With support for 
Keyword: OPTO
Reverse Whois » KEYWORD [opto ] { 16,371 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | opto.com.br | - | 16 Apr 1997 | 3 Apr 2024 | 16 Apr 2027 |
| 2 | opto.in.th | - | 20 Jan 2009 | 20 Nov 2024 | 19 Jan 2027 |
| 3 | opto.engineering | NameKing.com Inc. | 14 Oct 2023 | 27 Nov 2024 | 14 Oct 2024 |
| 4 | opto.vision | - | 12 May 2022 | 14 Oct 2024 | 12 May 2025 |
| 5 | opto.media | eNom, Inc. | 23 Jul 2014 | 29 Jun 2024 | 23 Jul 2025 |
| 6 | opto.nyc | Network Solutions, LLC | 10 Nov 2014 | 16 Sep 2024 | 9 Nov 2025 |
| 7 | opto.immo | OVH sas | 11 Dec 2014 | 12 Dec 2024 | 11 Dec 2025 |
| 8 | opto.top | - | 13 Feb 2024 | 13 Oct 2024 | 13 Feb 2026 |
| 9 | opto.link | 1API GmbH | 8 Apr 2015 | 8 Jun 2024 | 8 Apr 2025 |
| 10 | opto.solutions | GoDaddy.com, LLC | 10 Oct 2021 | 24 Nov 2024 | 10 Oct 2025 |
| 11 | opto.plus | Chengdu West Dimension Digital Technology Co., Ltd… | 6 Jan 2021 | 2 Jan 2025 | 6 Jan 2026 |
| 12 | opto.club | Dynadot, LLC | 12 Sep 2024 | 12 Jan 2025 | 12 Sep 2025 |
| 13 | opto.work | NameCheap, Inc. | 28 Jan 2019 | 28 Dec 2024 | 28 Jan 2026 |
| 14 | opto.space | NameCheap, Inc. | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 15 | opto.wang | eName Technology Co., Ltd. | 16 Nov 2015 | 16 Nov 2015 | 16 Nov 2016 |
| 16 | opto.systems | Uniregistrar Corp | 21 Mar 2021 | 10 Jun 2024 | 21 Mar 2025 |
| 17 | opto.clinic | GoDaddy.com, LLC | 8 Dec 2015 | 22 Jan 2025 | 8 Dec 2025 |
| 18 | opto.xyz | Dynadot, LLC | 16 May 2020 | 31 Aug 2023 | 16 May 2026 |
| 19 | opto.mobi | GoDaddy.com, LLC | 10 Oct 2021 | 24 Nov 2024 | 10 Oct 2025 |
| 20 | opto.com | GoDaddy.com, LLC | 16 Jan 1996 | 18 Jan 2024 | 17 Jan 2029 |
| 21 | opto.site | - | 8 Apr 2024 | 8 May 2024 | 8 Apr 2025 |
| 22 | opto.science | OnlineNIC, Inc. | 16 Mar 2016 | - | 15 Mar 2017 |
| 23 | opto.srl | Tucows Domains Inc. | 18 Mar 2016 | 22 Mar 2022 | 18 Mar 2023 |
| 24 | opto.online | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Jan 2020 | 2 Jan 2025 | 20 Jan 2026 |
| 25 | opto.delivery | eNom, Inc. | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 26 | opto.vip | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Dec 2017 | 19 Nov 2024 | 9 Dec 2025 |
| 27 | opto.ltd | Cronon AG | 22 Jun 2016 | 6 Aug 2024 | 22 Jun 2025 |
| 28 | opto.gmbh | united-domains AG | 22 Jun 2016 | 4 Nov 2024 | 22 Jun 2025 |
| 29 | opto.group | Cronon AG | 8 Jun 2016 | 23 Jul 2024 | 8 Jun 2025 |
| 30 | opto.store | Cronon AG | 14 Jun 2016 | 29 Aug 2024 | 14 Jun 2025 |
| 31 | opto.training | eNom, Inc. | 26 Mar 2014 | 2 Mar 2017 | 26 Mar 2018 |
| 32 | opto.biz | Namesilo, LLC | 17 Feb 2021 | 19 Sep 2024 | 17 Feb 2025 |
| 33 | opto.ca | - | 25 Nov 2000 | 28 Jul 2023 | 27 Aug 2030 |
| 34 | opto.info | - | 13 Oct 2024 | 23 Jan 2025 | 13 Oct 2025 |
| 35 | opto.net | GoDaddy.com, LLC | 10 Apr 2003 | 11 Apr 2024 | 10 Apr 2029 |
| 36 | opto.org | NameSecure L.L.C. | 27 Jan 2000 | 12 Dec 2024 | 27 Jan 2026 |
| 37 | opto.us | OVH sas | 10 Jul 2011 | 6 Jul 2024 | 9 Jul 2025 |
| 38 | opto.quebec | GoDaddy.com, LLC | 18 Nov 2014 | 19 Nov 2016 | 18 Nov 2018 |
| 39 | opto.dk | - | 1 Apr 1998 | - | 30 Jun 2025 |
| 40 | opto.fr | - | 26 Jan 2005 | 26 Jan 2025 | 26 Jan 2026 |
| 41 | opto.net.nz | Key-Systems GmbH | 23 Mar 2022 | 2 May 2023 | - |
| 42 | opto.pl | EuroDNS S.A. | 12 Feb 2007 | 30 Jan 2025 | 12 Feb 2026 |
| 43 | opto.tv | GMO Internet Inc. | 8 Jan 2012 | 28 Dec 2024 | 8 Jan 2026 |
| 44 | opto.one | 1&1 Internet AG | 2 Nov 2016 | 17 Dec 2024 | 2 Nov 2025 |
| 45 | opto.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 28 Mar 2019 | 14 Jun 2024 | 28 Mar 2025 |
| 46 | opto.works | Cronon AG | 5 Feb 2020 | 22 Mar 2023 | 5 Feb 2024 |
| 47 | opto.world | GoDaddy.com, LLC | 10 Oct 2021 | 24 Nov 2024 | 10 Oct 2025 |
| 48 | opto.life | GoDaddy.com, LLC | 5 Jul 2019 | 16 Aug 2024 | 5 Jul 2024 |
| 49 | opto.com.tr | - | 14 Aug 2001 | - | 13 Aug 2018 |
| 50 | opto.co.uk | - | 1 May 2006 | 8 Sep 2024 | 1 May 2026 |
| 51 | opto.org.uk | - | 19 Feb 2025 | 20 Feb 2025 | 19 Feb 2026 |
| 52 | opto.network | NameCheap, Inc. | 10 Nov 2024 | 15 Nov 2024 | 10 Nov 2025 |
| 53 | opto.cloud | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 28 Feb 2018 | 19 Feb 2024 | 28 Feb 2025 |
| 54 | opto.company | GoDaddy.com, LLC | 10 Oct 2021 | 24 Nov 2024 | 10 Oct 2025 |
| 55 | opto.center | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Feb 2021 | 14 Oct 2024 | 27 Feb 2025 |
| 56 | opto.fail | Gandi SAS | 8 Mar 2019 | 8 Mar 2023 | 8 Mar 2024 |
| 57 | opto.movie | Google, Inc. | 5 Apr 2019 | 4 Jun 2024 | 5 Apr 2024 |
| 58 | opto.zone | Porkbun, LLC | 21 Nov 2023 | 25 Nov 2024 | 21 Nov 2025 |
| 59 | opto.agency | GoDaddy.com, LLC | 10 Oct 2024 | 15 Oct 2024 | 10 Oct 2025 |
| 60 | opto.de | - | - | 17 May 2019 | - |
| 61 | opto.fyi | NameCheap, Inc. | 4 Feb 2020 | 10 Jan 2025 | 4 Feb 2026 |
| 62 | opto.tax | GoDaddy.com, LLC | 1 Apr 2020 | 18 Aug 2024 | 1 Apr 2032 |
| 63 | opto.business | GoDaddy.com, LLC | 1 Apr 2020 | 13 May 2024 | 1 Apr 2024 |
| 64 | opto.pro | - | 24 Nov 2023 | 14 Oct 2024 | 24 Nov 2025 |
| 65 | opto.run | - | 14 Jan 2024 | 14 Jan 2025 | 14 Jan 2026 |
| 66 | opto.asia | united-domains AG | 5 Feb 2014 | 5 Feb 2025 | 5 Feb 2026 |
| 67 | opto.farm | Automattic Inc. | 23 Nov 2020 | 28 Nov 2024 | 23 Nov 2025 |
| 68 | opto.equipment | GoDaddy.com, LLC | 30 Nov 2020 | 14 Jan 2025 | 30 Nov 2026 |
| 69 | opto.money | GoDaddy.com, LLC | 27 Jan 2021 | 9 Mar 2024 | 27 Jan 2024 |
| 70 | opto.guru | NameCheap, Inc. | 2 Feb 2021 | 2 Feb 2021 | 2 Feb 2022 |
| 71 | opto.international | GoDaddy.com, LLC | 9 Feb 2021 | 22 Mar 2024 | 9 Feb 2024 |
| 72 | opto.digital | Uniregistrar Corp | 21 Mar 2021 | 10 Jun 2024 | 21 Mar 2025 |
| 73 | opto.design | Dynadot, LLC | 26 Jan 2025 | 26 Jan 2025 | 26 Jan 2026 |
| 74 | opto.today | GoDaddy.com, LLC | 10 Oct 2021 | 24 Nov 2024 | 10 Oct 2025 |
| 75 | opto.website | GoDaddy.com, LLC | 10 Oct 2021 | 20 Dec 2024 | 10 Oct 2025 |
| 76 | opto.services | GoDaddy.com, LLC | 10 Oct 2021 | 24 Nov 2024 | 10 Oct 2025 |
| 77 | opto.city | GoDaddy.com, LLC | 27 Dec 2021 | 24 Dec 2024 | 27 Dec 2025 |
| 78 | opto.global | 1&1 Internet AG | 17 Jan 2022 | 17 Jan 2022 | 17 Jan 2023 |
| 79 | opto.properties | GoDaddy.com, LLC | 14 Apr 2022 | 26 Apr 2023 | 14 Apr 2024 |
| 80 | opto.finance | NameCheap, Inc. | 3 May 2022 | 3 May 2023 | 3 May 2024 |
| 81 | opto.investments | Google, Inc. | 5 May 2022 | 19 Jun 2024 | 5 May 2025 |
| 82 | opto.ooo | Gandi SAS | 22 Jul 2022 | 5 Sep 2024 | 22 Jul 2024 |
| 83 | opto.net.cn | ???????????? | 17 Nov 2003 | - | 17 Nov 2028 |
| 84 | opto.cc | Namesilo, LLC | 1 Jan 2024 | 2 Jan 2025 | 1 Jan 2026 |
| 85 | opto.kr | Dotname Korea Corp. | 6 Mar 2007 | 29 Nov 2022 | 6 Mar 2023 |
| 86 | opto.net.in | GoDaddy.com, LLC | 14 Mar 2017 | 17 Mar 2022 | 14 Mar 2025 |
| 87 | opto.me | Key-Systems GmbH | 30 Sep 2012 | 21 Sep 2024 | 30 Sep 2025 |
| 88 | opto.blog | GoDaddy.com, LLC | 13 Jan 2023 | 14 Jan 2025 | 13 Jan 2026 |
| 89 | opto.bio | GoDaddy.com, LLC | 22 Mar 2022 | 6 May 2024 | 22 Mar 2025 |
| 90 | opto.africa | AF Proxy Services Ltd | 31 Jan 2018 | 11 Dec 2024 | 31 Jan 2026 |
| 91 | opto.app | Google, Inc. | 2 Dec 2019 | 5 Dec 2024 | 2 Dec 2025 |
| 92 | opto.co.th | - | 2 Nov 2016 | 2 Sep 2024 | 1 Nov 2025 |
| 93 | opto.edu.pl | - | 4 Jan 2019 | 5 Jan 2025 | 4 Jan 2026 |
| 94 | opto.market | Chengdu West Dimension Digital Technology Co., Ltd… | 22 Sep 2022 | 11 Nov 2024 | 22 Sep 2025 |
| 95 | opto.pt | - | - | - | - |
| 96 | opto.capital | Google, Inc. | 5 May 2022 | 19 Jun 2024 | 5 May 2025 |
| 97 | opto.fun | Key-Systems, LLC | 19 Oct 2023 | 29 Oct 2024 | 19 Oct 2025 |
| 98 | opto.co | GoDaddy.com, LLC | 20 Jul 2010 | 25 Jul 2024 | 19 Jul 2025 |
| 99 | opto.sale | Limited Liability Company "Registrar of domain nam… | 19 Jul 2022 | 6 Dec 2024 | 19 Jul 2025 |
| 100 | opto.wiki | NameCheap, Inc. | 21 Feb 2023 | 22 Feb 2025 | 21 Feb 2025 |
| 101 | opto.energy | GoDaddy.com, LLC | 10 Apr 2023 | 21 Jun 2024 | 10 Apr 2024 |
| 102 | opto.cpa | EnCirca, Inc. | 6 Nov 2020 | 13 Oct 2024 | 6 Nov 2025 |
| 103 | opto.dev | Google, Inc. | 13 Dec 2019 | 5 Dec 2024 | 13 Dec 2025 |
| 104 | opto.co.in | GoDaddy.com, LLC | 1 Apr 2020 | 13 May 2024 | 1 Apr 2024 |
| 105 | opto.it | - | 2 Aug 2004 | 21 Aug 2024 | 5 Aug 2025 |
| 106 | opto.live | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 27 Sep 2024 | 11 Oct 2024 | 27 Sep 2025 |
| 107 | opto.nl | - | 17 Nov 1999 | 22 Jan 2017 | - |
| 108 | opto.cl | - | 26 May 2023 | - | 26 May 2026 |
| 109 | opto.studio | Squarespace Domains LLC | 26 Jul 2024 | 31 Jul 2024 | 26 Jul 2025 |
| 110 | opto.solar | OnlineNIC, Inc. | 7 Jul 2023 | 29 Dec 2024 | 7 Jul 2025 |
| 111 | opto.watch | Gandi SAS | 16 Nov 2023 | 30 Jan 2025 | 16 Nov 2024 |
| 112 | opto.email | eNom, Inc. | 27 Nov 2023 | 9 Jan 2025 | 27 Nov 2024 |
| 113 | opto.care | Name.com, Inc. | 28 Nov 2023 | 12 Jan 2025 | 28 Nov 2025 |
| 114 | opto.de.com | Cronon AG | 6 Jul 2021 | 27 Sep 2024 | 6 Jul 2025 |
| 115 | opto.cfd | Namesilo, LLC | 6 Jan 2024 | 7 Jan 2025 | 6 Jan 2026 |
| 116 | opto.games | Limited Liability Company "Registrar of domain nam… | 14 Jan 2024 | 14 Jan 2025 | 14 Jan 2026 |
| 117 | opto.be | - | 9 Feb 2024 | - | - |
| 118 | opto.direct | Tucows Domains Inc. | 19 Feb 2024 | 24 Feb 2024 | 19 Feb 2026 |
| 119 | opto.nz | - | 3 Feb 2017 | 7 Feb 2024 | - |
| 120 | opto.co.jp | - | 31 Jan 1996 | 1 Feb 2024 | - |
| 121 | opto.uk | - | 26 Mar 2019 | 8 Sep 2024 | 26 Mar 2026 |
| 122 | opto.com.pl | - | 23 Jul 2015 | 26 Jun 2024 | 23 Jul 2025 |
| 123 | opto.org.cn | - | 18 Apr 2024 | - | 18 Apr 2025 |
| 124 | opto.ru | - | 12 Dec 2001 | - | 12 Dec 2025 |
| 125 | opto.cz | - | 16 Dec 2004 | 27 Oct 2021 | 15 Dec 2030 |
| 126 | opto.bot | NameCheap, Inc. | 15 May 2024 | 15 May 2024 | 15 May 2025 |
| 127 | opto.au | - | - | 27 Aug 2024 | - |
| 128 | opto.se | - | 4 Jan 1996 | 4 Dec 2024 | 31 Dec 2025 |
| 129 | opto.markets | CSC Corporate Domains, Inc. | 3 Dec 2024 | 8 Dec 2024 | 3 Dec 2025 |
| 130 | optout-tlsm.net | Name.com, Inc. | 5 Apr 2011 | 3 Apr 2024 | 5 Apr 2025 |
| 131 | optout-ltnrf.net | Name.com, Inc. | 4 Aug 2010 | 2 Aug 2024 | 4 Aug 2025 |
| 132 | optoma.co.uk | - | 17 Dec 1999 | 20 Nov 2024 | 17 Dec 2025 |
| 133 | optonline.net | GoDaddy.com, LLC | 7 Oct 1996 | 6 Oct 2024 | 6 Oct 2025 |
| 134 | optout-stnd.net | Name.com, Inc. | 5 Apr 2011 | 9 Mar 2017 | 5 Apr 2018 |
| 135 | optout-tpgc.net | Beijing Lanhai Jiye Technology Co., Ltd | 27 Nov 2023 | 29 Dec 2024 | 27 Nov 2024 |
| 136 | optometrieonline.de | - | - | 13 Feb 2024 | - |
| 137 | optout-blgl.net | Name.com, Inc. | 4 Aug 2010 | 7 Jul 2017 | 4 Aug 2018 |
| 138 | optout-blglb.net | West263 International Limited | 30 Sep 2021 | 30 Sep 2021 | 30 Sep 2022 |
| 139 | optout-jnjw.net | Name.com, Inc. | 14 Feb 2012 | 11 Feb 2025 | 14 Feb 2026 |
| 140 | optoma.com | eNom, Inc. | 1 Dec 1999 | 24 Feb 2024 | 1 Dec 2033 |
| 141 | optomausa.com | eNom, Inc. | 10 Apr 2001 | 24 Feb 2024 | 10 Apr 2033 |
| 142 | optometrists.org | eNom, Inc. | 20 Nov 1997 | 23 Nov 2024 | 19 Nov 2025 |
| 143 | optometry.co.uk | - | - | 25 Jan 2025 | 24 Jan 2026 |
| 144 | optonicaled.com | eNom, Inc. | 18 Jan 2012 | 3 Sep 2024 | 18 Jan 2027 |
| 145 | optout-cggd.net | Name.com, Inc. | 14 Mar 2012 | 13 Feb 2015 | 14 Mar 2016 |
| 146 | optout-hctm.net | Mat Bao Trading & Service Company Limited d/b/a Ma… | 23 Aug 2022 | 24 Aug 2023 | 23 Aug 2024 |
| 147 | optout-nrpx.net | Name.com, Inc. | 17 Nov 2010 | 11 Nov 2024 | 17 Nov 2025 |
| 148 | optout-xfkq.net | Name.com, Inc. | 24 Aug 2012 | 25 Jul 2017 | 24 Aug 2018 |
| 149 | optochemicals.com | Sitefrenzy.com LLC | 2 Feb 2024 | 7 Feb 2025 | 2 Feb 2026 |
| 150 | optocon.de | - | - | 6 May 2020 | - |
| 151 | optoma.com.tw | - | 16 Dec 1999 | - | 15 Oct 2023 |
| 152 | optoma.pl | Gandi SAS | 2 Feb 2002 | 27 Feb 2024 | 1 Feb 2026 |
| 153 | optout-bkclt.net | Name.com, Inc. | 25 May 2011 | 18 May 2024 | 25 May 2025 |
| 154 | optout-cnnf.net | Name.com, Inc. | 4 Aug 2010 | 2 Aug 2024 | 4 Aug 2025 |
| 155 | optout-phvz.net | Name.com, Inc. | 14 Mar 2012 | 8 Mar 2024 | 14 Mar 2025 |
| 156 | optout-sknk.net | Name.com, Inc. | 16 Nov 2010 | 29 Jul 2012 | 16 Nov 2013 |
| 157 | optolover.com | Regional Network Information Center, JSC dba RU-CE… | 12 Feb 2005 | 23 Dec 2023 | 11 Feb 2026 |
| 158 | optout-sclp.net | Web Commerce Communications Limited dba WebNic.cc | 24 Aug 2019 | 24 Aug 2019 | 24 Aug 2020 |
| 159 | optout-vkmc.net | Name.com, Inc. | 13 Dec 2011 | 8 Dec 2024 | 13 Dec 2025 |
| 160 | optoutuk.com | eNom, Inc. | 6 Oct 2004 | 25 Sep 2024 | 6 Oct 2025 |
| 161 | optospot.com | DropCatch.com 1427 LLC | 24 Mar 2024 | 25 Mar 2024 | 24 Mar 2025 |
| 162 | optout-gtcrh.net | Name.com, Inc. | 13 May 2011 | 6 May 2024 | 13 May 2025 |
| 163 | optout-lkbv.net | Name.com, Inc. | 4 Mar 2012 | 29 Feb 2024 | 4 Mar 2025 |
| 164 | optoutprescreen.com | GoDaddy.com, LLC | 10 Aug 2004 | 31 Oct 2024 | 12 Jul 2026 |
| 165 | optosea.com | HiChina Zhicheng Technology Limited | 21 Oct 2014 | 19 Oct 2022 | 21 Oct 2031 |
| 166 | optomisticproductions.com | register.com, Inc. | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 167 | optolighting.com | TurnCommerce, Inc. DBA NameBright.com | 11 Sep 2020 | 30 Aug 2022 | 11 Sep 2025 |
| 168 | opto22.com | Network Solutions, LLC | 14 May 1995 | 29 Apr 2019 | 15 May 2028 |
| 169 | optoindia.com | GoDaddy.com, LLC | 15 Feb 2000 | 15 Jan 2025 | 15 Feb 2026 |
| 170 | optolex.com | Regional Network Information Center, JSC dba RU-CE… | 26 Oct 2006 | 31 Mar 2016 | 25 Oct 2025 |
| 171 | optoma.de | - | - | 5 Nov 2018 | - |
| 172 | optometricmanagement.com | GoDaddy.com, LLC | 22 Jun 2001 | 23 Jun 2024 | 22 Jun 2025 |
| 173 | optometrists.asn.au | - | - | 20 Sep 2024 | - |
| 174 | optometry.net | Network Solutions, LLC | 9 Nov 1998 | 25 Jul 2022 | 8 Nov 2026 |
| 175 | optomi.com | GoDaddy.com, LLC | 2 May 2006 | 3 May 2023 | 2 May 2025 |
| 176 | opton-impex.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Mar 2014 | 2 Feb 2025 | 4 Mar 2026 |
| 177 | optopti.net | eNom, Inc. | 26 Jun 2013 | 21 Jun 2017 | 26 Jun 2018 |
| 178 | optoro.com | GoDaddy.com, LLC | 11 Mar 2008 | 15 Mar 2024 | 11 Mar 2025 |
| 179 | optos.com | Network Solutions, LLC | 3 Oct 1996 | 6 Nov 2021 | 2 Oct 2026 |
| 180 | optout-clxf.net | Name.com, Inc. | 12 Dec 2013 | 10 Nov 2016 | 12 Dec 2017 |
| 181 | optout-gcrw.net | NameCheap, Inc. | 15 Jan 2024 | 16 Jan 2025 | 15 Jan 2025 |
| 182 | optout-hpvq.net | Name.com, Inc. | 8 Jul 2014 | 7 Jun 2015 | 8 Jul 2016 |
| 183 | optout-mbng.net | Name.com, Inc. | 11 Dec 2013 | 8 Dec 2024 | 11 Dec 2025 |
| 184 | optout-mqxj.net | Name.com, Inc. | 10 Jun 2014 | 11 May 2017 | 10 Jun 2018 |
| 185 | optout-mzkl.net | NameCheap, Inc. | 14 Jan 2025 | 14 Jan 2025 | 14 Jan 2026 |
| 186 | optout-nmfc.net | Name.com, Inc. | 2 May 2013 | 27 Apr 2024 | 2 May 2025 |
| 187 | optout-nvxv.net | Key-Systems GmbH | 20 Jun 2017 | 20 Jun 2017 | 20 Jun 2018 |
| 188 | optout-pjvn.net | Name.com, Inc. | 21 Jun 2013 | 23 May 2017 | 21 Jun 2018 |
| 189 | optout-qjkt.net | Name.com, Inc. | 5 Feb 2014 | 4 Jan 2019 | 5 Feb 2020 |
| 190 | optout-qqgf.net | Name.com, Inc. | 27 Aug 2014 | 20 Aug 2024 | 27 Aug 2025 |
| 191 | optout-sqkr.net | Name.com, Inc. | 16 Apr 2013 | 11 Apr 2024 | 16 Apr 2025 |
| 192 | optout-thmq.net | Name.com, Inc. | 27 Feb 2015 | 26 Jan 2017 | 27 Feb 2018 |
| 193 | optout-wcjl.net | Name.com, Inc. | 6 Oct 2014 | 29 Sep 2024 | 6 Oct 2025 |
| 194 | optout-wmwh.net | GoDaddy.com, LLC | 13 Dec 2019 | 13 Dec 2019 | 13 Dec 2020 |
| 195 | optout-zqmn.net | Above.com Pty Ltd. | 12 Sep 2024 | 12 Sep 2024 | 12 Sep 2025 |
| 196 | optout-zvnv.net | Name.com, Inc. | 5 Sep 2014 | 30 Aug 2024 | 5 Sep 2025 |
| 197 | optoutsubmit.net | GoDaddy.com, LLC | 15 Jan 2015 | 16 Jan 2025 | 15 Jan 2026 |
| 198 | optoutsupport.net | eNom, Inc. | 19 Dec 2013 | 20 Nov 2024 | 19 Dec 2025 |
| 199 | optostroy.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Oct 2014 | 5 Oct 2022 | 22 Oct 2025 |
| 200 | optometristsalarybystate.com | Dynadot5 LLC | 5 Sep 2022 | 15 Nov 2023 | 5 Sep 2023 |
| 201 | optom.ru | - | 4 Apr 2002 | - | 4 Apr 2025 |
| 202 | optomtovar.ru | - | 12 Oct 2011 | - | 12 Oct 2025 |
| 203 | optor.ru | - | 14 May 2015 | - | 14 May 2025 |
| 204 | optolex.ru | - | 28 Mar 2024 | - | 28 Mar 2025 |
| 205 | optomvse.ru | - | 28 Feb 2023 | - | 28 Feb 2025 |
| 206 | optorg.ru | - | 14 May 2003 | - | 14 May 2025 |
| 207 | optovik62.ru | - | 31 May 2011 | - | 31 May 2025 |
| 208 | optovozoff.ru | - | 18 Aug 2020 | - | 18 Aug 2024 |
| 209 | optout-njmp.net | Name.com, Inc. | 21 Oct 2014 | 21 Oct 2014 | 21 Oct 2015 |
| 210 | optonlines.net | NameCheap, Inc. | 17 Dec 2024 | 18 Dec 2024 | 17 Dec 2025 |
| 211 | optovik.center | 1&1 Internet AG | 3 Dec 2024 | 18 Dec 2024 | 3 Dec 2025 |
| 212 | optom-toys.ru | - | 3 Apr 2024 | - | 3 Apr 2025 |
| 213 | optometristbocaraton.info | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 214 | optom-plus.ru | - | 3 Mar 2013 | - | 3 Mar 2025 |
| 215 | optom77.ru | - | 29 Mar 2014 | - | 29 Mar 2025 |
| 216 | optotaiwan.com | Web Commerce Communications Limited dba WebNic.cc | 5 May 2004 | 27 Apr 2020 | 5 May 2025 |
| 217 | optovozov.com | Regional Network Information Center, JSC dba RU-CE… | 22 Apr 2015 | 22 Apr 2015 | 21 Apr 2018 |
| 218 | optoviki.kz | Gandi SAS | 2 Jul 2010 | 8 Mar 2015 | - |
| 219 | optobee.de | - | - | 26 Jul 2015 | - |
| 220 | optout-wghd.net | GoDaddy.com, LLC | 3 Jul 2018 | 3 Jul 2018 | 3 Jul 2019 |
| 221 | optout-jsql.net | Name.com, Inc. | 4 Nov 2013 | 29 Oct 2024 | 4 Nov 2025 |
| 222 | optometristoshawa.com | GoDaddy.com, LLC | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2016 |
| 223 | optoapps.com | Dynadot, LLC | 15 Nov 2022 | 25 Jan 2025 | 15 Nov 2024 |
| 224 | optovaja-baza.ru | - | - | - | - |
| 225 | optometristsalaryguide.net | TurnCommerce, Inc. DBA NameBright.com | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 226 | optometristbocaraton.org | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 227 | optometristbocaraton.net | GoDaddy.com, LLC | 22 Oct 2014 | 22 Oct 2014 | 22 Oct 2015 |
| 228 | optom24.ru | - | 10 May 2013 | - | 10 May 2025 |
| 229 | optout-wdzc.net | Name.com, Inc. | 9 Jan 2013 | 8 Dec 2016 | 9 Jan 2018 |
| 230 | optoma.es | - | - | - | - |
| 231 | optovichkoff.ru | - | 12 Nov 2013 | - | 12 Nov 2025 |
| 232 | optovik-ru.ru | - | 4 Jun 2024 | - | 4 Jun 2025 |
| 233 | optomzdorovo.ru | - | 17 Sep 2014 | - | 17 Sep 2025 |
| 234 | optospan.com | Network Solutions, LLC | 22 Feb 2010 | 7 Oct 2022 | 22 Feb 2032 |
| 235 | optomaeurope.com | Gandi SAS | 13 Sep 2001 | 4 Jul 2024 | 13 Sep 2025 |
| 236 | optout-rhvd.net | Name.com, Inc. | 5 Jun 2012 | 29 May 2024 | 5 Jun 2025 |
| 237 | optoma.it | Gandi SAS | 6 Dec 2001 | 10 Aug 2024 | 25 Jul 2025 |
| 238 | optout-nbhr.net | Name.com, Inc. | 21 May 2015 | 19 Apr 2017 | 21 May 2018 |
| 239 | optout-ljlm.net | Name.com, Inc. | 23 Apr 2013 | 16 Apr 2024 | 23 Apr 2025 |
| 240 | optomo.com.au | - | - | 13 Jan 2025 | - |
| 241 | optovik.trade | 101domain, Inc. | 23 Oct 2014 | 25 Sep 2015 | 22 Oct 2015 |
| 242 | optotronincs.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Oct 2014 | 25 Oct 2014 | 25 Oct 2015 |
| 243 | optometristvancouver.com | Dynadot, LLC | 8 Oct 2024 | 14 Jan 2025 | 8 Oct 2025 |
| 244 | optomoll.ru | - | 23 Sep 2013 | - | 23 Sep 2025 |
| 245 | optoma.fr | - | 16 Oct 2002 | 9 Dec 2024 | 9 Jul 2029 |
| 246 | optout-bhzp.net | Name.com, Inc. | 12 Mar 2014 | 10 Feb 2017 | 12 Mar 2018 |
| 247 | optogan.ru | - | 10 Jan 2024 | - | 10 Jan 2026 |
| 248 | optout-bzcz.net | Name.com, Inc. | 6 Aug 2013 | 7 Jul 2017 | 6 Aug 2018 |
| 249 | optout-klhj.net | Beijing Lanhai Jiye Technology Co., Ltd | 3 Dec 2024 | 25 Jan 2025 | 3 Dec 2025 |
| 250 | optometricnetworking.com | GoDaddy.com, LLC | 26 May 2012 | 27 May 2015 | 26 May 2016 |
| 251 | optometryoptometry.net | GoDaddy.com, LLC | 27 May 2008 | 28 May 2015 | 27 May 2016 |
| 252 | optogic.com | Tucows Domains Inc. | 22 Oct 2013 | 26 Oct 2014 | 22 Oct 2015 |
| 253 | optokol.net | GoDaddy.com, LLC | 27 May 2014 | 28 May 2015 | 27 May 2016 |
| 254 | optometristjonesboro.com | GoDaddy.com, LLC | 28 May 2013 | 29 May 2015 | 28 May 2016 |
| 255 | optometrydirect.com | GoDaddy.com, LLC | 15 Apr 2012 | 16 Apr 2024 | 15 Apr 2025 |
| 256 | optometryequipmentreview.com | GoDaddy.com, LLC | 23 May 2011 | 24 May 2015 | 23 May 2016 |
| 257 | optomaburada.com | GoDaddy.com, LLC | 22 May 2014 | 23 May 2015 | 22 May 2016 |
| 258 | optoutcardiff.com | Wild West Domains, LLC | 4 Jun 2014 | 5 Jun 2015 | 4 Jun 2016 |
| 259 | optoutla.com | GoDaddy.com, LLC | 5 Jun 2014 | 18 May 2024 | 5 Jun 2026 |
| 260 | optoutla.org | GoDaddy.com, LLC | 17 Nov 2017 | 1 Jan 2025 | 17 Nov 2025 |
| 261 | optometrypracticefinancing.net | GoDaddy.com, LLC | 5 Jun 2011 | 6 Jun 2015 | 5 Jun 2016 |
| 262 | optometrypracticefinancing.org | GoDaddy.com, LLC | 5 Jun 2011 | 17 Jun 2015 | 5 Jun 2016 |
| 263 | optometristsilverdale.com | eNom, Inc. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 264 | optometristmineolany.com | Network Solutions, LLC | 27 Oct 2014 | 24 Aug 2017 | 27 Oct 2018 |
| 265 | optomedis.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Apr 2019 | 17 May 2024 | 11 Apr 2026 |
| 266 | optoelectron.com | TurnCommerce, Inc. DBA NameBright.com | 27 Oct 2014 | 21 Oct 2020 | 27 Oct 2025 |
| 267 | optoutmontana.org | - | - | - | - |
| 268 | optoutmontana.info | GoDaddy.com, LLC | 6 Jun 2014 | 6 Jun 2015 | 6 Jun 2016 |
| 269 | optophoria.com | GoDaddy.com, LLC | 3 Oct 2007 | 4 Oct 2014 | 3 Oct 2015 |
| 270 | optometryce.org | Key-Systems GmbH | 21 Mar 2017 | 19 Jan 2018 | 21 Mar 2019 |
| 271 | optoutday.com | NameCheap, Inc. | 4 Apr 2021 | 13 Mar 2024 | 4 Apr 2025 |
| 272 | optoide.com | Key-Systems GmbH | 21 Apr 2013 | 27 May 2024 | 21 Apr 2025 |
| 273 | optogenetex.com | GoDaddy.com, LLC | 18 Dec 2010 | 18 Dec 2014 | 18 Dec 2015 |
| 274 | optometriccare.com | eNom, Inc. | 25 Jul 2009 | 27 Jul 2024 | 25 Jul 2025 |
| 275 | optometricconsultants.com | eNom, Inc. | 23 Jan 2011 | 30 Jan 2025 | 23 Jan 2026 |
| 276 | optoelettronica.com | eNom, Inc. | 1 Apr 2011 | 19 Apr 2017 | 1 Apr 2018 |
| 277 | optoelectronicproducts.com | eNom, Inc. | 16 Apr 2011 | 17 Apr 2024 | 16 Apr 2025 |
| 278 | optometricclinic.com | eNom, Inc. | 14 May 2012 | 11 May 2024 | 14 May 2025 |
| 279 | optometriceyecare.com | eNom, Inc. | 19 Dec 2002 | 11 Dec 2024 | 19 Dec 2025 |
| 280 | optometriceyecarecenter.com | eNom, Inc. | 29 May 2009 | 25 May 2017 | 29 May 2018 |
| 281 | optometricinstruments.com | eNom, Inc. | 30 Apr 2011 | 11 May 2017 | 30 Apr 2018 |
| 282 | optometrico.com | eNom, Inc. | 15 Jan 2010 | 24 Jan 2025 | 15 Jan 2026 |
| 283 | optometricsociety.com | eNom, Inc. | 6 Aug 2011 | 2 Aug 2024 | 6 Aug 2025 |
| 284 | optoutservices.com | Epik Inc. | 12 Jun 2024 | 12 Jun 2024 | 12 Jun 2025 |
| 285 | optovaya.com | Limited Liability Company "Registrar of domain nam… | 18 Jan 2024 | 19 Jan 2025 | 18 Jan 2026 |
| 286 | optometrist.pw | Alpnames Limited | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 287 | optometry.pw | Alpnames Limited | 22 Jun 2015 | 22 Aug 2015 | 22 Jun 2017 |
| 288 | optometristlewisville.com | GoDaddy.com, LLC | 1 Jul 2011 | 2 Jul 2015 | 1 Jul 2016 |
| 289 | optometristthecolony.com | GoDaddy.com, LLC | 1 Jul 2011 | 2 Jul 2015 | 1 Jul 2016 |
| 290 | optometristsindianapolis.com | GoDaddy.com, LLC | 3 Feb 2020 | 3 Feb 2020 | 3 Feb 2021 |
| 291 | optometrydirectory.com | Annulet LLC | 21 Feb 2016 | 8 Apr 2017 | 21 Feb 2018 |
| 292 | optometristorangeville.com | GoDaddy.com, LLC | 20 Jan 2011 | 1 Jan 2025 | 31 Dec 2025 |
| 293 | optometristsorangeville.com | GoDaddy.com, LLC | 20 Jan 2011 | 1 Jan 2025 | 31 Dec 2025 |
| 294 | optocircuit.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 Jun 2023 | 1 Aug 2024 | 24 Jun 2024 |
| 295 | optometryorangeville.com | GoDaddy.com, LLC | 20 Jan 2011 | 1 Jan 2025 | 31 Dec 2025 |
| 296 | optomua.com | GoDaddy.com, LLC | 31 Jan 2020 | 31 Jan 2020 | 31 Jan 2021 |
| 297 | optomizkitaya.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Dec 2017 | 25 Dec 2017 | 25 Dec 2020 |
| 298 | optomitristinsurance.com | GoDaddy.com, LLC | 30 Jan 2009 | 19 Apr 2015 | 30 Jan 2019 |
| 299 | optometric.co | GoDaddy.com, LLC | 28 Jul 2010 | 24 Jul 2017 | 27 Jul 2017 |
| 300 | optometryconsulting.com | GoDaddy.com, LLC | 20 Sep 2021 | 20 Aug 2024 | 20 Sep 2025 |
| 301 | optometry1.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Feb 2006 | 1 Feb 2025 | 3 Feb 2026 |
| 302 | optometrist411.com | GoDaddy.com, LLC | 12 Oct 2008 | 16 Jun 2015 | 12 Oct 2015 |
| 303 | optometry411.com | GoDaddy.com, LLC | 10 Apr 2024 | 10 Apr 2024 | 10 Apr 2027 |
| 304 | optometryassistant.com | GoDaddy.com, LLC | 29 Jul 2013 | 15 Feb 2015 | 29 Jul 2015 |
| 305 | optometrytechnician.com | GoDaddy.com, LLC | 29 Jul 2013 | 3 Jul 2014 | 29 Jul 2015 |
| 306 | optometristsalary.info | GoDaddy.com, LLC | 16 Jul 2011 | 17 Jul 2014 | 16 Jul 2015 |
| 307 | optotaiwan.biz | GMO Internet Inc. | 29 Oct 2014 | 17 Sep 2016 | 28 Oct 2017 |
| 308 | optometristtulsa.com | GoDaddy.com, LLC | 29 Oct 2014 | 30 Oct 2023 | 29 Oct 2025 |
| 309 | optoelectronic.com | GoDaddy.com, LLC | 10 May 1999 | 11 May 2024 | 10 May 2025 |
| 310 | optojapan.com | Uniregistrar Corp | 7 Sep 2008 | 8 Sep 2024 | 7 Sep 2025 |
| 311 | optokorea.com | Uniregistrar Corp | 7 Sep 2008 | 8 Sep 2024 | 7 Sep 2025 |
| 312 | optosys.com | GoDaddy.com, LLC | 7 Feb 1997 | 27 Oct 2022 | 8 Feb 2026 |
| 313 | optometristassistant.com | GoDaddy.com, LLC | 20 Jan 2012 | 21 Jan 2025 | 20 Jan 2026 |
| 314 | optometry.us | Dynadot, LLC | 24 Apr 2002 | 15 Apr 2024 | 23 Apr 2025 |
| 315 | optosun.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 316 | optohost.net | FBS Inc. | 28 Oct 2014 | 25 May 2017 | 28 Oct 2018 |
| 317 | optoacoustic.net | GoDaddy.com, LLC | 13 May 2013 | 25 May 2015 | 13 May 2016 |
| 318 | optoacoustic.org | GoDaddy.com, LLC | 13 May 2013 | 24 Jun 2017 | 13 May 2018 |
| 319 | optoacoustics.org | GoDaddy.com, LLC | 13 May 2013 | 24 Jun 2017 | 13 May 2018 |
| 320 | optoacousticeye.com | GoDaddy.com, LLC | 13 May 2013 | 25 May 2015 | 13 May 2016 |
| 321 | optoacousticvision.com | GoDaddy.com, LLC | 13 May 2013 | 25 May 2015 | 13 May 2016 |
| 322 | optocousticsight.com | GoDaddy.com, LLC | 13 May 2013 | 25 May 2015 | 13 May 2016 |
| 323 | optomed.info | Tucows Domains Inc. | 29 Oct 2014 | 2 Nov 2022 | 29 Oct 2023 |
| 324 | optowik.com | NameKing.com Inc. | 19 Apr 2024 | 6 Jul 2024 | 19 Apr 2025 |
| 325 | optoquantum.com | Hostinger, UAB | 4 Aug 2024 | 4 Oct 2024 | 4 Aug 2026 |
| 326 | optoonow.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 327 | optoionow.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 328 | opto22.biz | GoDaddy.com, LLC | 30 Oct 2014 | 10 Dec 2023 | 29 Oct 2023 |
| 329 | opto22.info | GoDaddy.com, LLC | 30 Oct 2014 | 8 Sep 2017 | 30 Oct 2018 |
| 330 | optometrycampus.com | GoDaddy.com, LLC | 1 Nov 2014 | 1 Nov 2014 | 1 Nov 2015 |
| 331 | optometristssantarosa.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 332 | optout-ggvt.net | Name.com, Inc. | 23 Jan 2012 | 17 Jan 2025 | 23 Jan 2026 |
| 333 | optout-qkqf.net | Name.com, Inc. | 14 Mar 2014 | 8 Mar 2024 | 14 Mar 2025 |
| 334 | optoled.com | GoDaddy.com, LLC | 2 Dec 2003 | 3 Dec 2024 | 2 Dec 2025 |
| 335 | optometrist-directory.info | GoDaddy.com, LLC | 17 May 2005 | 1 Jul 2024 | 17 May 2025 |
| 336 | optout-dtlt.net | Beijing Lanhai Jiye Technology Co., Ltd | 30 Nov 2023 | 1 Dec 2024 | 30 Nov 2025 |
| 337 | optouttoday.com | GoDaddy.com, LLC | 6 Mar 2008 | 6 Jan 2025 | 5 Jan 2026 |
| 338 | optout-hksz.net | Name.com, Inc. | 14 Dec 2012 | 13 Nov 2016 | 14 Dec 2017 |
| 339 | optometryscharity.org | GoDaddy.com, LLC | 16 Aug 2007 | 16 Sep 2024 | 16 Aug 2025 |
| 340 | optometryforums.com | Porkbun, LLC | 15 Sep 2024 | 15 Sep 2024 | 15 Sep 2025 |
| 341 | optout-dnvw.net | Name.com, Inc. | 22 Feb 2013 | 22 Jan 2015 | 22 Feb 2016 |
| 342 | optout-tnlp.net | Name.com, Inc. | 26 Apr 2011 | 1 Apr 2015 | 26 Apr 2016 |
| 343 | optout-flfc.net | Name.com, Inc. | 18 Jan 2013 | 18 Dec 2014 | 18 Jan 2016 |
| 344 | optometristchicago.com | Porkbun, LLC | 6 Feb 2024 | 18 Feb 2025 | 6 Feb 2026 |
| 345 | optometryreviews.com | GoDaddy.com, LLC | 19 Jan 2009 | 19 Jan 2025 | 19 Jan 2026 |
| 346 | optout4u.com | Uniregistrar Corp | - | - | - |
| 347 | optout-nrpf.net | Name.com, Inc. | 6 Jun 2014 | 9 May 2015 | 6 Jun 2016 |
| 348 | optorite.com | GoDaddy.com, LLC | 14 Nov 2001 | 25 Dec 2024 | 14 Nov 2025 |
| 349 | optout-ktbv.net | GoDaddy.com, LLC | 13 Jun 2017 | 13 Jun 2017 | 13 Jun 2018 |
| 350 | optometrysupplies.com | GoDaddy.com, LLC | 3 Nov 2011 | 30 Oct 2024 | 3 Nov 2025 |
| 351 | optout-fppw.net | Name.com, Inc. | 13 May 2014 | 17 Apr 2015 | 13 May 2016 |
| 352 | optout-ptvx.net | Name.com, Inc. | 19 Aug 2014 | 21 Jul 2017 | 19 Aug 2018 |
| 353 | optonine.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Dec 2003 | 29 Nov 2024 | 17 Dec 2025 |
| 354 | optol.com | GoDaddy.com, LLC | 7 Aug 2000 | 8 Aug 2024 | 7 Aug 2025 |
| 355 | optometristdiscount.com | GoDaddy.com, LLC | 10 Aug 2011 | 13 May 2015 | 10 Aug 2015 |
| 356 | optometrists.biz | GoDaddy.com, LLC | 1 May 2017 | 1 Jul 2024 | 30 Apr 2025 |
| 357 | optometristsnc.com | eNom, Inc. | 4 Jan 2013 | 6 Dec 2016 | 4 Jan 2018 |
| 358 | optometristwebsitedesign.com | eNom, Inc. | 6 Sep 2015 | 8 Nov 2016 | 6 Sep 2018 |
| 359 | optout-blbp.net | Name.com, Inc. | 23 Oct 2012 | 23 Sep 2014 | 23 Oct 2015 |
| 360 | optonlline.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jan 2004 | 3 Jan 2025 | 26 Jan 2026 |
| 361 | optoutpresscreen.com | GoDaddy.com, LLC | 6 Oct 2006 | 23 Dec 2024 | 6 Oct 2025 |
| 362 | optout-fcms.net | Name.com, Inc. | 10 Sep 2013 | 9 Aug 2016 | 10 Sep 2017 |
| 363 | optonsexpress.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jun 2007 | 9 May 2017 | 15 Jun 2018 |
| 364 | optoutrescreen.com | Cosmotown, Inc. | 10 Feb 2023 | 8 Aug 2024 | 10 Feb 2026 |
| 365 | optout-rxtb.net | Name.com, Inc. | 9 Jul 2013 | 7 Jun 2017 | 9 Jul 2018 |
| 366 | optooutprescreen.com | GoDaddy.com, LLC | 26 Nov 2005 | 23 Dec 2024 | 26 Nov 2025 |
| 367 | optonloine.net | Media Elite Holdings Limited | 8 Mar 2021 | 21 Nov 2024 | 8 Mar 2025 |
| 368 | optoutpresecreen.com | April Sea Information Technology Corporation | 29 Apr 2005 | 30 Apr 2024 | 29 Apr 2025 |
| 369 | optonlilne.net | Dynadot, LLC | 11 Mar 2020 | 20 Apr 2024 | 11 Mar 2025 |
| 370 | optonlinw.net | Gandi SAS | 18 Nov 2021 | 2 Jan 2024 | 18 Nov 2023 |
| 371 | optonlinee.net | Gandi SAS | 10 Jan 2022 | 26 Mar 2024 | 10 Jan 2024 |
| 372 | optout-pmjc.net | Name.com, Inc. | 10 May 2013 | 17 Apr 2015 | 10 May 2016 |
| 373 | optometrysoftware.com | GoDaddy.com, LLC | 6 May 2002 | 7 May 2024 | 6 May 2025 |
| 374 | optometrysuccessmagazine.com | GoDaddy.com, LLC | 15 Oct 2011 | 1 Oct 2014 | 15 Oct 2015 |
| 375 | optomedical.com | GoDaddy.com, LLC | 19 Apr 2001 | 20 Apr 2024 | 19 Apr 2025 |
| 376 | optout-qzll.net | Name.com, Inc. | 12 Dec 2013 | 10 Nov 2016 | 12 Dec 2017 |
| 377 | optout-srsv.net | Name.com, Inc. | 19 Jul 2012 | 17 Jun 2017 | 19 Jul 2018 |
| 378 | optout-zswc.net | Name.com, Inc. | 22 Mar 2014 | 23 Feb 2015 | 22 Mar 2016 |
| 379 | optoclones.com | GoDaddy.com, LLC | 23 Mar 2015 | 21 May 2015 | 23 Mar 2016 |
| 380 | optometricassistant.com | 1&1 Internet AG | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 381 | optout-qmnc.net | GoDaddy.com, LLC | 7 Dec 2012 | 17 Nov 2024 | 7 Dec 2025 |
| 382 | optout-ntfr.net | Name.com, Inc. | 14 Dec 2011 | 13 Nov 2016 | 14 Dec 2017 |
| 383 | optout.com | GoDaddy.com, LLC | 14 Oct 1996 | 1 Aug 2024 | 13 Oct 2025 |
| 384 | optobionics.info | GoDaddy.com, LLC | 3 Oct 2009 | 1 Oct 2013 | 3 Oct 2015 |
| 385 | optoutweek.com | GoDaddy.com, LLC | 5 Oct 2012 | 1 Jan 2025 | 31 Dec 2025 |
| 386 | optotree.com | NameCheap, Inc. | 7 Mar 2016 | 10 Feb 2025 | 7 Mar 2026 |
| 387 | optometristsalary.org | Dynadot, LLC | 19 Feb 2024 | 15 Aug 2024 | 19 Feb 2025 |
| 388 | optometristsalaries.com | eNom, Inc. | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 389 | optometrist.xyz | West263 International Limited | 29 Mar 2020 | 17 May 2024 | 29 Mar 2026 |
| 390 | optout-rxrj.net | Name.com, Inc. | 17 Oct 2013 | 12 Oct 2024 | 17 Oct 2025 |
| 391 | optout-qkvl.net | Name.com, Inc. | 13 Feb 2013 | 11 Feb 2025 | 13 Feb 2026 |
| 392 | optout-pscw.net | Name.com, Inc. | 3 May 2013 | 27 Apr 2024 | 3 May 2025 |
| 393 | optout-fqtl.net | Name.com, Inc. | 29 Jan 2015 | 2 Jan 2017 | 29 Jan 2018 |
| 394 | optout-wczf.net | Name.com, Inc. | 28 Apr 2015 | 28 Apr 2015 | 28 Apr 2016 |
| 395 | optoutconnect.com | GoDaddy.com, LLC | 26 Feb 2015 | 10 Apr 2015 | 26 Feb 2016 |
| 396 | optout-rvnc.net | Name.com, Inc. | 1 Sep 2010 | 26 Aug 2024 | 1 Sep 2025 |
| 397 | optout-vxqx.net | Name.com, Inc. | 11 Mar 2013 | 13 Feb 2015 | 11 Mar 2016 |
| 398 | optout-jsgz.net | Name.com, Inc. | 2 Dec 2012 | 31 Oct 2016 | 2 Dec 2017 |
| 399 | optout-pfqh.net | Name.com, Inc. | 13 Jun 2013 | 11 Jun 2024 | 13 Jun 2025 |
| 400 | optout-gzmm.net | Name.com, Inc. | 11 Jun 2013 | 6 Jul 2015 | 11 Jun 2016 |
| 401 | optout-dfhv.net | Name.com, Inc. | 26 Apr 2012 | 25 Mar 2017 | 26 Apr 2018 |
| 402 | optout-dmcn.net | Name.com, Inc. | 29 Apr 2015 | 29 Apr 2015 | 29 Apr 2016 |
| 403 | optom.market | Regional Network Information Center, JSC dba RU-CE… | 19 Sep 2023 | 23 Sep 2024 | 19 Sep 2025 |
| 404 | optovik.org | Dynadot, LLC | 15 Nov 2008 | 23 Dec 2016 | 15 Nov 2017 |
| 405 | optometrysolutions.com | GoDaddy.com, LLC | 29 Mar 2016 | 30 Mar 2024 | 29 Mar 2025 |
| 406 | optometrysupport.com | GoDaddy.com, LLC | 29 Jun 2021 | 29 Jun 2021 | 29 Jun 2022 |
| 407 | optometristphoenixaz.com | Wild West Domains, LLC | 3 Nov 2014 | 4 Nov 2024 | 3 Nov 2026 |
| 408 | optoutmontana.net | GoDaddy.com, LLC | 6 Jun 2014 | 7 Jun 2015 | 6 Jun 2016 |
| 409 | optoimum.com | eName Technology Co., Ltd. | 21 Jun 2022 | 2 Aug 2023 | 21 Jun 2023 |
| 410 | optout-hqxg.net | West263 International Limited | 29 Sep 2021 | 29 Sep 2021 | 29 Sep 2022 |
| 411 | optout-jjjl.net | Name.com, Inc. | 21 Jun 2013 | 23 May 2017 | 21 Jun 2018 |
| 412 | optout-kpwp.net | CommuniGal Communication Ltd. | 18 Jun 2024 | 19 Jun 2024 | 18 Jun 2025 |
| 413 | optout-krdw.net | Name.com, Inc. | 1 May 2012 | 31 Mar 2017 | 1 May 2018 |
| 414 | optout-ltbl.net | Name.com, Inc. | 9 Apr 2014 | 3 Apr 2024 | 9 Apr 2025 |
| 415 | optout-qhwb.net | Dynadot, LLC | 31 Aug 2015 | 4 Oct 2016 | 31 Aug 2017 |
| 416 | optout-qsjp.net | Name.com, Inc. | 25 Jan 2013 | 22 Jan 2025 | 25 Jan 2026 |
| 417 | optout-vdqg.net | Name.com, Inc. | 5 Mar 2015 | 6 Mar 2019 | 5 Mar 2019 |
| 418 | optout-xmzn.net | Name.com, Inc. | 19 Feb 2014 | 20 Jan 2017 | 19 Feb 2018 |
| 419 | optoutmontana.com | GoDaddy.com, LLC | 6 Jun 2014 | 7 Jun 2015 | 6 Jun 2016 |
| 420 | optoelectronics.com | Network Solutions, LLC | 24 Nov 1995 | 24 Sep 2024 | 23 Nov 2025 |
| 421 | optout-dzhs.net | Name.com, Inc. | 27 Apr 2013 | 27 Mar 2017 | 27 Apr 2018 |
| 422 | optout-csqf.net | Name.com, Inc. | 13 May 2014 | 11 Apr 2017 | 13 May 2018 |
| 423 | optout-ggnh.net | Name.com, Inc. | 9 May 2014 | 2 May 2024 | 9 May 2025 |
| 424 | optogenics.com | CSC Corporate Domains, Inc. | 12 Mar 1999 | 16 Jul 2023 | 20 Jul 2025 |
| 425 | optogenics.net | CSC Corporate Domains, Inc. | 29 Jun 2010 | 25 Jun 2023 | 29 Jun 2025 |
| 426 | optout-mctd.net | Name.com, Inc. | 4 Aug 2010 | 4 Jul 2015 | 4 Aug 2016 |
| 427 | optotronics.com | GoDaddy.com, LLC | 7 May 2005 | 7 May 2024 | 7 May 2025 |
| 428 | optometristattic.com | FastDomain Inc. | 21 Aug 2006 | 18 May 2023 | 21 Aug 2029 |
| 429 | optometry.org | Network Solutions, LLC | 7 May 1994 | 14 Mar 2024 | 8 May 2029 |
| 430 | optout-gmrv.net | Name.com, Inc. | 12 Jul 2013 | 14 Jul 2017 | 12 Jul 2017 |
| 431 | optokol.info | GoDaddy.com, LLC | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 432 | optokol.com | GoDaddy.com, LLC | 11 Jun 2014 | 12 Jun 2015 | 11 Jun 2016 |
| 433 | optout-djxn.net | Name.com, Inc. | 4 Feb 2014 | 6 Jan 2017 | 4 Feb 2018 |
| 434 | optovue.com | Network Solutions, LLC | 22 Jun 2004 | 24 Jun 2024 | 22 Jun 2025 |
| 435 | optout-zcmh.net | Name.com, Inc. | 2 Dec 2014 | 31 Oct 2016 | 2 Dec 2017 |
| 436 | optosigma.com | Network Solutions, LLC | 16 Jan 1996 | 19 Jan 2023 | 17 Jan 2032 |
| 437 | optout-xzhv.net | Name.com, Inc. | 15 Aug 2014 | 14 Jul 2017 | 15 Aug 2018 |
| 438 | optout-ssrf.net | Name.com, Inc. | 4 Feb 2014 | 6 Jan 2017 | 4 Feb 2018 |
| 439 | optout-pfcb.net | Name.com, Inc. | 7 Mar 2013 | 29 Feb 2024 | 7 Mar 2025 |
| 440 | optovueacademy.com | GoDaddy.com, LLC | 3 Nov 2014 | 16 Dec 2024 | 3 Nov 2025 |
| 441 | optomtm.com | Regional Network Information Center, JSC dba RU-CE… | 15 Oct 2014 | 3 Nov 2014 | 15 Oct 2015 |
| 442 | optometrist-sanjose.com | Wild West Domains, LLC | 3 Nov 2014 | 4 Nov 2016 | 3 Nov 2017 |
| 443 | optomestrist63122.com | Name.com, Inc. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 444 | optout-qnpp.net | Name.com, Inc. | 9 Jan 2014 | 18 Dec 2014 | 9 Jan 2016 |
| 445 | optout-brxb.net | Name.com, Inc. | 21 Apr 2013 | 21 Mar 2017 | 21 Apr 2018 |
| 446 | optout-szmh.net | GoDaddy.com, LLC | 11 Jul 2012 | 21 Jun 2024 | 11 Jul 2025 |
| 447 | optout-jrbk.net | Name.com, Inc. | 19 Mar 2014 | 23 Feb 2015 | 19 Mar 2016 |
| 448 | optout-rccf.net | Name.com, Inc. | 1 Jan 2014 | 2 Dec 2016 | 1 Jan 2018 |
| 449 | optonline.com | GoDaddy.com, LLC | 7 Oct 1996 | 6 Oct 2024 | 6 Oct 2025 |
| 450 | optout-vtlz.net | Name.com, Inc. | 11 Jan 2013 | 18 Dec 2014 | 11 Jan 2016 |
| 451 | optoscience.com | Japan Registry Services Co., Ltd. | 30 Oct 1998 | 24 Oct 2024 | 29 Oct 2025 |
| 452 | optout-llsm.net | Name.com, Inc. | 31 May 2013 | 26 May 2024 | 31 May 2025 |
| 453 | optout2012.com | GoDaddy.com, LLC | 15 Nov 2011 | 16 Nov 2024 | 15 Nov 2026 |
| 454 | optometryscareercenter.org | Network Solutions, LLC | 1 Apr 2003 | 5 Feb 2025 | 1 Apr 2030 |
| 455 | optout-rzfs.net | Name.com, Inc. | 9 Jan 2013 | 8 Dec 2016 | 9 Jan 2018 |
| 456 | optonexpress.com | GoDaddy.com, LLC | 7 Apr 2014 | 27 Apr 2015 | 7 Apr 2016 |
| 457 | optout-cszl.net | Name.com, Inc. | 8 Dec 2011 | 10 Nov 2014 | 8 Dec 2015 |
| 458 | optout-sdtp.net | DNSPod, Inc. | 18 Jun 2021 | 19 Jun 2021 | 18 Jun 2022 |
| 459 | optoutexpert.com | GoDaddy.com, LLC | 18 Oct 2011 | 19 Oct 2023 | 18 Oct 2025 |
| 460 | optout-pgld.net | - | 12 Oct 2016 | 12 Oct 2016 | 12 Oct 2017 |
| 461 | optoutiowa.com | GoDaddy.com, LLC | 25 Sep 2014 | 21 Apr 2015 | 25 Sep 2015 |
| 462 | optout-pkwg.net | Name.com, Inc. | 3 May 2013 | 1 Apr 2017 | 3 May 2018 |
| 463 | optometrydallas.com | NameCheap, Inc. | 12 Sep 2014 | 12 Aug 2024 | 12 Sep 2025 |
| 464 | optout-crhc.net | Name.com, Inc. | 4 Aug 2010 | 7 Jul 2017 | 4 Aug 2018 |
| 465 | optout-pzpl.net | Name.com, Inc. | 14 Mar 2014 | 10 Feb 2017 | 14 Mar 2018 |
| 466 | optout-remove.com | Beijing Lanhai Jiye Technology Co., Ltd | 9 Oct 2021 | 10 Oct 2023 | 9 Oct 2024 |
| 467 | optometristsabbotsford.com | Tucows Domains Inc. | 1 Nov 2010 | 5 Nov 2014 | 1 Nov 2015 |
| 468 | optometristerivesud.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2024 | 4 Nov 2025 |
| 469 | optometristelongueuil.com | GoDaddy.com, LLC | 4 Nov 2014 | 5 Nov 2024 | 4 Nov 2025 |
| 470 | optometristabbotsford.com | Tucows Domains Inc. | 1 Nov 2010 | 5 Nov 2014 | 1 Nov 2015 |
| 471 | optometrytimes.com | CSC Corporate Domains, Inc. | 13 Jul 2004 | 9 Jul 2024 | 13 Jul 2025 |
| 472 | optout-bhkd.net | Name.com, Inc. | 5 Sep 2014 | 5 Aug 2016 | 5 Sep 2017 |
| 473 | optometrist-advice.com | NameCheap, Inc. | 28 Sep 2022 | 30 Aug 2024 | 28 Sep 2025 |
| 474 | optout-fnft.net | Name.com, Inc. | 21 Apr 2014 | 20 Mar 2015 | 21 Apr 2016 |
| 475 | optometricglaucomasociety.org | GoDaddy.com, LLC | 26 Feb 2003 | 1 Aug 2024 | 26 Feb 2025 |
| 476 | optout-zfzt.net | Name.com, Inc. | 10 Jun 2014 | 9 May 2015 | 10 Jun 2016 |
| 477 | optoutidaho.org | NameSecure L.L.C. | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2016 |
| 478 | optogone.com | eNom, Inc. | 4 Feb 2018 | 13 Feb 2025 | 4 Feb 2026 |
| 479 | opto-norming.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Nov 2023 | 1 Dec 2024 | 30 Nov 2025 |
| 480 | opto-word.com | GoDaddy.com, LLC | 13 Jun 2014 | 14 Jun 2015 | 13 Jun 2016 |
| 481 | optoviki.com | Whiteglove Domains, Incorporated | 5 Feb 2025 | 6 Feb 2025 | 5 Feb 2026 |
| 482 | optonnet.com | GoDaddy.com, LLC | 16 Jun 2014 | 16 Jun 2015 | 16 Jun 2016 |
| 483 | optoutprescrenn.com | GoDaddy.com, LLC | 11 Dec 2024 | 11 Dec 2024 | 11 Dec 2025 |
| 484 | optotalent.com | Gandi SAS | 5 Nov 2014 | 5 Oct 2024 | 5 Nov 2025 |
| 485 | opto-ring.com | Metaregistrar BV Applications | 20 Oct 2014 | 22 Oct 2024 | 20 Oct 2025 |
| 486 | optogenetics-equipment.com | PSI-USA, Inc. dba Domain Robot | 18 Aug 2014 | 7 Oct 2024 | 18 Aug 2025 |
| 487 | optometrist-israel.com | GoDaddy.com, LLC | 18 Aug 2014 | 31 Jul 2016 | 18 Aug 2017 |
| 488 | optout-nbqn.net | Name.com, Inc. | 19 Aug 2014 | 19 Aug 2014 | 19 Aug 2015 |
| 489 | optometristvirginiabeach.com | DROPCATCH.COM 826 LLC | 31 Oct 2018 | 31 Oct 2018 | 31 Oct 2019 |
| 490 | optometry-orange-county.com | GoDaddy.com, LLC | 19 Jun 2012 | 20 Jun 2015 | 19 Jun 2016 |
| 491 | optogram.biz | GoDaddy.com, LLC | 1 May 2014 | 1 May 2015 | 30 Apr 2016 |
| 492 | optogram.info | GoDaddy.com, LLC | 20 Feb 2020 | 3 Apr 2023 | 20 Feb 2023 |
| 493 | optogram.net | GoDaddy.com, LLC | 1 May 2014 | 2 May 2015 | 1 May 2016 |
| 494 | optogram.org | GoDaddy.com, LLC | 1 May 2014 | 2 May 2015 | 1 May 2016 |
| 495 | optometristssacramento.com | GoDaddy.com, LLC | 19 Jun 2011 | 20 Jun 2015 | 19 Jun 2016 |
| 496 | optometristirvine.com | Dynadot10 LLC | 18 Feb 2015 | 4 Mar 2015 | 18 Feb 2016 |
| 497 | optodessa.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 18 Oct 2016 | 4 Nov 2017 |
| 498 | optodessa.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Nov 2014 | 18 Oct 2016 | 4 Nov 2017 |
| 499 | optoideas.com | Beijing Lanhai Jiye Technology Co., Ltd | 25 Apr 2022 | 26 Apr 2024 | 25 Apr 2025 |
| 500 | optometristbook.com | GoDaddy.com, LLC | 25 Jun 2015 | 25 Jun 2015 | 25 Jun 2016 |
| 501 | optour1.com | Jiangsu Bangning Science and technology Co. Ltd. | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 502 | optovarta.com | - | - | - | - |
| 503 | optometristnh.com | GoDaddy.com, LLC | 20 Dec 2022 | 2 Mar 2024 | 20 Dec 2023 |
| 504 | optometryhutto.com | eNom, Inc. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 505 | optoprog.com | Tucows Domains Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 506 | optometriststudiocity.com | eNom, Inc. | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 507 | optomdom.com | Network Solutions, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 508 | optouve.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Sep 2016 | 8 Nov 2017 | 27 Sep 2017 |
| 509 | optowner.org | GoDaddy.com, LLC | 12 Jan 2015 | 16 Dec 2015 | 12 Jan 2018 |
| 510 | optout-lvch.net | Name.com, Inc. | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 511 | optotalent.net | Gandi SAS | 5 Nov 2014 | 5 Oct 2024 | 5 Nov 2025 |
| 512 | optogans.com | Tucows Domains Inc. | 3 Feb 2014 | 7 Feb 2015 | 3 Feb 2016 |
| 513 | optometriexl.com | Hosting Concepts B.V. dba Openprovider | 6 Feb 2015 | 6 Feb 2025 | 6 Feb 2026 |
| 514 | optomvideo.com | GoDaddy.com, LLC | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2017 |
| 515 | optoview.com | Key-Systems GmbH | 6 Feb 2015 | 22 Jan 2025 | 6 Feb 2026 |
| 516 | optomation.biz | 1&1 Internet AG | 7 Nov 2014 | 22 Dec 2019 | 6 Nov 2020 |
| 517 | optoinspectionsystems.net | Domainshype.com, Inc. | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 518 | optoutappend.com | Domain.com, LLC | 29 Feb 2000 | 14 Feb 2017 | 1 Mar 2018 |
| 519 | optoutaz.com | Namesilo, LLC | 12 Aug 2021 | 15 Sep 2024 | 12 Aug 2024 |
| 520 | optoutaz.net | - | - | - | - |
| 521 | optoutaz.org | - | 15 Jun 2024 | 20 Jun 2024 | 15 Jun 2025 |
| 522 | optoutchange.com | Domain.com, LLC | 29 Feb 2000 | 14 Feb 2017 | 1 Mar 2018 |
| 523 | optoutdatabase.com | - | 25 May 2024 | 4 Jun 2024 | 25 May 2025 |
| 524 | optoutlink.com | NameSourceDomains, LLC | 18 May 2024 | 21 May 2024 | 18 May 2025 |
| 525 | optometristwestjeffersonoh.com | Tucows Domains Inc. | 4 Nov 2010 | 8 Nov 2014 | 4 Nov 2015 |
| 526 | optometristsnow.com | GoDaddy.com, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 527 | optognostics.com | Cronon AG | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2018 |
| 528 | optout-tnwf.net | Name.com, Inc. | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 529 | optout-zzrf.net | Name.com, Inc. | 22 Aug 2014 | 21 Jul 2017 | 22 Aug 2018 |
| 530 | optoutaprrm.org | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2015 |
| 531 | optoutofoptimum.com | Brandsight, Inc. | 22 Aug 2014 | 23 Jul 2024 | 22 Aug 2025 |
| 532 | optoutofoptimum.net | Brandsight, Inc. | 22 Aug 2014 | 23 Jul 2024 | 22 Aug 2025 |
| 533 | optouttexas.org | NameCheap, Inc. | 14 Apr 2015 | 26 May 2024 | 14 Apr 2024 |
| 534 | optout-plvj.net | Name.com, Inc. | 24 Jun 2015 | 18 Jun 2024 | 24 Jun 2025 |
| 535 | optojoy.com | Gabia, Inc. | 21 Oct 2015 | 4 Oct 2024 | 21 Oct 2025 |
| 536 | optoprog.net | Tucows Domains Inc. | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 537 | optocvet.com | Regional Network Information Center, JSC dba RU-CE… | 29 Mar 2021 | 2 Jun 2023 | 29 Mar 2023 |
| 538 | optometryrecruitment.com | GoDaddy.com, LLC | 13 Aug 2014 | 13 Aug 2024 | 13 Aug 2025 |
| 539 | optometryrecruitment.net | GoDaddy.com, LLC | 13 Aug 2014 | 20 Aug 2015 | 13 Aug 2017 |
| 540 | optout-gbmc.net | Name.com, Inc. | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 541 | optolis.com | Wild West Domains, LLC | 25 Aug 2014 | 25 Aug 2024 | 25 Aug 2025 |
| 542 | optometraspr.com | GoDaddy.com, LLC | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2017 |
| 543 | optomhealth.com | TurnCommerce, Inc. DBA NameBright.com | 2 Jan 2023 | 12 Feb 2025 | 2 Jan 2025 |
| 544 | optondeals.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 545 | optoutmt.com | GoDaddy.com, LLC | 24 Aug 2014 | 25 Aug 2024 | 24 Aug 2025 |
| 546 | optomation.info | 1&1 Internet AG | 7 Nov 2014 | 7 Nov 2019 | 7 Nov 2020 |
| 547 | optometrie-aof.org | GMO Internet Inc. | 17 Sep 2016 | 28 Oct 2017 | 17 Sep 2018 |
| 548 | optometristsbrisbane.com | 1API GmbH | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 549 | optometryoffice.com | Annulet LLC | 31 Oct 2016 | 18 Dec 2024 | 31 Oct 2025 |
| 550 | optonicaleditalia.com | Tucows Domains Inc. | 13 Aug 2014 | 17 Aug 2017 | 13 Aug 2017 |
| 551 | optofluidics2015.org | Web Commerce Communications Limited dba WebNic.cc | 25 Aug 2014 | 4 Aug 2015 | 25 Aug 2022 |
| 552 | optogent.com | LCN.COM Ltd. | 25 Aug 2014 | 30 May 2017 | 25 Aug 2018 |
| 553 | optometryct.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jun 2016 | 12 Jun 2024 | 15 Jun 2025 |
| 554 | optonet.com | Dynadot, LLC | 14 Aug 2000 | 20 Nov 2024 | 14 Aug 2026 |
| 555 | optonine-chip.us | Wild West Domains, LLC | 25 Aug 2014 | 25 Aug 2014 | 24 Aug 2015 |
| 556 | optomechatronics.org | Online SAS | 8 Nov 2014 | 1 Jun 2022 | 8 Nov 2025 |
| 557 | optorgbaza.com | 1&1 Internet AG | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 558 | optout-lxpl.net | Name.com, Inc. | 15 Aug 2014 | 14 Jul 2017 | 15 Aug 2018 |
| 559 | optogirl.com | GoDaddy.com, LLC | 28 Aug 2014 | 9 Aug 2016 | 28 Aug 2017 |
| 560 | optometristcary.com | GoDaddy.com, LLC | 27 Aug 2014 | 28 Aug 2015 | 27 Aug 2017 |
| 561 | optometristpetoskey.com | GoDaddy.com, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 562 | optomnoski.com | TurnCommerce, Inc. DBA NameBright.com | 6 Nov 2021 | 18 Jan 2024 | 6 Nov 2023 |
| 563 | optopn.com | GoDaddy.com, LLC | 27 Aug 2014 | 16 Sep 2022 | 27 Aug 2025 |
| 564 | optoxun.com | GoDaddy.com, LLC | 6 Feb 2016 | 6 Feb 2016 | 6 Feb 2017 |
| 565 | optovayaprodaja.com | FBS Inc. | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 566 | optonox.com | Google, Inc. | 27 Mar 2022 | 26 Apr 2024 | 27 Mar 2025 |
| 567 | optometrui.com | Moniker Online Services LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 568 | optonlineug.com | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 569 | optonlineug.net | GoDaddy.com, LLC | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 570 | optout-npnm.net | Name.com, Inc. | 27 Aug 2014 | 26 Jul 2017 | 27 Aug 2018 |
| 571 | optom-stroy.com | Register NV dba Register.eu | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 572 | optom-stroy.net | Register NV dba Register.eu | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 573 | optoutwesterville.com | register.com, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 574 | optoutcentral.com | GoDaddy.com, LLC | 11 Nov 2014 | 12 Nov 2023 | 11 Nov 2025 |
| 575 | optometriasab.com | Dynadot6 LLC | 29 Jan 2021 | 30 Jan 2021 | 29 Jan 2022 |
| 576 | optomart.com | GoDaddy.com, LLC | 13 May 2016 | 26 Sep 2024 | 13 May 2025 |
| 577 | optout-xzjs.net | Name.com, Inc. | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 578 | optout-wfgl.net | Name.com, Inc. | 11 Nov 2014 | 10 Oct 2017 | 11 Nov 2018 |
| 579 | optout-dvkr.net | Name.com, Inc. | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 580 | optomoda.org | Internet Invest, Ltd. dba Imena.ua | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 581 | opto-trace.net | Wild West Domains, LLC | 11 Sep 2014 | 12 Sep 2024 | 11 Sep 2025 |
| 582 | opto-trace.org | Wild West Domains, LLC | 11 Sep 2014 | 26 Oct 2024 | 11 Sep 2025 |
| 583 | optofilm.com | Hangzhou AiMing Network Co., LTD | 11 Sep 2014 | 11 Apr 2024 | 11 Sep 2025 |
| 584 | optometre.com | Tucows Domains Inc. | 13 Dec 2016 | 13 Dec 2016 | 13 Dec 2017 |
| 585 | optometristsniagara.com | Domain.com, LLC | 11 Sep 2014 | 6 Mar 2016 | 11 Sep 2019 |
| 586 | optout4cash.com | TLD Registrar Solutions Ltd. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 587 | optogenetix.com | GoDaddy.com, LLC | 30 Jan 2016 | 31 Jan 2025 | 30 Jan 2026 |
| 588 | optolux.com | Megazone Corp., dba HOSTING.KR | 2 Aug 2008 | 21 Aug 2024 | 2 Aug 2025 |
| 589 | optometristhendersonnv.com | eNom, Inc. | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 590 | optometrycourses.info | GMO Internet Inc. | 14 Nov 2014 | - | 14 Nov 2015 |
| 591 | optochem.com | Inames Co. Ltd. | 9 Aug 2011 | 20 Aug 2024 | 9 Aug 2025 |
| 592 | optoneday.com | eNom, Inc. | 13 Sep 2014 | 13 Sep 2014 | 13 Sep 2015 |
| 593 | optoutdirectory.com | Tucows Domains Inc. | 10 Sep 2004 | 14 Sep 2018 | 10 Sep 2018 |
| 594 | optoconf.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 595 | optogeneticstherapy.com | Moniker Online Services LLC | 31 Aug 2014 | 29 Aug 2024 | 31 Aug 2025 |
| 596 | optout-wxcz.net | Name.com, Inc. | 31 Aug 2014 | 31 Aug 2014 | 31 Aug 2015 |
| 597 | optometrierotterdam.com | Tucows Domains Inc. | 7 Oct 2014 | 8 Sep 2024 | 7 Oct 2025 |
| 598 | optometriecentrumrotterdam.com | Tucows Domains Inc. | 7 Oct 2014 | 8 Sep 2024 | 7 Oct 2025 |
| 599 | optoglo.com | GoDaddy.com, LLC | 14 Nov 2014 | 1 May 2024 | 14 Nov 2027 |
| 600 | optomtorg.info | Limited Liability Company "Registrar of domain nam… | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 601 | opto-gold.com | BigRock Solutions Ltd. | 1 Sep 2014 | 1 Sep 2016 | 1 Sep 2017 |
| 602 | optofi.com | NameCheap, Inc. | 1 Sep 2014 | 2 Aug 2024 | 1 Sep 2025 |
| 603 | optogostore.com | GoDaddy.com, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 604 | optoil.com | TurnCommerce, Inc. DBA NameBright.com | 20 Nov 2019 | 14 Nov 2020 | 20 Nov 2025 |
| 605 | optovantage.com | Google, Inc. | 16 Sep 2014 | 2 Sep 2024 | 16 Sep 2025 |
| 606 | optometrik.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Sep 2014 | 10 Sep 2024 | 16 Sep 2025 |
| 607 | optometristhydepark.com | eNom, Inc. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 608 | optoteh.com | Register NV dba Register.eu | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 609 | optometricalliance.com | 1API GmbH | 4 Dec 2020 | 4 Dec 2020 | 4 Dec 2021 |
| 610 | optometristalliance.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2017 |
| 611 | optometryalliance.com | GoDaddy.com, LLC | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2017 |
| 612 | optomzakaz.com | - | 4 Jan 2023 | 7 Mar 2024 | 4 Jan 2024 |
| 613 | optomtekstil.com | GoDaddy.com, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 614 | optonom.com | Namesilo, LLC | 1 Dec 2016 | 1 Dec 2024 | 1 Dec 2025 |
| 615 | optout-vkbh.net | Name.com, Inc. | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2015 |
| 616 | optomaticandchromatograph.com | Tucows Domains Inc. | 31 Aug 2005 | 4 Sep 2014 | 31 Aug 2015 |
| 617 | optomsumki.com | Limited Liability Company "Registrar of domain nam… | 8 Jan 2018 | 13 Jan 2024 | 8 Jan 2025 |
| 618 | optoutbkclt.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 619 | optomtime.com | Network Solutions, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 620 | optomisticod.com | GoDaddy.com, LLC | 17 Sep 2014 | 18 Sep 2016 | 17 Sep 2017 |
| 621 | optovichkof.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Sep 2014 | 12 Sep 2024 | 17 Sep 2025 |
| 622 | optobuv.com | Internet Invest, Ltd. dba Imena.ua | 15 Dec 2015 | 5 Jul 2017 | 15 Dec 2017 |
| 623 | optometryfinder.com | GoDaddy.com, LLC | 25 Oct 2019 | 25 Oct 2019 | 25 Oct 2020 |
| 624 | optometrymarket.com | Namecatch Zone LLC | 5 Dec 2017 | 6 Dec 2017 | 5 Dec 2018 |
| 625 | optovichkoff.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Sep 2014 | 12 Sep 2024 | 17 Sep 2025 |
| 626 | optovolokno-spb.com | Network Solutions, LLC | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2015 |
| 627 | optodps.com | Tucows Domains Inc. | 1 Sep 2011 | 5 Sep 2014 | 1 Sep 2015 |
| 628 | optomeyeinstitute.com | OnlineNIC, Inc. | 27 Mar 2018 | 27 Mar 2018 | 27 Mar 2019 |
| 629 | optosupplyhk.com | eNom, Inc. | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 630 | optout-dhqh.net | Name.com, Inc. | 4 Sep 2014 | 5 Aug 2016 | 4 Sep 2017 |
| 631 | optovellem.biz | Key-Systems GmbH | 4 Sep 2014 | 4 Sep 2014 | 3 Sep 2015 |
| 632 | optovellem.com | Key-Systems GmbH | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 633 | optovellem.net | Key-Systems GmbH | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 634 | optovellem.org | Key-Systems GmbH | 4 Sep 2014 | 4 Sep 2014 | 4 Sep 2015 |
| 635 | optometricvisiontherapy.com | GoDaddy.com, LLC | 18 Sep 2014 | 19 Sep 2024 | 18 Sep 2025 |
| 636 | optomgroup.com | Wix.com Ltd. | 8 Sep 2020 | 12 Sep 2022 | 8 Sep 2022 |
| 637 | optopcom.com | eNom, Inc. | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 638 | optomtrade.com | Hosting Concepts B.V. dba Openprovider | 15 Aug 2021 | 15 Aug 2021 | 15 Aug 2022 |
| 639 | optomas.com | OPENNAME LLC | 4 Dec 2015 | 5 Dec 2016 | 4 Dec 2017 |
| 640 | optometrist22030.com | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2016 |
| 641 | optout-hdvm.net | Name.com, Inc. | 5 Sep 2014 | 5 Aug 2017 | 5 Sep 2018 |
| 642 | optout-pxww.net | Name.com, Inc. | 5 Sep 2014 | 5 Sep 2014 | 5 Sep 2015 |
| 643 | optotrafficli.com | WorthyDomains LLC | 7 Dec 2018 | 7 Dec 2018 | 7 Dec 2019 |
| 644 | optonova.info | 1&1 Internet AG | 19 Sep 2014 | - | 19 Sep 2015 |
| 645 | optonova.net | 1&1 Internet AG | 19 Sep 2014 | 19 Sep 2014 | 19 Sep 2015 |
| 646 | optotrafficli.info | GoDaddy.com, LLC | 19 Sep 2014 | 8 Oct 2017 | 19 Sep 2018 |
| 647 | optotrafficny.info | GoDaddy.com, LLC | 19 Sep 2014 | 8 Oct 2017 | 19 Sep 2018 |
| 648 | optomoskva.com | Tucows Domains Inc. | 17 Nov 2014 | 21 Nov 2017 | 17 Nov 2017 |
| 649 | optominsk.com | Hongkong Domain Name Information Management Co., L… | 3 Jul 2021 | 3 Jul 2021 | 3 Jul 2022 |
| 650 | optometrypracticebroker.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2024 | 18 Nov 2025 |
| 651 | optotrafficli.net | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2016 | 19 Sep 2017 |
| 652 | optotrafficny.com | DropCatch.com 1270 LLC | 7 Dec 2018 | 7 Dec 2018 | 7 Dec 2019 |
| 653 | optotrafficny.net | GoDaddy.com, LLC | 19 Sep 2014 | 20 Sep 2016 | 19 Sep 2017 |
| 654 | optotrafficli.org | GoDaddy.com, LLC | 19 Sep 2014 | 8 Oct 2017 | 19 Sep 2018 |
| 655 | optonova.org | 1&1 Internet AG | 19 Sep 2014 | - | 19 Sep 2015 |
| 656 | optotrafficny.org | GoDaddy.com, LLC | 19 Sep 2014 | 8 Oct 2017 | 19 Sep 2018 |
| 657 | optom-pampers.com | GoDaddy.com, LLC | 20 Sep 2014 | 20 Sep 2014 | 20 Sep 2015 |
| 658 | optos.info | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 30 Dec 2024 | 30 Dec 2024 | 30 Dec 2025 |
| 659 | optodegka.com | eNom, Inc. | 30 Nov 2016 | 12 Jan 2018 | 30 Nov 2017 |
| 660 | optogenetica.com | 1&1 Internet AG | 8 Sep 2014 | 8 Sep 2016 | 8 Sep 2025 |
| 661 | optontrade.com | GoDaddy.com, LLC | 12 Apr 2016 | 12 Apr 2016 | 12 Apr 2017 |
| 662 | optomclub.com | Google, Inc. | 17 Nov 2019 | 2 Nov 2024 | 17 Nov 2025 |
| 663 | optometras.com | NameKing.com Inc. | 16 Oct 2009 | 14 Nov 2024 | 16 Oct 2025 |
| 664 | optoutofchesapeakesettlement.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 665 | optocart.com | Namesilo, LLC | 18 May 2017 | 3 May 2024 | 18 May 2025 |
| 666 | optosurfer.com | - | 21 Dec 2022 | 22 Jan 2024 | 21 Dec 2023 |
| 667 | optometristtraining.com | eNom, Inc. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 668 | optomiz.com | NameCheap, Inc. | 17 Feb 2025 | 17 Feb 2025 | 17 Feb 2026 |
| 669 | optob.net | Network Solutions, LLC | 26 Mar 2014 | 2 Oct 2014 | 26 Mar 2015 |
| 670 | optob.org | Network Solutions, LLC | 26 Mar 2014 | 2 Oct 2014 | 26 Mar 2015 |
| 671 | optout-llnd.net | Name.com, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 672 | optomach.com | Xin Net Technology Corporation | 14 Aug 2021 | 4 Sep 2021 | 14 Aug 2022 |
| 673 | optolumen.com | united-domains AG | 24 Sep 2017 | 24 Sep 2017 | 24 Sep 2018 |
| 674 | optofy.com | NameCheap, Inc. | 10 Sep 2014 | 11 Aug 2024 | 10 Sep 2025 |
| 675 | optokinesys.com | GoDaddy.com, LLC | 10 Sep 2014 | 11 Sep 2016 | 10 Sep 2017 |
| 676 | optometristleesburg.com | DNC Holdings, Inc. | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2019 |
| 677 | optock.info | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 678 | optokinesys.info | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 679 | optokinesys.net | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 680 | optokinesys.org | GoDaddy.com, LLC | 10 Sep 2014 | 10 Sep 2014 | 10 Sep 2015 |
| 681 | optonlineline.net | One.com A/S | 8 Mar 2024 | 24 Apr 2024 | 8 Mar 2025 |
| 682 | optoutofchesapeakepennsylvaniasettlement.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 683 | optoutofdemchakchesapeakesettlement.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 684 | optocrypt.com | GoDaddy.com, LLC | 30 Apr 2021 | 1 May 2023 | 30 Apr 2025 |
| 685 | optom-moda.com | Internet Invest, Ltd. dba Imena.ua | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 686 | optoshred.com | Wild West Domains, LLC | 1 Oct 2014 | 2 Oct 2016 | 1 Oct 2017 |
| 687 | optoutofchesapeakepennsylvaniaclassactionsettlement.com | GoDaddy.com, LLC | 1 Oct 2014 | 1 Oct 2014 | 1 Oct 2015 |
| 688 | optoinbuddy.com | GoDaddy.com, LLC | 19 Nov 2014 | 19 Nov 2014 | 19 Nov 2015 |
| 689 | optogatesolutions.com | Network Solutions, LLC | 19 Nov 2014 | 19 Nov 2023 | 19 Nov 2033 |
| 690 | optout-ffsr.net | Name.com, Inc. | 1 Oct 2014 | 31 Aug 2017 | 1 Oct 2018 |
| 691 | optoutanalytics.org | GoDaddy.com, LLC | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 692 | optoutanalytics.com | GoDaddy.com, LLC | 21 Sep 2014 | 21 Sep 2014 | 21 Sep 2015 |
| 693 | optotec.us | Tucows Domains Inc. | 18 Nov 2014 | 13 Nov 2024 | 17 Nov 2025 |
| 694 | optometricaldoctor.com | Tucows Domains Inc. | 29 Sep 2012 | 3 Oct 2015 | 29 Sep 2016 |
| 695 | optometrie.biz | Cronon AG | 2 Oct 2014 | 16 Nov 2024 | 1 Oct 2025 |
| 696 | optoviki.info | Regional Network Information Center, JSC dba RU-CE… | 5 Dec 2012 | 19 Nov 2014 | 5 Dec 2014 |
| 697 | optocourse.com | GoDaddy.com, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 698 | optoutofyelp.info | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2016 |
| 699 | optomvozim.com | Register NV dba Register.eu | 22 Sep 2014 | 23 Sep 2014 | 22 Sep 2015 |
| 700 | optoutofyelp.com | DropCatch.com 961 LLC | 10 Dec 2016 | 11 Dec 2016 | 10 Dec 2017 |
| 701 | optov.net | Limited Liability Company "Registrar of domain nam… | 20 Jul 2020 | 6 Jun 2024 | 20 Jul 2025 |
| 702 | optom-vozim.com | Register NV dba Register.eu | 22 Sep 2014 | 23 Sep 2014 | 22 Sep 2015 |
| 703 | optoutofyelp.net | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2016 |
| 704 | optometryvancouver.com | eNom, Inc. | 1 Aug 2015 | 28 Jul 2024 | 1 Aug 2025 |
| 705 | optout-wqwc.net | Name.com, Inc. | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 706 | optometryconcierge.com | NameCheap, Inc. | 7 Sep 2020 | 8 Aug 2024 | 7 Sep 2025 |
| 707 | optometristconcierge.com | GoDaddy.com, LLC | 21 Nov 2014 | 21 Nov 2016 | 21 Nov 2017 |
| 708 | optoutofyelp.org | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2016 |
| 709 | optomahometheater.com | GoDaddy.com, LLC | 8 Jul 2019 | 8 Jul 2019 | 8 Jul 2020 |
| 710 | optometristrichmondhill.com | GoDaddy.com, LLC | 6 Oct 2014 | 17 Jul 2016 | 6 Oct 2017 |
| 711 | optout-vdvf.net | Name.com, Inc. | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 712 | optoutside.com | GoDaddy.com, LLC | 28 Dec 2016 | 29 Dec 2024 | 28 Dec 2025 |
| 713 | optometriaclinica.com | GoDaddy.com, LLC | 8 Feb 2021 | 9 Feb 2025 | 8 Feb 2026 |
| 714 | optosky.com | HiChina Zhicheng Technology Limited | 7 Oct 2014 | 1 Jul 2023 | 7 Oct 2030 |
| 715 | optosoins.com | Gandi SAS | 7 Oct 2014 | 25 Jan 2018 | 7 Oct 2018 |
| 716 | optout-nlrm.net | Name.com, Inc. | 8 Oct 2014 | 6 Sep 2016 | 8 Oct 2017 |
| 717 | optometristmcleanva.com | Name.com, Inc. | 21 Nov 2014 | 23 Oct 2016 | 21 Nov 2017 |
| 718 | optoisolateselfflatterergz.com | eNom, Inc. | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 719 | optostyle.com | GoDaddy.com, LLC | 11 Apr 2018 | 26 Jul 2024 | 11 Apr 2025 |
| 720 | optometristeldoradohills.com | eNom, Inc. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 721 | optometrydoctorwestminster.com | eNom, Inc. | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 722 | optom-vsyo.com | Internet Invest, Ltd. dba Imena.ua | 24 Sep 2014 | 17 Sep 2024 | 24 Sep 2025 |
| 723 | optonlinie.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Aug 2021 | 27 Aug 2021 | 27 Aug 2022 |
| 724 | optorr.com | GoDaddy.com, LLC | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2017 |
| 725 | optonia.biz | GKG.NET, INC. | 27 Sep 2007 | 1 Oct 2017 | 26 Sep 2018 |
| 726 | optovik.info | Limited Liability Company "Registrar of domain nam… | 6 Jan 2021 | 24 Dec 2024 | 6 Jan 2026 |
| 727 | optometristlittlerock.com | GoDaddy.com, LLC | 8 Oct 2014 | 27 May 2024 | 8 Oct 2024 |
| 728 | optometristscolumbusohio.com | Tucows Domains Inc. | 5 Oct 2012 | 9 Oct 2014 | 5 Oct 2015 |
| 729 | optopiaramereyecare.com | Tucows Domains Inc. | 5 Oct 2012 | 9 Oct 2014 | 5 Oct 2015 |
| 730 | optout-jcmd.net | Name.com, Inc. | 9 Oct 2014 | 9 Oct 2014 | 9 Oct 2015 |
| 731 | optout-jdlw.net | Name.com, Inc. | 9 Oct 2014 | 9 Oct 2014 | 9 Oct 2015 |
| 732 | optoplus.info | GoDaddy.com, LLC | 7 Apr 2020 | 6 Jun 2020 | 7 Apr 2021 |
| 733 | optomise.net | Tucows Domains Inc. | 21 Nov 2014 | 22 Oct 2024 | 21 Nov 2025 |
| 734 | optonicaled.mobi | GoDaddy.com, LLC | 9 Oct 2014 | 7 Sep 2024 | 9 Oct 2025 |
| 735 | optoitbizzo.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 736 | optometrylaws.com | GoDaddy.com, LLC | 14 Jun 2016 | 15 Jun 2024 | 14 Jun 2025 |
| 737 | optometryrules.com | GoDaddy.com, LLC | 28 Sep 2014 | 28 Sep 2014 | 28 Sep 2015 |
| 738 | optoscreener.com | NamesHere LLC | 3 Sep 2012 | 4 Sep 2017 | 3 Sep 2018 |
| 739 | optoprismethod.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Sep 2014 | 11 Sep 2017 | 29 Sep 2018 |
| 740 | optoprismethod.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Sep 2014 | 11 Sep 2017 | 29 Sep 2018 |
| 741 | optomechanic-bg.org | Wild West Domains, LLC | 21 Nov 2014 | 21 Nov 2014 | 21 Nov 2015 |
| 742 | optometristsmiami.com | Tucows Domains Inc. | 13 Jan 2017 | 17 Jan 2018 | 13 Jan 2018 |
| 743 | optometristventura.com | eNom, Inc. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 744 | optoutct.org | GoDaddy.com, LLC | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 745 | optoec.com | Tucows Domains Inc. | 10 Feb 2014 | 14 Feb 2016 | 10 Feb 2017 |
| 746 | optotraveline.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Oct 2014 | 29 Nov 2017 | 17 Oct 2018 |
| 747 | optologicshop.com | Register.it SPA | 11 Oct 2014 | 13 Nov 2017 | 11 Oct 2018 |
| 748 | optout-wssk.net | Name.com, Inc. | 12 Oct 2014 | 12 Oct 2014 | 12 Oct 2015 |
| 749 | optomedia.net | 1API GmbH | 11 May 2018 | 25 Jul 2024 | 11 May 2024 |
| 750 | optoutohio.com | GoDaddy.com, LLC | 15 May 2020 | 16 May 2024 | 15 May 2025 |
| 751 | optouen.com | Network Solutions, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 752 | optometristenlistment.com | GoDaddy.com, LLC | 27 Sep 2014 | 27 Sep 2014 | 27 Sep 2015 |
| 753 | optochips.com | GoDaddy.com, LLC | 6 Mar 2017 | 6 Mar 2017 | 6 Mar 2018 |
| 754 | optometristsantaana.com | pair Networks, Inc. d/b/a pairNIC | 25 Nov 2014 | 15 Nov 2024 | 25 Nov 2025 |
| 755 | optometristriverside.com | pair Networks, Inc. d/b/a pairNIC | 25 Nov 2014 | 15 Nov 2024 | 25 Nov 2025 |
| 756 | optometristnorwalk.com | pair Networks, Inc. d/b/a pairNIC | 25 Nov 2014 | 15 Nov 2024 | 25 Nov 2025 |
| 757 | optoutname.com | eNom, Inc. | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 758 | optometristsantarosa.com | GKG.NET, INC. | 17 Oct 2014 | 18 Oct 2014 | 17 Oct 2015 |
| 759 | optoliving.com | GoDaddy.com, LLC | 17 Oct 2014 | 18 Oct 2024 | 17 Oct 2026 |
| 760 | optokart.com | Google, Inc. | 22 Apr 2021 | 18 Jun 2024 | 22 Apr 2025 |
| 761 | optogas.com | 1&1 Internet AG | 17 Oct 2014 | 18 Oct 2024 | 17 Oct 2025 |
| 762 | optocentroandora.com | Tucows Domains Inc. | 14 Oct 2011 | 18 Oct 2014 | 14 Oct 2015 |
| 763 | optout.name | - | - | - | - |
| 764 | optogard.com | - | 20 Oct 2016 | 20 Oct 2016 | 20 Oct 2017 |
| 765 | optographics.us | PSI-USA, Inc. dba Domain Robot | 14 Oct 2014 | 14 Oct 2014 | 13 Oct 2015 |
| 766 | optosenso.com | GoDaddy.com, LLC | 14 Jul 2024 | 14 Jul 2024 | 14 Jul 2025 |
| 767 | optout-wwgt.net | Name.com, Inc. | 14 Oct 2014 | 12 Sep 2017 | 14 Oct 2018 |
| 768 | optometristlafayettetn.com | GoDaddy.com, LLC | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 769 | optoele.com | Domain.com, LLC | 18 Oct 2014 | 3 Oct 2024 | 18 Oct 2025 |
| 770 | optovolokna.net | Regional Network Information Center, JSC dba RU-CE… | 4 Nov 2014 | 13 Aug 2018 | 3 Nov 2018 |
| 771 | optomshow.com | GoDaddy.com, LLC | 19 Oct 2014 | 20 Oct 2024 | 19 Oct 2025 |
| 772 | optout-qrbf.net | Name.com, Inc. | 25 Nov 2014 | 26 Oct 2017 | 25 Nov 2018 |
| 773 | optout-lgmq.net | Name.com, Inc. | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 774 | optout-hzmv.net | Name.com, Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2015 |
| 775 | optofine.net | Above.com Pty Ltd. | 15 Oct 2014 | 28 Jan 2025 | 15 Oct 2025 |
| 776 | optometristefovea.com | GoDaddy.com, LLC | 15 Oct 2014 | 18 Oct 2016 | 15 Oct 2017 |
| 777 | optometrysta.info | NetArt Registrar Sp. z o.o. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 778 | optometrystagdynia.com | NetArt Registrar Sp. z o.o. | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 779 | optoutflorida.com | - | 20 Mar 2022 | 22 May 2023 | 20 Mar 2023 |
| 780 | optometrywindsor.com | Name.com, Inc. | 26 Nov 2014 | 4 Nov 2016 | 26 Nov 2017 |
| 781 | optometrystratford.com | Beijing Lanhai Jiye Technology Co., Ltd | 5 Jul 2024 | 13 Dec 2024 | 5 Jul 2025 |
| 782 | optometriststratford.com | GoDaddy.com, LLC | 25 Nov 2014 | 30 Aug 2016 | 25 Nov 2021 |
| 783 | optometristsstratford.com | GoDaddy.com, LLC | 25 Nov 2014 | 30 Aug 2016 | 25 Nov 2021 |
| 784 | optones.com | Realtime Register B.V. | 26 Sep 2021 | 4 Sep 2024 | 26 Sep 2025 |
| 785 | optobank.com | Lionshare Domains, LLC | 3 Feb 2019 | 5 Feb 2025 | 3 Feb 2026 |
| 786 | optomode.net | Gabia, Inc. | 23 Nov 2010 | 26 Nov 2018 | 23 Nov 2021 |
| 787 | optoutmanager.com | Namestop LLC | 9 Mar 2020 | 22 May 2024 | 9 Mar 2024 |
| 788 | optoutattorney.com | NameCheap, Inc. | 29 Nov 2014 | 30 Oct 2024 | 29 Nov 2025 |
| 789 | optommebel.com | DomainTact LLC | 14 Jun 2018 | 14 Jun 2018 | 14 Jun 2019 |
| 790 | optometristtarponsprings.com | West263 International Limited | 14 Oct 2020 | 14 Oct 2020 | 14 Oct 2021 |
| 791 | optocomputer.com | Domain.com, LLC | 19 Sep 2018 | 8 Sep 2024 | 19 Sep 2025 |
| 792 | optometu.info | Dynadot, LLC | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 793 | opto-eng.com | Gabia, Inc. | 20 Oct 2020 | 23 Sep 2022 | 20 Oct 2025 |
| 794 | optovikon.com | Regional Network Information Center, JSC dba RU-CE… | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 795 | optometristinloveland.com | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2014 | 2 Dec 2015 |
| 796 | optoutr2.com | register.com, Inc. | 3 Dec 2014 | 4 Nov 2017 | 3 Dec 2018 |
| 797 | optometristsurfsidebeach.com | eNom, Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 798 | optometriasanfrancisco.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 799 | optomagic.com | TurnCommerce, Inc. DBA NameBright.com | 20 Feb 2017 | 14 Feb 2021 | 20 Feb 2025 |
| 800 | optomagic.info | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 801 | optovikodessa.com | Internet Invest, Ltd. dba Imena.ua | 4 Dec 2014 | 2 Dec 2016 | 4 Dec 2017 |
| 802 | optoponics.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Apr 2024 | 7 Oct 2024 | 16 Apr 2025 |
| 803 | optout-ppwj.net | Name.com, Inc. | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 804 | optomagic.org | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 805 | optomagic.net | GoDaddy.com, LLC | 4 Dec 2014 | 4 Dec 2014 | 4 Dec 2015 |
| 806 | optovs.com | OVH sas | 5 Dec 2014 | 17 Dec 2014 | 5 Dec 2015 |
| 807 | optolus.com | CV. Jogjacamp | 2 Aug 2024 | 2 Aug 2024 | 2 Aug 2025 |
| 808 | optometricassociation.net | eNom, Inc. | 5 Dec 2014 | 5 Dec 2014 | 5 Dec 2015 |
| 809 | optomist.com | TurnCommerce, Inc. DBA NameBright.com | 21 Jan 2020 | 15 Jan 2021 | 21 Jan 2026 |
| 810 | optomdan.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 811 | optoelectric.com | GoDaddy.com, LLC | 26 Feb 2018 | 31 Aug 2023 | 26 Feb 2025 |
| 812 | optoparadigm.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 813 | optolightsolutions.com | Network Solutions, LLC | 5 Mar 2016 | 5 Mar 2016 | 5 Mar 2017 |
| 814 | optobriteled.com | Network Solutions, LLC | 11 Dec 2014 | 9 Dec 2016 | 11 Dec 2018 |
| 815 | optobriteindustries.com | Network Solutions, LLC | 11 Dec 2014 | 23 Jan 2025 | 11 Dec 2024 |
| 816 | optom.mobi | Tucows Domains Inc. | 10 Dec 2014 | 14 Dec 2021 | 10 Dec 2022 |
| 817 | optosupply-tech.com | GMO Internet Inc. | 12 Dec 2014 | 12 Dec 2016 | 11 Dec 2017 |
| 818 | optom-toys.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 819 | optofeel.com | HANGANG Systems, Inc. d/b/a doregi.com | 8 Dec 2006 | 11 Dec 2024 | 8 Dec 2024 |
| 820 | optometricalliance.org | GoDaddy.com, LLC | 10 Dec 2014 | 21 Jan 2025 | 10 Dec 2024 |
| 821 | optosonic.com | GoDaddy.com, LLC | 12 Dec 2014 | 23 Jan 2025 | 12 Dec 2024 |
| 822 | optonljne.com | Tucows Domains Inc. | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2016 |
| 823 | optoelectroniccomponents.com | GoDaddy.com, LLC | 15 Oct 2008 | 5 Nov 2024 | 15 Oct 2025 |
| 824 | optometristinoshkosh.com | Domain.com, LLC | 13 Dec 2014 | 26 Jan 2025 | 13 Dec 2024 |
| 825 | optometrist-master.com | OVH sas | 13 Dec 2014 | 13 Dec 2024 | 13 Dec 2025 |
| 826 | optoro.net | Dynadot, LLC | 15 Feb 2022 | 15 Feb 2022 | 15 Feb 2023 |
| 827 | optocircuitsshareprice.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 828 | optonxpress.com | Fabulous.com Pty Ltd. | 15 Nov 2005 | 1 Dec 2015 | 15 Nov 2016 |
| 829 | optonoline.com | Media Elite Holdings Limited | 3 Feb 2023 | 4 Feb 2024 | 3 Feb 2024 |
| 830 | optombuy.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 May 2021 | 21 Jun 2024 | 20 May 2024 |
| 831 | optoptan.com | Name.com, Inc. | 16 Dec 2014 | 16 Dec 2016 | 16 Dec 2017 |
| 832 | optomol.com | GoDaddy.com, LLC | 7 Jul 2023 | 18 Aug 2024 | 7 Jul 2024 |
| 833 | optometristlapuente.com | register.com, Inc. | 16 Dec 2014 | 16 Dec 2014 | 16 Dec 2015 |
| 834 | optosucceed.com | Tucows Domains Inc. | 14 Dec 2012 | 18 Dec 2014 | 14 Dec 2015 |
| 835 | optout-jfss.net | Name.com, Inc. | 17 Dec 2014 | 23 Nov 2016 | 17 Dec 2017 |
| 836 | optout-fskz.net | Name.com, Inc. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 837 | optoprime.com | BigRock Solutions Ltd. | 3 Aug 2017 | 22 Jun 2023 | 3 Aug 2032 |
| 838 | optometristsnewbraunfels.com | eNom, Inc. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 839 | optoelectronicslightinganddisplays.com | MarkMonitor Inc. | 19 Dec 2014 | 21 Nov 2024 | 19 Dec 2025 |
| 840 | optoelectronicsandlighting.com | MarkMonitor Inc. | 19 Dec 2014 | 21 Nov 2024 | 19 Dec 2025 |
| 841 | optoelectronics.biz | MarkMonitor Inc. | 19 Dec 2014 | 21 Nov 2024 | 18 Dec 2025 |
| 842 | optoelectronic.biz | MarkMonitor Inc. | 19 Dec 2014 | 21 Nov 2024 | 18 Dec 2025 |
| 843 | optobe.com | - | 31 May 2022 | 14 Aug 2023 | 31 May 2023 |
| 844 | optob.com | - | 31 May 2022 | 14 Aug 2023 | 31 May 2023 |
| 845 | opto-b.com | united-domains AG | 19 Dec 2014 | 20 Dec 2016 | 19 Dec 2017 |
| 846 | optout-jczl.net | Name.com, Inc. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 847 | optout-fgzr.net | Name.com, Inc. | 19 Dec 2014 | 19 Dec 2014 | 19 Dec 2015 |
| 848 | optoelectronics.us | MarkMonitor Inc. | 19 Dec 2014 | 21 Nov 2021 | 18 Dec 2023 |
| 849 | optoelectronic.us | MarkMonitor Inc. | 19 Dec 2014 | 21 Nov 2021 | 18 Dec 2023 |
| 850 | optobe.org | united-domains AG | 19 Dec 2014 | 20 Dec 2016 | 19 Dec 2017 |
| 851 | optobe.net | united-domains AG | 19 Dec 2014 | 20 Dec 2016 | 19 Dec 2017 |
| 852 | opto-b.org | united-domains AG | 19 Dec 2014 | 20 Dec 2016 | 19 Dec 2017 |
| 853 | opto-b.net | united-domains AG | 19 Dec 2014 | 20 Dec 2016 | 19 Dec 2017 |
| 854 | optoplusmontmagny.com | Tucows Domains Inc. | 22 Dec 2014 | 26 Dec 2018 | 22 Dec 2018 |
| 855 | optons-adv.com | Tucows Domains Inc. | 21 Dec 2014 | 25 Dec 2015 | 21 Dec 2016 |
| 856 | optoins-adv.com | Tucows Domains Inc. | 22 Dec 2014 | 26 Dec 2015 | 22 Dec 2016 |
| 857 | optocatalytix.com | eNom, Inc. | 21 Dec 2014 | 21 Dec 2014 | 21 Dec 2015 |
| 858 | optometricassociationofindia.org | GoDaddy.com, LLC | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 859 | optometrys.com | NameCheap, Inc. | 3 Oct 2024 | 16 Oct 2024 | 3 Oct 2025 |
| 860 | optoncc.com | GoDaddy.com, LLC | 23 Dec 2014 | 23 Dec 2014 | 23 Dec 2015 |
| 861 | optocomponents.com | TurnCommerce, Inc. DBA NameBright.com | 23 Feb 2017 | 17 Feb 2021 | 23 Feb 2025 |
| 862 | optoff.com | DropCatch.com 1268 LLC | 7 Mar 2018 | 7 Feb 2020 | 7 Mar 2025 |
| 863 | optokus.net | Tucows Domains Inc. | 25 Dec 2014 | 29 Dec 2016 | 25 Dec 2016 |
| 864 | optometriabarturen.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 865 | optomdeshevle.com | TurnCommerce, Inc. DBA NameBright.com | 26 Dec 2014 | 6 Feb 2025 | 26 Dec 2024 |
| 866 | optovik-2.net | - | 8 Jun 2016 | 8 Jun 2016 | 8 Jun 2017 |
| 867 | optor.net | Beijing Lanhai Jiye Technology Co., Ltd | 19 Sep 2023 | 13 Jan 2025 | 19 Sep 2025 |
| 868 | optoutheritagepci.com | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 869 | optometristversaillesky.com | Tucows Domains Inc. | 29 Dec 2014 | 2 Jan 2017 | 29 Dec 2016 |
| 870 | optochip.org | Regional Network Information Center, JSC dba RU-CE… | 29 Dec 2014 | 1 Jan 2025 | 29 Dec 2025 |
| 871 | optometristsanantonio.com | NameCheap, Inc. | 12 Jul 2024 | 16 Nov 2024 | 12 Jul 2025 |
| 872 | optoviku.com | NeoNIC OY | 21 Mar 2016 | 15 May 2024 | 21 Mar 2025 |
| 873 | optoutmyrmloan.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 874 | optoparadigmllc.com | GoDaddy.com, LLC | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 875 | optomisticcurmudgeon.com | register.com, Inc. | 5 Jan 2015 | 22 Mar 2017 | 5 Jan 2018 |
| 876 | optometristfinder.com | GoDaddy.com, LLC | 7 Sep 2023 | 7 Sep 2023 | 7 Sep 2028 |
| 877 | optometriste.vision | Gandi SAS | 2 Jul 2014 | 2 Jul 2020 | 2 Jul 2021 |
| 878 | optogenetics.expert | GoDaddy.com, LLC | 1 Jul 2014 | 6 Jan 2017 | 1 Jul 2017 |
| 879 | optom.plumbing | Tucows Domains Inc. | 16 Jul 2014 | 20 Jul 2015 | 16 Jul 2016 |
| 880 | optom.lighting | Tucows Domains Inc. | 16 Jul 2014 | 20 Jul 2015 | 16 Jul 2016 |
| 881 | optometry.tips | Name.com, Inc. | 10 Mar 2016 | 9 Feb 2018 | 10 Mar 2019 |
| 882 | optometry.equipment | Uniregistrar Corp | 29 Apr 2017 | 29 Sep 2017 | 29 Apr 2018 |
| 883 | opto22distributor.xyz | Network Solutions, LLC | 13 Jul 2014 | 14 Jul 2014 | 13 Jul 2015 |
| 884 | optout.link | NameCheap, Inc. | 31 Mar 2018 | 18 May 2018 | 31 Mar 2028 |
| 885 | opto22.xyz | Network Solutions, LLC | 21 Jul 2014 | 21 Jul 2014 | 21 Jul 2015 |
| 886 | optocal.xyz | Network Solutions, LLC | 23 Jul 2014 | 23 Jul 2014 | 23 Jul 2015 |
| 887 | optoutdomains-ori.xyz | Network Solutions, LLC | 23 Jul 2014 | 24 Jul 2014 | 23 Jul 2015 |
| 888 | optographics.lighting | Metaregistrar BV Applications | 1 Aug 2017 | 1 Aug 2017 | 1 Aug 2018 |
| 889 | optometrie.training | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Jul 2014 | 8 Jul 2024 | 31 Jul 2025 |
| 890 | optonest.xyz | Network Solutions, LLC | 29 Jul 2014 | 30 Jul 2014 | 29 Jul 2015 |
| 891 | optometrist.care | GoDaddy.com, LLC | 18 Aug 2014 | 29 Oct 2023 | 18 Aug 2023 |
| 892 | optometry.clinic | GoDaddy.com, LLC | 28 Aug 2014 | 4 Jul 2024 | 28 Aug 2025 |
| 893 | optometrie.clinic | GoDaddy.com, LLC | 28 Aug 2014 | 4 Jul 2024 | 28 Aug 2025 |
| 894 | optometric.clinic | GoDaddy.com, LLC | 28 Aug 2014 | 4 Jul 2024 | 28 Aug 2025 |
| 895 | optom.shoes | Regtime Ltd. | 2 Sep 2014 | 1 Feb 2017 | 2 Sep 2017 |
| 896 | optometrist.vegas | NETIM SARL | 16 Sep 2014 | 13 Sep 2024 | 16 Sep 2025 |
| 897 | optomize.solutions | eNom, Inc. | 17 Sep 2014 | 19 Aug 2019 | 17 Sep 2020 |
| 898 | optometry.guide | 1&1 Internet AG | 17 Sep 2014 | 1 Nov 2019 | 17 Sep 2020 |
| 899 | optom.toys | Tucows Domains Inc. | 29 Sep 2014 | 3 Oct 2018 | 29 Sep 2019 |
| 900 | optometria.center | Key-Systems, LLC | 4 Jan 2019 | 4 Jan 2019 | 4 Jan 2020 |
| 901 | optoconcept.vision | OVH sas | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 902 | optoconcept.lighting | OVH sas | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 903 | optometrist.guide | Name.com, Inc. | 5 Oct 2014 | 17 Sep 2024 | 5 Oct 2025 |
| 904 | optom.city | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Oct 2014 | 9 Oct 2014 | 8 Oct 2015 |
| 905 | optometry.scot | Tucows Domains Inc. | 16 Oct 2014 | 26 Nov 2024 | 16 Oct 2024 |
| 906 | optometry.nyc | Network Solutions, LLC | 3 Oct 2014 | 9 Aug 2020 | 2 Oct 2025 |
| 907 | optonline.services | GoDaddy.com, LLC | 23 Oct 2014 | 6 Jan 2017 | 23 Oct 2017 |
| 908 | optowin.net | DOMAIN NAME NETWORK PTY LTD | 18 Apr 2022 | 1 Jul 2023 | 18 Apr 2023 |
| 909 | optoism.com | HiChina Zhicheng Technology Limited | 11 Aug 2015 | 4 Apr 2024 | 11 Aug 2030 |
| 910 | optometry.website | Alpnames Limited | 16 Mar 2017 | 16 May 2017 | 16 Mar 2018 |
| 911 | optometrist.vision | GoDaddy.com, LLC | 19 Mar 2016 | 30 May 2024 | 19 Mar 2024 |
| 912 | optom.moscow | Regtime Ltd. | 29 Dec 2021 | 29 Dec 2023 | 29 Dec 2023 |
| 913 | optomen.london | GoDaddy.com, LLC | 25 Nov 2014 | 26 Nov 2024 | 25 Nov 2025 |
| 914 | optoviy-sklad.moscow | Limited Liability Company "Registrar of domain nam… | 4 Dec 2014 | 5 Dec 2014 | 4 Dec 2015 |
| 915 | optoviq.moscow | Regional Network Information Center, JSC dba RU-CE… | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 916 | optovik.moscow | Regional Network Information Center, JSC dba RU-CE… | 1 Dec 2014 | 8 Dec 2014 | 1 Dec 2015 |
| 917 | optovic.moscow | Regional Network Information Center, JSC dba RU-CE… | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 918 | optoped.center | Regional Network Information Center, JSC dba RU-CE… | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 919 | optometrist.services | Crazy Domains FZ-LLC | 19 Dec 2014 | 20 Oct 2023 | 19 Dec 2025 |
| 920 | optometrist.expert | Crazy Domains FZ-LLC | 19 Dec 2014 | 20 Oct 2023 | 19 Dec 2025 |
| 921 | optometrist.business | Google, Inc. | 11 Aug 2019 | 11 Aug 2019 | 11 Aug 2020 |
| 922 | optometry.care | GoDaddy.com, LLC | 25 Dec 2014 | 31 Dec 2024 | 25 Dec 2026 |
| 923 | opto-sensor.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Jan 2015 | 5 Jan 2015 | 5 Jul 2017 |
| 924 | optometrists.vegas | eNom, Inc. | 2 Jun 2014 | 6 Jan 2015 | 2 Jun 2015 |
| 925 | optometry.world | 1&1 Internet AG | 14 Jan 2015 | 14 Jan 2025 | 14 Jan 2026 |
| 926 | optometrist.website | - | 16 Jul 2024 | 21 Jul 2024 | 16 Jul 2025 |
| 927 | optoelectronics.forsale | MarkMonitor Inc. | 21 Jan 2015 | 25 Dec 2024 | 21 Jan 2027 |
| 928 | optometrist.healthcare | Dynadot, LLC | 4 Aug 2020 | 4 Aug 2020 | 4 Aug 2021 |
| 929 | optout-xtlv.net | Name.com, Inc. | 12 Aug 2015 | 11 Jul 2017 | 12 Aug 2018 |
| 930 | optout-xhtr.net | Name.com, Inc. | 12 Aug 2015 | 11 Jul 2017 | 12 Aug 2018 |
| 931 | optout-wvcx.net | Name.com, Inc. | 12 Aug 2015 | 11 Jul 2017 | 12 Aug 2018 |
| 932 | optout-sqcn.net | Name.com, Inc. | 13 Aug 2015 | 13 Aug 2015 | 13 Aug 2016 |
| 933 | optout-nqjb.net | Name.com, Inc. | 12 Aug 2015 | 11 Jul 2016 | 12 Aug 2017 |
| 934 | optout-bxlp.net | Name.com, Inc. | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 935 | optosl.com | Amazon Registrar, Inc. | 10 Aug 2006 | 24 May 2017 | 10 Aug 2018 |
| 936 | optometristwoodbridge.com | Tucows Domains Inc. | 9 Aug 2010 | 13 Aug 2015 | 9 Aug 2016 |
| 937 | optometrist.joburg | Tucows Domains Inc. | 7 Jan 2015 | 11 Jan 2016 | 7 Jan 2017 |
| 938 | optometrist.durban | Tucows Domains Inc. | 7 Jan 2015 | 11 Jan 2016 | 7 Jan 2017 |
| 939 | optometrist.capetown | Hosting Concepts B.V. dba Openprovider | 4 Feb 2017 | 13 Dec 2024 | 4 Feb 2026 |
| 940 | optometrist.onl | Crazy Domains FZ-LLC | 28 Jan 2015 | - | 28 Jan 2016 |
| 941 | optout.club | GoDaddy.com, LLC | 1 Jan 2020 | 2 Jan 2025 | 1 Jan 2026 |
| 942 | optometryce.education | GoDaddy.com, LLC | 12 Feb 2015 | 29 Mar 2017 | 12 Feb 2018 |
| 943 | optometrists.work | Go Canada Domains, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 944 | optometrist.work | 1&1 Internet AG | 29 Apr 2017 | 13 Jun 2024 | 29 Apr 2025 |
| 945 | optometry.work | Gandi SAS | 19 Nov 2018 | 14 Oct 2024 | 19 Nov 2025 |
| 946 | optometrists.sydney | Key-Systems, LLC | 16 Apr 2023 | 21 Apr 2023 | 16 Apr 2025 |
| 947 | optometrists.guru | eNom, Inc. | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 948 | optometry.direct | 1&1 Internet AG | 15 Feb 2015 | 31 Mar 2024 | 15 Feb 2025 |
| 949 | optometrists.reviews | Name.com, Inc. | 14 Feb 2015 | 4 Apr 2017 | 14 Feb 2018 |
| 950 | optometrist.top | Uniregistrar Corp | 6 Aug 2017 | 14 Oct 2017 | 6 Aug 2018 |
| 951 | optometry.healthcare | Epik Inc. | 11 Mar 2021 | 11 Mar 2021 | 11 Mar 2022 |
| 952 | optovik.city | Regional Network Information Center, JSC dba RU-CE… | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 953 | optometry.vision | GoDaddy.com, LLC | 22 Feb 2015 | 7 Jul 2024 | 22 Feb 2027 |
| 954 | optometry.wales | 1&1 Internet AG | 1 Mar 2015 | 1 Mar 2024 | 1 Mar 2025 |
| 955 | optometry.cymru | 1&1 Internet AG | 1 Mar 2015 | 1 Mar 2024 | 1 Mar 2025 |
| 956 | optometristsbirkenhead.kiwi | Tucows Domains Inc. | 18 Nov 2016 | 23 Nov 2016 | 18 Nov 2017 |
| 957 | optometristsocial.media | eNom, Inc. | 24 Jul 2016 | 1 Jul 2017 | 24 Jul 2017 |
| 958 | optout.nyc | GoDaddy.com, LLC | 25 Mar 2019 | 31 Mar 2020 | 25 Mar 2021 |
| 959 | optorg.moscow | Limited Liability Company "Registrar of domain nam… | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 960 | optomechanical.engineer | 1&1 Internet AG | 26 Mar 2015 | 10 May 2024 | 26 Mar 2025 |
| 961 | optometry.community | GoDaddy.com, LLC | 3 Apr 2015 | 14 Jun 2023 | 3 Apr 2023 |
| 962 | optometrist.frl | Metaregistrar BV Applications | 3 Apr 2015 | 19 May 2024 | 3 Apr 2025 |
| 963 | optometrist.community | GoDaddy.com, LLC | 3 Apr 2015 | 15 Apr 2020 | 3 Apr 2021 |
| 964 | optometrie.frl | Mijndomein.nl BV | 2 Feb 2015 | 2 Apr 2017 | 3 Apr 2018 |
| 965 | opto-mechanical.engineer | 1&1 Internet AG | 3 Apr 2015 | 18 May 2024 | 3 Apr 2025 |
| 966 | optout.center | GoDaddy.com, LLC | 30 Jun 2023 | 5 Jul 2023 | 30 Jun 2026 |
| 967 | optometry.expert | Name.com, Inc. | 3 Feb 2019 | 5 Feb 2025 | 3 Feb 2026 |
| 968 | optovik.company | Tucows Domains Inc. | 8 Apr 2015 | 12 Apr 2017 | 8 Apr 2018 |
| 969 | optorial.com | GoDaddy.com, LLC | 1 Jul 2021 | 1 Jul 2021 | 1 Jul 2022 |
| 970 | optophoenix.com | Shanghai Best Oray Information S&T Co., Ltd | 13 Aug 2015 | 25 Aug 2016 | 13 Aug 2018 |
| 971 | optometriahdyfotografia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Aug 2015 | 15 Jul 2016 | 13 Aug 2017 |
| 972 | optology.science | Alpnames Limited | 24 Feb 2015 | 25 Apr 2015 | 23 Feb 2016 |
| 973 | optometry.capetown | Tucows Domains Inc. | 23 Apr 2015 | 23 Apr 2015 | 23 Apr 2016 |
| 974 | optout-qckg.net | Name.com, Inc. | 4 Jan 2015 | 4 Jan 2015 | 4 Jan 2016 |
| 975 | optometristgreenville.com | GoDaddy.com, LLC | 6 Jan 2015 | 7 Jan 2025 | 6 Jan 2027 |
| 976 | optoutapalooza.com | DreamHost, LLC | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2017 |
| 977 | optommebel.net | Regional Network Information Center, JSC dba RU-CE… | 14 Aug 2015 | 15 Aug 2015 | 13 Aug 2017 |
| 978 | optoguide.com | GoDaddy.com, LLC | 31 Oct 2017 | 12 Jan 2025 | 31 Oct 2024 |
| 979 | optorium.com | - | 10 Jan 2025 | 11 Jan 2025 | 10 Jan 2026 |
| 980 | optomix.com | TurnCommerce, Inc. DBA NameBright.com | 29 Aug 2003 | 20 Dec 2024 | 29 Aug 2026 |
| 981 | optometrology.com | Domain.com, LLC | 13 Jan 2001 | 10 Jan 2015 | 13 Jan 2016 |
| 982 | optoman.com | Nordreg AB | 18 Aug 2015 | 21 Jan 2025 | 18 Aug 2025 |
| 983 | optofiber.com | Annulet LLC | 18 Jun 2004 | 5 Aug 2024 | 18 Jun 2025 |
| 984 | optout-mphd.net | Name.com, Inc. | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 985 | optout-bkc.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2015 | 8 Jan 2015 | 8 Jan 2016 |
| 986 | optokraft.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Jan 2015 | 17 Nov 2024 | 10 Jan 2026 |
| 987 | optoair.com | 1&1 Internet AG | 10 Jan 2015 | 11 Jan 2025 | 10 Jan 2026 |
| 988 | optoplants.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2016 |
| 989 | optoeffect.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2016 |
| 990 | optowner.net | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 991 | optout-qcmq.net | Name.com, Inc. | 11 Jan 2015 | 15 Dec 2016 | 11 Jan 2018 |
| 992 | optotrafficlongisland.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 993 | optometrylocal.com | FastDomain Inc. | 13 Jan 2015 | 13 Jan 2017 | 13 Jan 2018 |
| 994 | optometristtucson.com | GoDaddy.com, LLC | 13 Jan 2015 | 14 Jan 2025 | 13 Jan 2026 |
| 995 | optometristsilverspring.com | GoDaddy.com, LLC | 13 Jan 2015 | 13 Jan 2015 | 13 Jan 2016 |
| 996 | optometristsanjose.com | - | 16 Jan 2022 | 13 Feb 2025 | 16 Jan 2026 |
| 997 | optometrymarkets.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2017 |
| 998 | optouturl.net | GoDaddy.com, LLC | 15 Jan 2015 | 16 Jan 2025 | 15 Jan 2026 |
| 999 | optonline.nyc | GoDaddy.com, LLC | 18 May 2015 | 23 May 2024 | 17 May 2025 |
| 1000 | optovik.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 May 2015 | 22 Aug 2024 | 30 May 2025 |
Displaying 1,000 out of 16,371 domains starting with the keyword "OPTO". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=opto
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |