep 2019
969officecleaningcarteret.comNordreg AB16 Dec 202416 Dec 202416 Dec 2025
970officecleaningstaff.comPorkbun, LLC25 Apr 202425 Apr 202425 Apr 2025
971officecleaningcompany.servicesGoDaddy.com, LLC27 Sep 201827 Sep 201827 Sep 2019
972officecleaningcompany.sydneyInstra Corporation Pty Ltd.6 Oct 2018-6 Oct 2019
973officecleaningdubai.comGoDaddy.com, LLC18 Aug 202219 Aug 202418 Aug 2025
974officecleaningkentucky.comGoDaddy.com, LLC8 Nov 20189 Nov 20238 Nov 2028
975officecleaninglead.comNetwork Solutions, LLC13 Nov 201814 Oct 202413 Nov 2026
976officecleaningexpress.comGoDaddy.com, LLC2 Jun 20201 Jul 20242 Jun 2025
977officecleaningliverpool.uk-16 Nov 201816 Nov 201816 Nov 2019
978officecleaningmelbourne1.comGoDaddy.com, LLC19 Nov 201819 Nov 201819 Nov 2019
979officecleaningadelaide.comCrazy Domains FZ-LLC23 Nov 201823 Nov 201823 Nov 2020
980officecleaningservicesnearme.comCosmotown, Inc.27 Dec 202318 Dec 202427 Dec 2025
981officecleaningcompaniesnearme.comCrazy Domains FZ-LLC5 Dec 20185 Dec 20185 Dec 2019
982officecleaningmaintenance.comGoDaddy.com, LLC7 Dec 20187 Dec 20187 Dec 2020
983officecleaningandmaintenance.comGoDaddy.com, LLC7 Dec 20187 Dec 20187 Dec 2020
984officecleaningteam.comPorkbun, LLC25 Apr 202425 Apr 202425 Apr 2025
985officecleaningwork.comGoDaddy.com, LLC27 Jan 201928 Jan 202527 Jan 2027
986officecleaningservicesjm.comGandi SAS30 Jan 201930 Dec 202430 Jan 2026
987officecleaningdunedin.comGoDaddy.com, LLC31 Jan 20191 Feb 202531 Jan 2027
988officecleaningnewjersey.comeNom, Inc.8 Dec 202220 Feb 20248 Dec 2023
989officecleaningclearwater.comGoDaddy.com, LLC31 Jan 20191 Feb 202531 Jan 2027
990officecleaningpalmharbor.comGoDaddy.com, LLC31 Jan 20191 Feb 202531 Jan 2027
991officecleaningarizona.comNetwork Solutions, LLC1 Feb 20191 Feb 20191 Feb 2020
992officecleaningcontractortampa.comGoDaddy.com, LLC4 Mar 20194 Mar 20194 Mar 2021
993officecleaningservicestampa.comGoDaddy.com, LLC18 Aug 202230 Oct 202318 Aug 2023
994officecleaningservicetampa.comGoDaddy.com, LLC18 Aug 202230 Oct 202318 Aug 2023
995officecleaningplusllc.comGoDaddy.com, LLC5 Mar 20195 Mar 20195 Mar 2020
996officecleaningcleveland.comGoDaddy.com, LLC2 Jun 20201 Jul 20242 Jun 2025
997officecleaningcanton.comGoDaddy.com, LLC6 Oct 20246 Oct 20246 Oct 2025
998officecleaningakron.comGoDaddy.com, LLC4 Oct 20244 Oct 20244 Oct 2025
999officecleaningyoungstown.comregister.com, Inc.5 Mar 20195 Mar 20195 Mar 2020
1000officecleaningtallahassee.comGoDaddy.com, LLC8 Mar 20198 Mar 20198 Mar 2021

Displaying 1,000 out of 2,402 domains starting with the keyword "OFFICECLEANING". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=officecleaning

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now