Our database now contains whois records of 602 Million (602,432,602) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [602 Million Domains] $10,000 Details

Keyword: OUTWARDLY

Reverse Whois » KEYWORD [outwardly ]  { 58 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1outwardly.infoNameCheap, Inc.7 Jul 20227 Jul 20237 Jul 2024
2outwardly.sexyGoDaddy.com, LLC9 Mar 20159 Mar 20159 Mar 2016
3outwardly.netPapaki Ltd.8 Apr 20158 Apr 20158 Apr 2016
4outwardly.spaceGoDaddy.com, LLC14 Feb 201615 Feb 201614 Feb 2017
5outwardly.comGoDaddy.com, LLC27 Sep 20047 Sep 202427 Sep 2025
6outwardly.us-3 Oct 20163 Oct 20162 Oct 2017
7outwardly.xyzNameCheap, Inc.26 Sep 20247 Oct 202426 Sep 2025
8outwardly.co.uk-27 Nov 202427 Nov 202427 Nov 2025
9outwardly.ru-16 May 2024-16 May 2025
10outwardly.babyDynadot, LLC11 Feb 202511 Feb 202511 Feb 2026
11outwardlysimple.comGoDaddy.com, LLC14 May 202115 May 202414 May 2025
12outwardlysimpleinwardlyrich.comGandi SAS1 Mar 20151 Mar 20151 Mar 2016
13outwardlymobile.orgTucows Domains Inc.11 Sep 201415 Sep 201711 Sep 2018
14outwardlycreative.comTucows Domains Inc.8 Jun 201312 Jun 20158 Jun 2016
15outwardlyintroverted.comFastDomain Inc.20 Jul 201522 May 201620 Jul 2017
16outwardlyargos.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Nov 201526 Nov 201526 Nov 2016
17outwardlysociable.comCrazy Domains FZ-LLC30 Jan 20125 Mar 201630 Jan 2017
18outwardly-sociable.comCrazy Domains FZ-LLC30 Jan 20125 Mar 201630 Jan 2017
19outwardlysimplerinwardlyricher.orgGoDaddy.com, LLC6 Jul 201617 Aug 20176 Jul 2018
20outwardlysimplerinwardlyricher.netGoDaddy.com, LLC6 Jul 20166 Jul 20166 Jul 2017
21outwardlysimplerinwardlyricher.infoGoDaddy.com, LLC6 Jul 201617 Aug 20176 Jul 2018
22outwardlysimplerinwardlyricher.comGoDaddy.com, LLC6 Jul 20166 Jul 20166 Jul 2017
23outwardlybound.comNameCheap, Inc.10 Aug 201611 Jul 202410 Aug 2025
24outwardlyaging.comGoDaddy.com, LLC22 Dec 201123 Dec 201522 Dec 2016
25outwardlysocial.comCloudFlare, Inc.18 Oct 200813 Nov 202418 Oct 2025
26outwardlypleasant.comFastDomain Inc.8 Aug 20138 Aug 20168 Aug 2017
27outwardlymobile.comTucows Domains Inc.23 Feb 200524 Jan 202523 Feb 2026
28outwardly-mobile.comGoogle, Inc.29 Sep 201630 Oct 201729 Sep 2017
29outwardlysocial.netGoDaddy.com, LLC18 Oct 200830 Dec 202418 Oct 2024
30outwardlyaging.orgGoDaddy.com, LLC22 Dec 201110 Nov 201722 Dec 2018
31outwardlyihcew.onlineNameCheap, Inc.4 Dec 201620 Dec 20174 Dec 2018
32outwardly-argos.comGoDaddy.com, LLC1 Jan 20171 Jan 20171 Jan 2018
33outwardlyopc.comAdvanced Internet Technologies, Inc. (AIT)24 Apr 201726 Apr 201724 Apr 2018
34outwardlyopc.orgAdvanced Internet Technologies, Inc. (AIT)24 Apr 201724 Jun 201724 Apr 2018
35outwardlyadulting.comName.com, Inc.23 Jul 201723 Jul 201723 Jul 2018
36outwardlyhuman.comGoDaddy.com, LLC16 Sep 201817 Sep 202416 Sep 2026
37outwardlyrecluse.comWild West Domains, LLC13 Oct 201825 Dec 202413 Oct 2024
38outwardlyhealing.comAutomattic Inc.28 Mar 202028 Mar 202028 Mar 2021
39outwardlybeautiful.comTucows Domains Inc.12 May 202023 Jul 202312 May 2023
40outwardlydigital.comGoDaddy.com, LLC2 Jun 20202 Jun 20202 Jun 2022
41outwardlyordinary.comGandi SAS27 Sep 202027 Sep 202027 Sep 2021
42outwardlybeautiful.netTucows Domains Inc.13 May 202117 May 202213 May 2022
43outwardlyagile.comGoDaddy.com, LLC29 Nov 202130 Nov 202429 Nov 2025
44outwardlyearthy.comNameCheap, Inc.19 Jan 2022-19 Jan 2023
45outwardlys.netAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…11 May 202212 May 202411 May 2025
46outwardlys.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…11 May 20228 May 202311 May 2025
47outwardlyhorny.lifeGoDaddy.com, LLC22 May 202222 May 202322 May 2024
48outwardlyco.comWix.com Ltd.27 Nov 202216 Jan 202427 Nov 2026
49outwardlyawkwardly.comGoDaddy.com, LLC20 May 20181 Jul 202420 May 2024
50outwardlyorganized.comSquarespace Domains LLC6 Oct 20216 Dec 20236 Oct 2023
51outwardlyisle.comSquarespace Domains LLC4 Apr 202320 Mar 20244 Apr 2025
52outwardlyodd.comGoogle, Inc.20 Jun 202220 Aug 202420 Jun 2024
53outwardlyhuman.orgGoDaddy.com, LLC16 Sep 201831 Oct 202416 Sep 2025
54outwardly-subtractions.clickNameCheap, Inc.9 Mar 202414 Mar 20249 Mar 2025
55outwardlymobile.co.uk-29 May 202329 May 202329 May 2025
56outwardlyforth.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…6 Aug 20246 Aug 20246 Aug 2025
57outwardly-supervisions.clickNameCheap, Inc.27 Nov 20242 Dec 202427 Nov 2025
58outwardlycreative.co.uk-30 Jan 202530 Jan 202530 Jan 2026

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=outwardly

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now