With support for 
Keyword: PACKAGING
Reverse Whois » KEYWORD [packaging ] { 9,034 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | packaging.tv | Hangten Domains, LLC | 25 Sep 2022 | 5 Oct 2023 | 25 Sep 2023 |
| 2 | packaging.pro | Google, Inc. | 6 Jul 2022 | 14 May 2024 | 6 Jul 2028 |
| 3 | packaging.mobi | - | 3 Jul 2024 | 30 Aug 2024 | 3 Jul 2025 |
| 4 | packaging.email | Online SAS | 1 Jul 2014 | 31 Jul 2024 | 1 Jul 2024 |
| 5 | packaging.agency | EuroDNS S.A. | 4 Apr 2023 | 8 Jun 2024 | 4 Apr 2025 |
| 6 | packaging.tools | Name.com, Inc. | 10 Nov 2021 | 24 Oct 2024 | 10 Nov 2025 |
| 7 | packaging.education | GoDaddy.com, LLC | 12 Aug 2016 | 26 Sep 2024 | 12 Aug 2025 |
| 8 | packaging.engineering | Key-Systems, LLC | 7 Dec 2018 | 21 Jan 2020 | 7 Dec 2020 |
| 9 | packaging.industries | united-domains AG | 14 May 2020 | 27 Jul 2023 | 14 May 2023 |
| 10 | packaging.cards | GoDaddy.com, LLC | 8 Nov 2019 | 18 Oct 2024 | 8 Nov 2025 |
| 11 | packaging.discount | 1&1 Internet AG | 27 Aug 2014 | 11 Oct 2024 | 27 Aug 2025 |
| 12 | packaging.hamburg | 1&1 Internet AG | 1 Sep 2022 | 1 Sep 2022 | 1 Sep 2025 |
| 13 | packaging.community | eNom, Inc. | 18 Jan 2022 | 18 Jan 2022 | 18 Jan 2023 |
| 14 | packaging.bio | eNom, Inc. | 24 Feb 2016 | 9 Feb 2025 | 24 Feb 2026 |
| 15 | packaging.buzz | GoDaddy.com, LLC | 5 Sep 2014 | 5 Sep 2014 | 4 Sep 2017 |
| 16 | packaging.christmas | Uniregistrar Corp | 30 Sep 2014 | 1 Oct 2014 | 30 Sep 2015 |
| 17 | packaging.direct | 1&1 Internet AG | 24 Sep 2014 | 24 Sep 2024 | 24 Sep 2025 |
| 18 | packaging.deals | 1&1 Internet AG | 1 Oct 2014 | 15 Nov 2024 | 1 Oct 2025 |
| 19 | packaging.london | Tucows Domains Inc. | 23 Oct 2014 | 27 Oct 2015 | 23 Oct 2016 |
| 20 | packaging.rocks | GoDaddy.com, LLC | 12 Aug 2016 | 26 Sep 2024 | 12 Aug 2025 |
| 21 | packaging.melbourne | Instra Corporation Pty Ltd. | 11 Nov 2014 | 19 Dec 2024 | 11 Nov 2025 |
| 22 | packaging.market | 1&1 Internet AG | 5 Nov 2014 | 20 Dec 2024 | 5 Nov 2025 |
| 23 | packaging.moscow | Regional Network Information Center, JSC dba RU-CE… | 1 Dec 2014 | 9 Jan 2025 | 1 Dec 2024 |
| 24 | packaging.click | Name.com, Inc. | 3 Dec 2014 | 15 Jan 2018 | 3 Dec 2017 |
| 25 | packaging.training | Key-Systems, LLC | 10 Dec 2014 | 24 Jan 2020 | 10 Dec 2020 |
| 26 | packaging.network | Google, Inc. | 24 Apr 2022 | 8 Jun 2024 | 24 Apr 2025 |
| 27 | packaging.career | Key-Systems, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 28 | packaging.business | NameCheap, Inc. | 17 Dec 2014 | 31 Jan 2025 | 17 Dec 2025 |
| 29 | packaging.top | Dynadot, LLC | 3 Jan 2025 | 3 Jan 2025 | 3 Jan 2026 |
| 30 | packaging.world | 1&1 Internet AG | 14 Jan 2015 | 14 Jan 2025 | 14 Jan 2026 |
| 31 | packaging.reviews | GoDaddy.com, LLC | 12 Jan 2015 | 24 Mar 2024 | 12 Jan 2024 |
| 32 | packaging.services | GoDaddy.com, LLC | 26 Apr 2018 | 1 Aug 2024 | 26 Apr 2028 |
| 33 | packaging.global | GoDaddy.com, LLC | 15 Jun 2023 | 27 Jul 2024 | 15 Jun 2024 |
| 34 | packaging.help | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 35 | packaging.glass | OVH sas | 29 Jan 2015 | 3 Feb 2015 | 29 Jan 2016 |
| 36 | packaging.sydney | Crazy Domains FZ-LLC | 17 Feb 2015 | 23 Feb 2025 | 17 Feb 2025 |
| 37 | packaging.legal | OVH sas | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2016 |
| 38 | packaging.wales | Mesh Digital Limited | 31 Mar 2015 | 13 Mar 2017 | 31 Mar 2018 |
| 39 | packaging.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 40 | packaging.nrw | 1&1 Internet AG | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 41 | packaging.fashion | GoDaddy.com, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 42 | packaging.company | - | 28 Jun 2015 | 6 Jul 2024 | 28 Jun 2025 |
| 43 | packaging.news | GoDaddy.com, LLC | 15 Jul 2015 | 11 Jun 2024 | 15 Jul 2025 |
| 44 | packaging.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 45 | packaging.digital | NameKing.com Inc. | 16 Jun 2021 | 29 May 2024 | 16 Jun 2025 |
| 46 | packaging.guide | Namesilo, LLC | 11 Oct 2015 | 25 Nov 2019 | 11 Oct 2020 |
| 47 | packaging.expert | united-domains AG | 12 Oct 2015 | 31 Dec 2024 | 12 Oct 2025 |
| 48 | packaging.feedback | Reserved for non-billable transactions where Regis… | 15 Oct 2015 | 30 Nov 2024 | 15 Oct 2025 |
| 49 | packaging.supplies | GoDaddy.com, LLC | 8 Jun 2018 | 3 Aug 2024 | 8 Jun 2025 |
| 50 | packaging.wiki | PSI-USA, Inc. dba Domain Robot | 6 Nov 2015 | 22 Dec 2024 | 6 Nov 2025 |
| 51 | packaging.miami | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2016 |
| 52 | packaging.forsale | GoDaddy.com, LLC | 14 Dec 2015 | 14 Dec 2015 | 14 Dec 2016 |
| 53 | packaging.press | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 20 Dec 2015 | 23 May 2017 | 20 Dec 2018 |
| 54 | packaging.show | Porkbun, LLC | 7 Dec 2024 | 12 Dec 2024 | 7 Dec 2025 |
| 55 | packaging.wine | GoDaddy.com, LLC | 14 Feb 2024 | 19 Feb 2024 | 14 Feb 2029 |
| 56 | packaging.ninja | GoDaddy.com, LLC | 29 May 2019 | 23 Jun 2024 | 29 May 2025 |
| 57 | packaging.careers | Google, Inc. | 19 Feb 2016 | 19 Feb 2016 | 19 Feb 2017 |
| 58 | packaging.coffee | GoDaddy.com, LLC | 26 Feb 2016 | 27 Feb 2025 | 26 Feb 2026 |
| 59 | packaging.pet | FBS Inc. | 25 Dec 2023 | 6 Feb 2025 | 25 Dec 2024 |
| 60 | packaging.com | GoDaddy.com, LLC | 3 May 1995 | 3 Sep 2022 | 4 May 2026 |
| 61 | packaging.barcelona | 1&1 Internet AG | 24 Mar 2016 | 8 May 2024 | 24 Mar 2025 |
| 62 | packaging.video | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Mar 2016 | 4 Mar 2017 | 29 Mar 2018 |
| 63 | packaging.photo | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 29 Mar 2016 | 4 Mar 2017 | 29 Mar 2018 |
| 64 | packaging.live | - | 18 Nov 2024 | 25 Dec 2024 | 18 Nov 2025 |
| 65 | packaging.scot | 1&1 Internet AG | 23 Sep 2014 | - | 23 Sep 2016 |
| 66 | packaging.ltd | GoDaddy.com, LLC | 22 Jun 2016 | 23 Jul 2024 | 22 Jun 2025 |
| 67 | packaging.tube | 101domain, Inc. | 7 Jul 2016 | 7 Jul 2016 | 6 Jul 2017 |
| 68 | packaging.group | GoDaddy.com, LLC | 8 Jun 2016 | 22 Jul 2024 | 8 Jun 2025 |
| 69 | packaging.equipment | eNom, Inc. | 12 Feb 2014 | 12 Feb 2025 | 12 Feb 2026 |
| 70 | packaging.graphics | Network Solutions, LLC | 25 Nov 2022 | 1 Oct 2024 | 25 Nov 2025 |
| 71 | packaging.guru | - | 14 Jun 2024 | 28 Jan 2025 | 14 Jun 2025 |
| 72 | packaging.center | Network Solutions, LLC | 24 May 2019 | 13 Jun 2024 | 24 May 2025 |
| 73 | packaging.management | 1&1 Internet AG | 19 Mar 2014 | 3 May 2017 | 19 Mar 2018 |
| 74 | packaging.academy | NETIM SARL | 19 Mar 2014 | 24 Mar 2024 | 19 Mar 2025 |
| 75 | packaging.systems | eNom, Inc. | 19 Mar 2014 | 23 Mar 2024 | 19 Mar 2025 |
| 76 | packaging.support | Porkbun, LLC | 7 Dec 2024 | 12 Dec 2024 | 7 Dec 2025 |
| 77 | packaging.international | GoDaddy.com, LLC | 7 Apr 2014 | 19 Apr 2023 | 7 Apr 2024 |
| 78 | packaging.solutions | Go Montenegro Domains, LLC | 23 Mar 2014 | 6 Jun 2024 | 23 Mar 2025 |
| 79 | packaging.technology | Gransy s.r.o. d/b/a subreg.cz | 19 Feb 2014 | 12 Feb 2025 | 19 Feb 2026 |
| 80 | packaging.cloud | EuroDNS S.A. | 16 Feb 2016 | 15 Feb 2025 | 16 Feb 2026 |
| 81 | packaging.jobs | Name Share, Inc. | 4 Feb 2010 | 21 Mar 2016 | 4 Feb 2017 |
| 82 | packaging.tips | Google, Inc. | 13 Jan 2021 | 13 Jan 2021 | 13 Jan 2022 |
| 83 | packaging.lol | - | 11 Jan 2025 | 11 Jan 2025 | 11 Jan 2026 |
| 84 | packaging.directory | Easyspace LTD | 19 Feb 2014 | 15 Feb 2025 | 19 Feb 2026 |
| 85 | packaging.wang | DNSPod, Inc. | 16 Mar 2024 | 16 Mar 2024 | 16 Mar 2025 |
| 86 | packaging.gift | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 87 | packaging.supply | Porkbun, LLC | 25 Jun 2014 | 29 Jun 2024 | 25 Jun 2025 |
| 88 | packaging.partners | Porkbun, LLC | 2 Feb 2023 | 6 Feb 2025 | 2 Feb 2026 |
| 89 | packaging.link | united-domains AG | 16 Jan 2021 | 22 Jan 2025 | 16 Jan 2026 |
| 90 | packaging.bid | NameCheap, Inc. | 11 Jun 2019 | 17 May 2024 | 11 Jun 2025 |
| 91 | packaging.trade | Go China Domains, LLC | 9 Jun 2014 | 5 Jun 2024 | 8 Jun 2026 |
| 92 | packaging.biz | Moniker Online Services LLC | 27 Mar 2002 | 24 Oct 2024 | 26 Mar 2025 |
| 93 | packaging.life | GoDaddy.com, LLC | 12 Aug 2016 | 26 Sep 2024 | 12 Aug 2025 |
| 94 | packaging.today | GoDaddy.com, LLC | 12 Aug 2016 | 26 Sep 2024 | 12 Aug 2025 |
| 95 | packaging.gallery | GoDaddy.com, LLC | 19 Aug 2016 | 29 Sep 2017 | 19 Aug 2017 |
| 96 | packaging.ink | NameCheap, Inc. | 6 Nov 2022 | 10 Nov 2024 | 6 Nov 2025 |
| 97 | packaging.com.br | - | 13 Mar 1998 | 17 Oct 2022 | 13 Mar 2025 |
| 98 | packaging.info | Fabulous.com Pty Ltd. | 16 Sep 2006 | 10 Oct 2024 | 16 Sep 2025 |
| 99 | packaging.net | GoDaddy.com, LLC | 3 Oct 1996 | 28 Oct 2024 | 2 Oct 2025 |
| 100 | packaging.org | GoDaddy.com, LLC | 3 Oct 1996 | 3 Jul 2024 | 2 Oct 2029 |
| 101 | packaging.xyz | Dynadot, LLC | 20 Jan 2019 | 7 May 2024 | 20 Jan 2029 |
| 102 | packaging.cat | Arsys Internet, S.L. dba NICLINE.COM | 1 Mar 2012 | 15 Apr 2024 | 1 Mar 2025 |
| 103 | packaging.club | - | 21 Jul 2017 | 7 Jan 2025 | 21 Jul 2025 |
| 104 | packaging.co | 1&1 Internet AG | 4 Nov 2013 | 9 Apr 2023 | 3 Nov 2025 |
| 105 | packaging.ch | - | - | - | - |
| 106 | packaging.cc | HiChina Zhicheng Technology Limited | 19 Jun 2002 | 16 Jun 2023 | 19 Jun 2025 |
| 107 | packaging.de | - | - | 18 Apr 2012 | - |
| 108 | packaging.dk | - | 9 Feb 2012 | - | 28 Feb 2018 |
| 109 | packaging.fr | - | 11 Apr 2005 | 21 Aug 2024 | 11 Apr 2025 |
| 110 | packaging.eu | EuroDNS S.A. | - | - | - |
| 111 | packaging.co.id | - | 17 Jun 2017 | - | 17 Jun 2025 |
| 112 | packaging.it | - | 18 Apr 1997 | 2 Nov 2024 | 17 Oct 2025 |
| 113 | packaging.kr | - | 12 Jul 2016 | 5 Jul 2017 | 12 Jul 2018 |
| 114 | packaging.org.nz | - | 16 Mar 1998 | 5 Nov 2024 | - |
| 115 | packaging.com.pl | - | 30 Sep 2024 | 5 Oct 2024 | 30 Sep 2025 |
| 116 | packaging.pl | - | 16 Apr 2022 | 21 Nov 2024 | 16 Apr 2025 |
| 117 | packaging.co.uk | - | - | 6 Aug 2024 | 7 Sep 2025 |
| 118 | packaging.ws | GoDaddy.com, LLC | 9 Nov 2010 | 10 Nov 2024 | 9 Nov 2026 |
| 119 | packaging.host | NameCheap, Inc. | 3 Sep 2016 | 16 Sep 2016 | 3 Sep 2017 |
| 120 | packaging.house | NameCheap, Inc. | 21 Feb 2023 | 3 May 2024 | 21 Feb 2024 |
| 121 | packaging.express | NameKing.com Inc. | 17 Dec 2022 | 30 Jan 2025 | 17 Dec 2024 |
| 122 | packaging.pizza | Porkbun, LLC | 9 Feb 2024 | 8 Feb 2025 | 9 Feb 2026 |
| 123 | packaging.foundation | Namesilo, LLC | 12 Jun 2017 | 27 Jul 2024 | 12 Jun 2025 |
| 124 | packaging.city | GoDaddy.com, LLC | 19 Oct 2024 | 24 Oct 2024 | 19 Oct 2025 |
| 125 | packaging.zone | Mesh Digital Limited | 4 Aug 2017 | 8 Aug 2024 | 4 Aug 2025 |
| 126 | packaging.mba | Namesilo, LLC | 3 Oct 2017 | 3 Oct 2017 | 3 Oct 2018 |
| 127 | packaging.me.uk | Crazy Domains FZ-LLC | 25 Sep 2011 | 25 Sep 2017 | 25 Sep 2018 |
| 128 | packaging.uk | - | 10 Jun 2014 | 16 Aug 2024 | 10 Jun 2025 |
| 129 | packaging.org.uk | - | 10 Feb 2024 | 26 Sep 2024 | 10 Feb 2025 |
| 130 | packaging.team | NameCheap, Inc. | 17 Oct 2024 | 20 Jan 2025 | 17 Oct 2026 |
| 131 | packaging.works | NameKing.com Inc. | 15 Feb 2025 | 28 Feb 2025 | 15 Feb 2026 |
| 132 | packaging.us | DNC Holdings, Inc. | 24 Apr 2002 | 14 Mar 2024 | 23 Apr 2025 |
| 133 | packaging.cool | NameCheap, Inc. | 17 Mar 2024 | 22 Mar 2024 | 17 Mar 2025 |
| 134 | packaging.plus | Gandi SAS | 23 Apr 2018 | 15 May 2024 | 23 Apr 2025 |
| 135 | packaging.amsterdam | Tucows Domains Inc. | 16 Nov 2018 | 16 Nov 2018 | 16 Nov 2019 |
| 136 | packaging.fail | GoDaddy.com, LLC | 21 Dec 2018 | 4 Feb 2020 | 21 Dec 2020 |
| 137 | packaging.media | Gandi SAS | 13 Jun 2024 | 18 Jun 2024 | 13 Jun 2025 |
| 138 | packaging.events | Namesilo, LLC | 20 Sep 2019 | 6 Sep 2024 | 20 Sep 2025 |
| 139 | packaging.wtf | Tucows Domains Inc. | 10 Oct 2019 | 14 Oct 2020 | 10 Oct 2021 |
| 140 | packaging.madrid | Arsys Internet, S.L. dba NICLINE.COM | 19 Feb 2020 | 4 Apr 2024 | 19 Feb 2025 |
| 141 | packaging.sucks | Rebel.com Corp. | 10 Jan 2019 | 24 Feb 2020 | 10 Jan 2021 |
| 142 | packaging.watch | GoDaddy.com, LLC | 8 Jul 2020 | 8 Jul 2020 | 8 Jul 2021 |
| 143 | packaging.institute | GoDaddy.com, LLC | 14 Jul 2020 | 13 Aug 2024 | 14 Jul 2024 |
| 144 | packaging.edeka | 1API GmbH | 22 May 2017 | 6 Jul 2024 | 22 May 2025 |
| 145 | packaging.delivery | Uniregistrar Corp | 18 Jul 2020 | 18 Jul 2020 | 18 Jul 2021 |
| 146 | packaging.asia | GoDaddy.com, LLC | 11 Jun 2008 | 6 Jun 2024 | 11 Jun 2025 |
| 147 | packaging.realty | Epik Inc. | 30 Sep 2020 | 15 Nov 2021 | 30 Sep 2022 |
| 148 | packaging.farm | GoDaddy.com, LLC | 2 Oct 2020 | 2 Oct 2020 | 2 Oct 2021 |
| 149 | packaging.vin | OVH sas | 3 Oct 2020 | 3 Oct 2020 | 3 Oct 2021 |
| 150 | packaging.ca | - | 1 Oct 2014 | 15 Nov 2024 | 1 Oct 2025 |
| 151 | packaging.contact | Porkbun, LLC | 4 Jan 2021 | 4 Jan 2021 | 4 Jan 2022 |
| 152 | packaging.tax | GoDaddy.com, LLC | 15 Jan 2021 | 15 Jan 2021 | 15 Jan 2022 |
| 153 | packaging.school | NameKing.com Inc. | 21 Oct 2024 | 26 Oct 2024 | 21 Oct 2025 |
| 154 | packaging.beauty | NameCheap, Inc. | 9 Aug 2022 | 19 Nov 2024 | 9 Aug 2025 |
| 155 | packaging.skin | NameCheap, Inc. | 24 Mar 2021 | 19 Nov 2024 | 24 Mar 2025 |
| 156 | packaging.university | register.com, Inc. | 30 Mar 2021 | 30 Mar 2021 | 30 Mar 2022 |
| 157 | packaging.art | Gandi SAS | 28 Jul 2021 | 7 Nov 2024 | 28 Jul 2025 |
| 158 | packaging.me | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Jul 2008 | 28 Nov 2024 | 9 Jul 2025 |
| 159 | packaging.makeup | GoDaddy.com, LLC | 26 Nov 2021 | 26 Nov 2021 | 26 Nov 2022 |
| 160 | packaging.shopping | DNSPod, Inc. | 11 Jan 2022 | 14 Jan 2025 | 11 Jan 2026 |
| 161 | packaging.promo | DNSPod, Inc. | 11 Jan 2022 | 12 Jan 2022 | 11 Jan 2023 |
| 162 | packaging.marketing | Google, Inc. | 6 Mar 2022 | 5 May 2023 | 6 Mar 2023 |
| 163 | packaging.coach | GoDaddy.com, LLC | 6 Apr 2022 | 5 Sep 2024 | 6 Apr 2025 |
| 164 | packaging.quest | NameCheap, Inc. | 9 Dec 2023 | 16 Dec 2024 | 9 Dec 2025 |
| 165 | packaging.ma | - | 20 Jul 2016 | 16 Jul 2024 | 20 Jul 2025 |
| 166 | packaging.uk.com | Webfusion Ltd. | 4 Sep 1997 | 10 Jun 2024 | 4 Sep 2025 |
| 167 | packaging.id | - | 17 Feb 2015 | 3 Apr 2022 | 17 Feb 2023 |
| 168 | packaging.luxury | DNC Holdings, Inc. | 31 Jul 2022 | 3 Jul 2024 | 31 Jul 2025 |
| 169 | packaging.place | Google, Inc. | 20 Aug 2022 | 20 Aug 2023 | 20 Aug 2024 |
| 170 | packaging.nl | - | 22 Dec 2008 | 18 Apr 2022 | - |
| 171 | packaging.blog | 1API GmbH | 15 Nov 2022 | 29 Dec 2022 | 15 Nov 2023 |
| 172 | packaging.exchange | NameCheap, Inc. | 10 Dec 2022 | 20 Feb 2025 | 10 Dec 2024 |
| 173 | packaging.vip | Namesilo, LLC | 1 Jul 2018 | 20 Jan 2024 | 1 Jul 2025 |
| 174 | packaging.ai | EuroDNS S.A. | - | - | - |
| 175 | packaging.berlin | Cronon AG | 18 Mar 2014 | 5 May 2023 | 18 Mar 2024 |
| 176 | packaging.app | GoDaddy.com, LLC | 8 May 2018 | 20 May 2023 | 8 May 2024 |
| 177 | packaging.beer | NameCheap, Inc. | 9 Feb 2022 | 24 Feb 2023 | 9 Feb 2023 |
| 178 | packaging.so | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 19 May 2011 | 9 Apr 2024 | 19 May 2025 |
| 179 | packaging.paris | OVH sas | 7 Feb 2020 | 6 Feb 2025 | 7 Feb 2026 |
| 180 | packaging.pe | - | - | - | - |
| 181 | packaging.day | NameCheap, Inc. | 6 Feb 2022 | 16 Nov 2024 | 6 Feb 2026 |
| 182 | packaging.social | Tucows Domains Inc. | 9 Feb 2023 | 13 Feb 2025 | 9 Feb 2026 |
| 183 | packaging.monster | GoDaddy.com, LLC | 28 Mar 2023 | 9 May 2024 | 28 Mar 2024 |
| 184 | packaging.cn | - | 8 May 2022 | - | 8 May 2026 |
| 185 | packaging.studio | Network Solutions, LLC | 2 Jan 2017 | 2 Jan 2024 | 2 Jan 2027 |
| 186 | packaging.consulting | Gandi SAS | 28 Jul 2021 | 28 Jul 2023 | 28 Jul 2024 |
| 187 | packaging.co.nz | - | 21 Aug 2004 | 3 Jul 2024 | - |
| 188 | packaging.sale | DNSPod, Inc. | 11 Jan 2022 | 11 Jan 2025 | 11 Jan 2026 |
| 189 | packaging.cl | - | 9 Sep 2010 | - | 7 Oct 2025 |
| 190 | packaging.co.ke | - | 23 Apr 2024 | 23 May 2024 | 23 Apr 2025 |
| 191 | packaging.hr | - | 30 Jun 2010 | 4 Apr 2012 | 30 Jun 2023 |
| 192 | packaging.ng | - | 6 Jul 2022 | 27 Jul 2023 | 6 Jul 2025 |
| 193 | packaging.vc | 1&1 Internet AG | 19 Dec 2006 | 2 Feb 2025 | 19 Dec 2025 |
| 194 | packaging.net.au | - | - | 28 Mar 2024 | - |
| 195 | packaging.earth | GoDaddy.com, LLC | 12 Jan 2020 | 13 Jan 2025 | 12 Jan 2026 |
| 196 | packaging.work | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jan 2018 | 13 Jan 2024 | 13 Jan 2024 |
| 197 | packaging.be | Key-Systems GmbH | 12 Dec 2000 | - | - |
| 198 | packaging.engineer | united-domains AG | 6 Jan 2021 | 6 Jan 2025 | 6 Jan 2026 |
| 199 | packaging.lt | - | 17 Nov 2022 | - | 18 Nov 2025 |
| 200 | packaging.kiwi | 101domain, Inc. | 23 May 2014 | 23 May 2023 | 23 May 2024 |
| 201 | packaging.com.ng | Upperlink Limited | 21 Sep 2018 | 28 Jan 2025 | 21 Sep 2026 |
| 202 | packaging.nz | - | 17 Aug 2022 | 1 Dec 2023 | - |
| 203 | packaging.co.jp | - | 31 Aug 2001 | 1 Sep 2024 | - |
| 204 | packaging.fun | Chengdu West Dimension Digital Technology Co., Ltd… | 1 Mar 2024 | 17 Mar 2024 | 1 Mar 2025 |
| 205 | packaging.ro | - | 4 Oct 2018 | - | 2 Oct 2025 |
| 206 | packaging.in | - | 2 May 2018 | 9 May 2022 | 2 May 2032 |
| 207 | packaging.com.au | - | - | 27 Sep 2024 | - |
| 208 | packaging.ie | - | 28 Mar 2021 | 19 Jan 2024 | 28 Mar 2025 |
| 209 | packaging.shop | Realtime Register B.V. | 24 Nov 2016 | 12 Nov 2022 | 24 Nov 2023 |
| 210 | packaging.la | - | 17 Jul 2008 | 11 Jul 2024 | 17 Jul 2025 |
| 211 | packaging.casa | NameKing.com Inc. | 24 Apr 2023 | 28 Apr 2024 | 24 Apr 2025 |
| 212 | packaging.amazon | Nom-iq Ltd. dba COM LAUDE | 9 May 2023 | 4 May 2024 | 9 May 2025 |
| 213 | packaging.chat | Chengdu West Dimension Digital Technology Co., Ltd… | 4 Nov 2024 | 21 Nov 2024 | 4 Nov 2025 |
| 214 | packaging.icu | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 12 Jul 2023 | 20 Aug 2024 | 12 Jul 2024 |
| 215 | packaging.africa | NameCheap, Inc. | 7 Mar 2025 | 7 Mar 2025 | 7 Mar 2026 |
| 216 | packaging.lat | NameCheap, Inc. | 4 Aug 2023 | 15 Oct 2024 | 4 Aug 2024 |
| 217 | packaging.cheap | Synergy Wholesale Pty Ltd | 22 Aug 2023 | 27 Aug 2024 | 22 Aug 2025 |
| 218 | packaging.im | - | - | - | - |
| 219 | packaging.bot | EnCirca, Inc. | 30 Oct 2023 | 2 Nov 2024 | 30 Oct 2025 |
| 220 | packaging.com.co | GoDaddy.com, LLC | 26 Sep 2011 | 10 Jun 2024 | 25 Sep 2025 |
| 221 | packaging.au | - | - | 20 Sep 2023 | - |
| 222 | packaging.jp | - | 21 Jan 2024 | 1 Feb 2025 | 31 Jan 2026 |
| 223 | packaging.ru | - | 10 Feb 1999 | - | 28 Feb 2026 |
| 224 | packaging.su | - | 5 Feb 2024 | - | 5 Feb 2026 |
| 225 | packaging.sk | - | 3 Feb 2010 | 23 Jan 2025 | 3 Feb 2026 |
| 226 | packaging.com.cn | - | 24 Dec 2011 | - | 24 Dec 2029 |
| 227 | packaging.bostik | Mailclub SAS | 19 Jul 2024 | 4 Dec 2024 | 19 Jul 2025 |
| 228 | packaging.cz | - | 17 Feb 1999 | 5 Mar 2010 | 7 Oct 2025 |
| 229 | packaging.deal | NameCheap, Inc. | 7 Oct 2024 | 7 Oct 2024 | 7 Oct 2025 |
| 230 | packaging.eu.com | NameSecure L.L.C. | 18 Oct 2008 | 3 Dec 2024 | 18 Oct 2025 |
| 231 | packaging.now | NameCheap, Inc. | 31 Oct 2024 | 31 Oct 2024 | 31 Oct 2025 |
| 232 | packaging.se | - | 25 Apr 2003 | 16 Mar 2024 | 25 Apr 2025 |
| 233 | packaging.gold | Porkbun, LLC | 27 Nov 2024 | 2 Dec 2024 | 27 Nov 2025 |
| 234 | packaging-gateway.com | Register.it SPA | 10 Jun 2005 | 17 May 2024 | 10 Jun 2025 |
| 235 | packagingconnections.com | Amazon Registrar, Inc. | 15 May 2006 | 16 Apr 2024 | 15 May 2026 |
| 236 | packagingnews.co.uk | - | 9 Dec 1997 | 10 Dec 2024 | 9 Dec 2025 |
| 237 | packagingprice.com | Amazon Registrar, Inc. | 15 Nov 1999 | 30 Apr 2024 | 15 Nov 2026 |
| 238 | packaging2buy.co.uk | - | 10 Jul 2007 | 6 Jul 2024 | 10 Jul 2025 |
| 239 | packagingdigest.com | SafeNames Ltd. | 11 Feb 1996 | 29 Feb 2024 | 12 Feb 2026 |
| 240 | packagingfirst.co.uk | - | 26 Aug 2004 | 19 Jul 2024 | 26 Aug 2025 |
| 241 | packagingstore24.com | RegistryGate GmbH | 6 Nov 2008 | 11 Dec 2024 | 6 Nov 2025 |
| 242 | packaging365.co.uk | - | 6 Oct 2019 | 6 Nov 2023 | 6 Oct 2024 |
| 243 | packagingsource.com | Network Solutions, LLC | 4 Mar 1999 | 13 Nov 2023 | 4 Dec 2028 |
| 244 | packaging-int.com | Dynadot, LLC | 26 Jul 2002 | 8 Oct 2024 | 26 Jul 2025 |
| 245 | packagingeurope.com | Register.it SPA | 26 Jun 2017 | 18 Mar 2022 | 18 Mar 2025 |
| 246 | packagingkosmetik.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 31 Oct 2022 | 31 Oct 2022 | 31 Oct 2023 |
| 247 | packagingonline.it | - | 11 May 2005 | 7 Jan 2025 | 22 Dec 2025 |
| 248 | packagingtape.com | CSC Corporate Domains, Inc. | 1 Apr 2004 | 27 Jan 2025 | 1 Apr 2025 |
| 249 | packaging-labelling.com | Google, Inc. | 11 Mar 2008 | 3 Jun 2024 | 11 Mar 2028 |
| 250 | packaginghub.in | GoDaddy.com, LLC | 8 Jun 2021 | 19 Jun 2023 | 8 Jun 2025 |
| 251 | packaging-leaders.com | NameCheap, Inc. | 6 Oct 2022 | 17 Nov 2023 | 6 Oct 2023 |
| 252 | packagingarena.co.uk | - | 24 Mar 2010 | 8 Jul 2015 | 24 Mar 2019 |
| 253 | packagingdirect.com.au | - | - | 5 Jul 2024 | - |
| 254 | packagingexpress.co.uk | - | 1 Sep 2009 | 25 Jun 2024 | 1 Sep 2025 |
| 255 | packagingfinder.net | Amazon Registrar, Inc. | 5 Dec 2008 | 25 Apr 2024 | 5 Dec 2026 |
| 256 | packagingoftheworld.com | GoDaddy.com, LLC | 13 Aug 2009 | 29 Aug 2024 | 13 Aug 2025 |
| 257 | packagingoptionsdirect.com | GoDaddy.com, LLC | 10 Apr 2012 | 11 Apr 2024 | 10 Apr 2025 |
| 258 | packagingplace.com.au | - | - | 30 May 2024 | - |
| 259 | packagingserved.com | register.com, Inc. | 28 Oct 2008 | 10 Dec 2024 | 28 Oct 2025 |
| 260 | packagingsupplies.com | Wild West Domains, LLC | 27 Jun 1998 | 26 Jun 2024 | 26 Jun 2025 |
| 261 | packagingwholesalers.com | Amazon Registrar, Inc. | 7 Nov 2005 | 6 May 2024 | 7 Nov 2025 |
| 262 | packagingmachineryuk.com | Register.it SPA | 22 Oct 2014 | 19 Sep 2016 | 22 Oct 2018 |
| 263 | packagingdost.com | BigRock Solutions Ltd. | 14 Mar 2016 | 14 Mar 2017 | 14 Mar 2018 |
| 264 | packagingfocus.com | TurnCommerce, Inc. DBA NameBright.com | 30 Nov 2022 | 16 Mar 2024 | 30 Nov 2024 |
| 265 | packaging4jewelers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Oct 2014 | 23 Oct 2014 | 23 Oct 2015 |
| 266 | packaging-storage.com | DotArai Co., Ltd. | 20 Nov 2012 | 6 Nov 2024 | 20 Nov 2025 |
| 267 | packagingoftheworld.net | eNom, Inc. | 26 Jul 2013 | 16 Jul 2024 | 26 Jul 2025 |
| 268 | packagingone.biz | Tucows Domains Inc. | 24 Oct 2014 | 27 Oct 2021 | 23 Oct 2021 |
| 269 | packagingconsult.biz | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 23 Oct 2015 |
| 270 | packagingblog.org | GoDaddy.com, LLC | 2 Jul 2013 | 1 Jul 2024 | 2 Jul 2025 |
| 271 | packagingcircus.com | RegistryGate GmbH | 2 Mar 2013 | 3 Mar 2024 | 2 Mar 2025 |
| 272 | packaging-business-review.com | Register.it SPA | 13 Jul 2010 | 7 Jun 2024 | 13 Jul 2025 |
| 273 | packagingsource.co.za | Server-Service GmbH | 17 Dec 2008 | - | - |
| 274 | packagingdiscuss.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 275 | packagingconsultsolutions.com | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 276 | packagingconsultgroup.com | GoDaddy.com, LLC | 24 Oct 2014 | 2 Oct 2016 | 24 Oct 2017 |
| 277 | packagingchat.com | TurnCommerce, Inc. DBA NameBright.com | 11 Jan 2016 | 10 Feb 2025 | 11 Jan 2025 |
| 278 | packagingnews.com.au | - | - | 20 Feb 2024 | - |
| 279 | packagingcorp.com | Network Solutions, LLC | 29 Mar 1999 | 10 Jul 2020 | 29 Mar 2026 |
| 280 | packagingcovenant.org.au | - | - | 31 Jan 2025 | - |
| 281 | packagingsachet.com | eNom, Inc. | 6 Sep 2013 | 30 Oct 2016 | 6 Sep 2017 |
| 282 | packagingone.info | Tucows Domains Inc. | 24 Oct 2014 | 25 Sep 2017 | 24 Oct 2018 |
| 283 | packagingconsultgroup.info | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 284 | packagingconsult.info | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 285 | packagingchat.info | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 286 | packagingsupplysuperstore.com | GoDaddy.com, LLC | 26 May 2010 | 27 May 2015 | 26 May 2016 |
| 287 | packagingsuppliessuperstore.com | GoDaddy.com, LLC | 26 May 2010 | 27 May 2015 | 26 May 2016 |
| 288 | packagingace.com | GoDaddy.com, LLC | 25 Oct 2014 | 30 Aug 2024 | 25 Oct 2025 |
| 289 | packaginguqam.com | Wild West Domains, LLC | 27 May 2010 | 28 May 2015 | 27 May 2016 |
| 290 | packagingl.com | GoDaddy.com, LLC | 27 May 2013 | 28 May 2015 | 27 May 2016 |
| 291 | packagingone.us | Tucows Domains Inc. | 24 Oct 2014 | 23 Jan 2018 | 23 Oct 2018 |
| 292 | packagingone.org | Tucows Domains Inc. | 24 Oct 2014 | 25 Sep 2017 | 24 Oct 2018 |
| 293 | packagingone.net | Tucows Domains Inc. | 26 Sep 2024 | 13 Oct 2024 | 26 Sep 2025 |
| 294 | packagingconsultsolutions.net | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 295 | packagingconsultgroup.org | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 296 | packagingconsultgroup.net | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 297 | packagingconsult.org | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 298 | packagingconsult.net | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 299 | packagingchat.org | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 300 | packagingchat.net | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 301 | packagingace.net | GoDaddy.com, LLC | 25 Oct 2014 | 26 Oct 2016 | 25 Oct 2017 |
| 302 | packagingdesign.biz | GoDaddy.com, LLC | 2 Jun 2008 | 2 Jun 2014 | 1 Jun 2015 |
| 303 | packagingspecialties.org | - | - | - | - |
| 304 | packagingconnection.org | GoDaddy.com, LLC | 2 Jun 2014 | 14 Jun 2015 | 2 Jun 2016 |
| 305 | packagingiberica.com | Network Solutions, LLC | 26 Oct 2014 | 8 Dec 2017 | 26 Oct 2017 |
| 306 | packaging-matters.org | - | - | - | - |
| 307 | packagingmatters.org | GoDaddy.com, LLC | 6 Mar 2021 | 9 Aug 2024 | 6 Mar 2025 |
| 308 | packaging-mfg.com | GoDaddy.com, LLC | 22 May 2013 | 23 May 2015 | 22 May 2016 |
| 309 | packagingawards.com | TurnCommerce, Inc. DBA NameBright.com | 19 Jan 2017 | 13 Feb 2025 | 19 Jan 2025 |
| 310 | packagingrevolution.com | eNom, Inc. | 20 Jul 2010 | 22 Jul 2024 | 20 Jul 2025 |
| 311 | packagingshippingservices.com | eNom, Inc. | 16 Apr 2011 | 17 Apr 2024 | 16 Apr 2025 |
| 312 | packaging123.com | GoDaddy.com, LLC | 25 Dec 2005 | 9 May 2024 | 5 May 2026 |
| 313 | packagingassociates.net | GoDaddy.com, LLC | 6 Mar 2009 | 19 Apr 2015 | 6 Mar 2016 |
| 314 | packagingconcepts.net | Go Australia Domains, LLC | 16 Apr 2011 | 31 May 2024 | 16 Apr 2026 |
| 315 | packaging-forum.com | Soluciones Corporativas IP, SLU | 28 Oct 2014 | 28 Oct 2014 | 28 Oct 2015 |
| 316 | packagingmachinerynews.com | Network Solutions, LLC | 28 Jul 2021 | 29 May 2024 | 28 Jul 2025 |
| 317 | packagingdesignconsultants.com | eNom, Inc. | 23 Dec 2012 | 21 Dec 2016 | 23 Dec 2017 |
| 318 | packagingdistribution.com | eNom, Inc. | 8 Jan 2013 | 18 Jan 2025 | 8 Jan 2026 |
| 319 | packagingdesign.us | Uniregistrar Corp | 6 Oct 2016 | 22 Feb 2017 | 5 Oct 2017 |
| 320 | packagingengineerjobs.com | GoDaddy.com, LLC | 6 May 2009 | 9 Jan 2025 | 6 May 2025 |
| 321 | packagingmaterials.us | GoDaddy.com, LLC | 6 Nov 2007 | 19 Dec 2014 | 5 Nov 2016 |
| 322 | packaging-forum.org | Soluciones Corporativas IP, SLU | 28 Oct 2014 | - | 28 Oct 2015 |
| 323 | packagingpouches.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jan 2007 | 23 Nov 2024 | 2 Jan 2026 |
| 324 | packagingwaste.com | TurnCommerce, Inc. DBA NameBright.com | 4 Oct 2004 | 31 Jan 2025 | 2 Jan 2026 |
| 325 | packagingworks.com | eNom, Inc. | 21 Nov 2008 | 22 Nov 2024 | 21 Nov 2025 |
| 326 | packaging-day.com | Estrategias WebSite S.L. | 30 Oct 2014 | 17 Sep 2024 | 30 Oct 2025 |
| 327 | packagingmadrid.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 29 Oct 2014 | 24 Oct 2016 | 29 Oct 2017 |
| 328 | packaginghemp.info | GoDaddy.com, LLC | 30 Oct 2014 | 14 Dec 2024 | 30 Oct 2025 |
| 329 | packagingconsultants.co | GoDaddy.com, LLC | 25 Jul 2010 | 31 Jul 2016 | 24 Jul 2017 |
| 330 | packagingandfulfillment.com | GoDaddy.com, LLC | 2 Dec 2007 | 27 Nov 2024 | 2 Dec 2025 |
| 331 | packagingstoretraversecity.com | eNom, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 332 | packaging-luxe-paris.com | Online SAS | 31 Oct 2014 | 25 Oct 2024 | 31 Oct 2025 |
| 333 | packaging-tapes-and-boxes.com | GoDaddy.com, LLC | 29 Mar 2011 | 28 Sep 2012 | 29 Mar 2017 |
| 334 | packagingsuppliers.co | GoDaddy.com, LLC | 15 Jun 2011 | 20 Jun 2015 | 14 Jun 2015 |
| 335 | packagingserved.net | register.com, Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2018 |
| 336 | packaginghemp.net | GoDaddy.com, LLC | 30 Oct 2014 | 31 Oct 2024 | 30 Oct 2025 |
| 337 | packagingsense.com | DROPCATCH.COM 786 LLC | 27 Feb 2022 | 28 Feb 2025 | 27 Feb 2025 |
| 338 | packagingplusllc.com | Tucows Domains Inc. | 10 Nov 2024 | 10 Nov 2024 | 10 Nov 2025 |
| 339 | packagingconnection.biz | GoDaddy.com, LLC | 1 Nov 2014 | 6 Nov 2024 | 31 Oct 2025 |
| 340 | packagingalternatives.com | Network Solutions, LLC | 6 Nov 2000 | 26 Jul 2021 | 6 Nov 2026 |
| 341 | packaginghotline.com | TurnCommerce, Inc. DBA NameBright.com | 10 Dec 1999 | 30 Aug 2022 | 10 Dec 2024 |
| 342 | packagingsupply.org | Wild West Domains, LLC | 6 Aug 2016 | 17 Sep 2017 | 6 Aug 2018 |
| 343 | packagingdesigncenter.net | GoDaddy.com, LLC | 31 Oct 2014 | 1 Nov 2024 | 31 Oct 2025 |
| 344 | packagingrecruiting.com | GoDaddy.com, LLC | 25 Mar 2017 | 27 Oct 2022 | 25 Mar 2027 |
| 345 | packaginginfoamericas.com | Mesh Digital Limited | 23 Jun 2012 | 10 Jul 2015 | 23 Jun 2016 |
| 346 | packaginginfoasia.org | Mesh Digital Limited | 23 Jun 2012 | 10 Jul 2015 | 23 Jun 2016 |
| 347 | packaginginfosouthamerica.com | Mesh Digital Limited | 23 Jun 2012 | 10 Jul 2015 | 23 Jun 2016 |
| 348 | packaginginfoamerica.com | Mesh Digital Limited | 23 Jun 2012 | 10 Jul 2015 | 23 Jun 2016 |
| 349 | packagingcarton.com | GoDaddy.com, LLC | 26 Jun 2015 | 2 Jul 2024 | 26 Jun 2025 |
| 350 | packagingconnection.mobi | GoDaddy.com, LLC | 1 Nov 2014 | 16 Dec 2024 | 1 Nov 2025 |
| 351 | packagingconnection.info | GoDaddy.com, LLC | 1 Nov 2014 | 16 Dec 2024 | 1 Nov 2025 |
| 352 | packaginggal.com | GoDaddy.com, LLC | 8 Jun 2014 | 9 Jun 2015 | 8 Jun 2016 |
| 353 | packagingfedn.co.uk | - | 2 Feb 2000 | 19 Jan 2016 | 2 Feb 2018 |
| 354 | packagingconnection.us | GoDaddy.com, LLC | 1 Nov 2014 | 6 Nov 2017 | 31 Oct 2018 |
| 355 | packaginghandles.com | GoDaddy.com, LLC | 20 Mar 2007 | 27 Feb 2024 | 20 Mar 2025 |
| 356 | packaging-equipment-supplies.com | GMO Internet Inc. | 3 Nov 2014 | 4 Nov 2014 | 3 Nov 2015 |
| 357 | packagingrevolution.net | GoDaddy.com, LLC | 15 Sep 2009 | 15 Sep 2024 | 15 Sep 2025 |
| 358 | packaging-tapeinc.com | Tucows Domains Inc. | 14 Aug 2008 | 17 Aug 2014 | 14 Aug 2015 |
| 359 | packagingwala.com | GoDaddy.com, LLC | 28 Jul 2024 | 14 Feb 2025 | 28 Jul 2025 |
| 360 | packagingassist.com | GoDaddy.com, LLC | 8 May 2020 | 10 Dec 2024 | 8 May 2025 |
| 361 | packagingandlabel.com | Limited Liability Company "Registrar of domain nam… | 16 Jan 2021 | 4 Jan 2025 | 16 Jan 2026 |
| 362 | packagingplusservices.net | GMO Internet Inc. | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 363 | packagingsolution.biz | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 17 Aug 2015 |
| 364 | packagingsolution.us | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 17 Aug 2015 |
| 365 | packagingtoolrepair.com | GoDaddy.com, LLC | 18 Aug 2014 | 16 Aug 2016 | 18 Aug 2017 |
| 366 | packaging0086.com | Namesilo, LLC | 13 Nov 2019 | 14 Nov 2019 | 13 Nov 2020 |
| 367 | packagingelevated.com | TurnCommerce, Inc. DBA NameBright.com | 9 Nov 2017 | 19 Dec 2024 | 9 Nov 2024 |
| 368 | packagingflorida.com | GoDaddy.com, LLC | 16 Dec 2022 | 17 Dec 2024 | 16 Dec 2025 |
| 369 | packaginginnovationsupdate.com | 1API GmbH | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 370 | packagingelevated.biz | FastDomain Inc. | 19 Aug 2014 | 20 Aug 2017 | 18 Aug 2017 |
| 371 | packagingelevated.info | FastDomain Inc. | 19 Aug 2014 | 19 Aug 2016 | 19 Aug 2017 |
| 372 | packagingmachineryindia.com | Tucows Domains Inc. | 20 Aug 2014 | 2 Dec 2024 | 20 Aug 2028 |
| 373 | packagingmarketing.com | TurnCommerce, Inc. DBA NameBright.com | 28 Sep 2011 | 22 Sep 2020 | 28 Sep 2025 |
| 374 | packagingpart.com | GoDaddy.com, LLC | 6 Nov 2014 | 7 Nov 2024 | 6 Nov 2026 |
| 375 | packagingnavigator.com | GoDaddy.com, LLC | 12 Jan 2015 | 12 Jan 2015 | 12 Jan 2016 |
| 376 | packaging9.com | Dynadot, LLC | 12 Apr 2019 | 12 Apr 2019 | 12 Apr 2020 |
| 377 | packagingpocketknife.com | NamePal.com, LLC | 21 Aug 2014 | 21 Aug 2014 | 21 Aug 2015 |
| 378 | packaginghelp.net | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 379 | packaginghelp.info | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 380 | packagingexpert.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Oct 2024 | 14 Dec 2024 | 14 Oct 2025 |
| 381 | packagingexpert.info | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 382 | packagingadvisor.net | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 383 | packagingadvisor.info | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 384 | packagingandfinishing.com | GoDaddy.com, LLC | 6 Feb 2015 | 19 Sep 2022 | 6 Feb 2027 |
| 385 | packagingdesigners.com | Annulet LLC | 3 Feb 2000 | 19 Aug 2024 | 3 Feb 2025 |
| 386 | packagingsurveys.com | Net 4 India Limited | 7 Nov 2014 | 8 Nov 2016 | 7 Nov 2017 |
| 387 | packagingsupplies4less.com | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2024 | 8 Nov 2025 |
| 388 | packagingmasters.com | GoDaddy.com, LLC | 25 May 2020 | 19 Nov 2024 | 25 May 2025 |
| 389 | packagingcosts.com | Dynadot, LLC | 7 Nov 2014 | 7 Nov 2014 | 7 Nov 2015 |
| 390 | packagingresearchlaboratory.com | GoDaddy.com, LLC | 22 Aug 2014 | 22 Aug 2014 | 22 Aug 2016 |
| 391 | packaginghelp.org | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 392 | packagingexpert.org | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 393 | packagingadvisor.org | GoDaddy.com, LLC | 6 Nov 2014 | 6 Nov 2014 | 6 Nov 2015 |
| 394 | packaging-santa-fe-springs.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 395 | packagingnashville.com | GoDaddy.com, LLC | 24 Aug 2014 | 25 Aug 2024 | 24 Aug 2025 |
| 396 | packagingodyssey.com | GoDaddy.com, LLC | 24 Aug 2014 | 24 Aug 2014 | 24 Aug 2015 |
| 397 | packagingset.com | GoDaddy.com, LLC | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 398 | packaging2yourdoor.com | GoDaddy.com, LLC | 5 Nov 2020 | 5 Nov 2020 | 5 Nov 2021 |
| 399 | packagingfood.org | GoDaddy.com, LLC | 7 Nov 2014 | 30 Oct 2016 | 7 Nov 2017 |
| 400 | packagingprocessingoem.com | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2016 |
| 401 | packagingprocessing.com | TurnCommerce, Inc. DBA NameBright.com | 24 Nov 2020 | 26 Aug 2021 | 24 Nov 2025 |
| 402 | packagingdaybarcelona.com | GMO Internet Inc. | 9 Nov 2014 | 10 Nov 2014 | 9 Nov 2015 |
| 403 | packagingandprocessingoem.com | GoDaddy.com, LLC | 10 Nov 2014 | 19 Apr 2015 | 10 Nov 2018 |
| 404 | packaging-video.com | eNom, Inc. | 26 Aug 2014 | 28 Jul 2016 | 26 Aug 2017 |
| 405 | packagingbox.org | Tucows Domains Inc. | 6 Oct 2022 | 11 Oct 2024 | 6 Oct 2025 |
| 406 | packaginggraphic.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 21 Feb 2023 | 30 Mar 2024 | 21 Feb 2024 |
| 407 | packagingsupplies4less.us | GoDaddy.com, LLC | 8 Nov 2014 | 13 Nov 2017 | 7 Nov 2018 |
| 408 | packagingandequipment.com | GoDaddy.com, LLC | 14 Aug 2014 | 26 Aug 2024 | 14 Aug 2025 |
| 409 | packaginginformationhq.com | FastDomain Inc. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 410 | packagingdiscussion.com | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 411 | packagingconsultation.com | GoDaddy.com, LLC | 11 Nov 2014 | 10 Jul 2024 | 11 Nov 2025 |
| 412 | packaginganalysis.com | GoDaddy.com, LLC | 11 Nov 2014 | 10 Jul 2024 | 11 Nov 2025 |
| 413 | packagingmachineryaffiliates.com | Network Solutions, LLC | 15 Aug 2014 | 16 Jun 2024 | 15 Aug 2029 |
| 414 | packagingmaterialsupplies.com | GoDaddy.com, LLC | 28 Aug 2014 | 29 Aug 2024 | 28 Aug 2026 |
| 415 | packagingsourcecorp.com | Launchpad, Inc. | 28 Aug 2014 | 29 Nov 2024 | 28 Aug 2025 |
| 416 | packagingandlabelling.com | Google, Inc. | 28 Oct 2022 | 29 Oct 2023 | 28 Oct 2024 |
| 417 | packagingdirectireland.com | GoDaddy.com, LLC | 16 Aug 2014 | 16 Aug 2014 | 16 Aug 2015 |
| 418 | packaginglabeling.com | Squarespace Domains LLC | 23 Mar 2021 | - | 23 Mar 2022 |
| 419 | packaginganswers.info | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 420 | packaging-appel-offre.com | Online SAS | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 421 | packagingsupport.net | Google, Inc. | 10 Nov 2014 | 26 Oct 2024 | 10 Nov 2025 |
| 422 | packaginganswers.net | GoDaddy.com, LLC | 11 Nov 2014 | 11 Nov 2014 | 11 Nov 2015 |
| 423 | packagingstoreglendale.com | eNom, Inc. | 11 Sep 2014 | 11 Sep 2014 | 11 Sep 2015 |
| 424 | packaginghawaii.com | DomainLocal LLC | 13 Nov 2014 | 14 Nov 2017 | 13 Nov 2018 |
| 425 | packagingforyou.com | GoDaddy.com, LLC | 6 Jan 2024 | 6 Jan 2025 | 6 Jan 2026 |
| 426 | packagingengineeringstore.com | Network Solutions, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2015 |
| 427 | packagingfair.net | Key-Systems GmbH | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 428 | packagingfairs.com | GoDaddy.com, LLC | 19 Apr 2020 | 19 Apr 2020 | 19 Apr 2021 |
| 429 | packagingfairs.net | Key-Systems GmbH | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2015 |
| 430 | packagingplastikmakanan.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Aug 2014 | 29 Aug 2017 | 30 Aug 2018 |
| 431 | packaging-laboratories.com | Launchpad, Inc. | 27 Aug 2015 | 29 Oct 2016 | 27 Aug 2017 |
| 432 | packagingconnected.com | GoDaddy.com, LLC | 13 Sep 2014 | 14 Sep 2024 | 13 Sep 2025 |
| 433 | packaging-pallet.com | Tucows Domains Inc. | 11 Nov 2008 | 22 Dec 2024 | 11 Nov 2024 |
| 434 | packagingtransformation.com | GoDaddy.com, LLC | 14 Sep 2014 | 14 Sep 2014 | 14 Sep 2015 |
| 435 | packagingtech.net | 1&1 Internet AG | 1 Aug 2017 | 20 Aug 2022 | 1 Aug 2025 |
| 436 | packagingbest.com | Namesilo, LLC | 13 Jul 2020 | 12 Jan 2025 | 13 Jul 2025 |
| 437 | packagingforretail.com | GoDaddy.com, LLC | 30 Aug 2007 | 29 Aug 2024 | 30 Aug 2025 |
| 438 | packagingofdistinction.com | GoDaddy.com, LLC | 30 Aug 2007 | 22 Sep 2014 | 30 Aug 2019 |
| 439 | packagingstoreak.com | eNom, Inc. | 14 Jun 2016 | 6 Jun 2017 | 14 Jun 2018 |
| 440 | packagingplanet.com | Domain.com, LLC | 15 Nov 2014 | 31 Oct 2024 | 15 Nov 2025 |
| 441 | packagingmaterialdelhi.com | Wild West Domains, LLC | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 442 | packaging-representatives.com | GoDaddy.com, LLC | 15 Nov 2014 | 6 Oct 2015 | 15 Nov 2017 |
| 443 | packagingradar.net | Soluciones Corporativas IP, SLU | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 444 | packagingmachinery.us | FastDomain Inc. | 14 Nov 2014 | 14 Nov 2016 | 13 Nov 2017 |
| 445 | packagingfastfood.com | OVH sas | 29 Sep 2017 | 9 Oct 2018 | 29 Sep 2019 |
| 446 | packagingantalis.com | Top Tier Domains LLC | 7 Dec 2016 | 8 Dec 2016 | 7 Dec 2017 |
| 447 | packagingandprintingcompany.com | GoDaddy.com, LLC | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2016 |
| 448 | packagingn.com | register.com, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 449 | packagingplatform.com | Azdomainz LLC | 10 Oct 2018 | 25 Nov 2024 | 10 Oct 2025 |
| 450 | packagingboxmanufacturers.com | GoDaddy.com, LLC | 23 Jun 2020 | 4 Jan 2024 | 23 Jun 2025 |
| 451 | packagingbyalex.com | Launchpad, Inc. | 8 Sep 2014 | 8 Sep 2014 | 8 Sep 2015 |
| 452 | packagingnapoli.com | DropCatch.com 1390 LLC | 26 Jan 2017 | 28 Jan 2017 | 26 Jan 2018 |
| 453 | packagingnapoli.biz | Register.it SPA | 18 Nov 2014 | - | 17 Nov 2015 |
| 454 | packagingnapoli.info | Register.it SPA | 18 Nov 2014 | - | 18 Nov 2015 |
| 455 | packagingcareers.net | Namesilo, LLC | 28 Aug 2013 | 9 Sep 2014 | 28 Aug 2015 |
| 456 | packagingproviders.com | Network Solutions, LLC | 3 Oct 2014 | 4 Aug 2020 | 3 Oct 2025 |
| 457 | packagingculture.com | Network Solutions, LLC | 28 Oct 2023 | 29 Oct 2024 | 28 Oct 2025 |
| 458 | packaginglearning.com | NameTurn LLC | 26 Sep 2013 | 27 Sep 2017 | 26 Sep 2018 |
| 459 | packagingprintingnewyorkcity.com | GoDaddy.com, LLC | 8 Aug 2013 | 9 Jul 2016 | 8 Aug 2018 |
| 460 | packagingprintingnyc.com | GoDaddy.com, LLC | 8 Aug 2013 | 9 Jul 2016 | 8 Aug 2017 |
| 461 | packagingnapoli.org | Register.it SPA | 18 Nov 2014 | - | 18 Nov 2015 |
| 462 | packagingnapoli.net | Register.it SPA | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 463 | packaginginuae.com | GoDaddy.com, LLC | 7 Jun 2020 | 7 Jun 2020 | 7 Jun 2021 |
| 464 | packagingfeedback.com | GoDaddy.com, LLC | 22 Sep 2014 | 13 Aug 2024 | 20 Aug 2025 |
| 465 | packagingmachineriesinchennai.com | Infocom Network Ltd. | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 466 | packagingindustries.net | Tucows Domains Inc. | 19 Nov 2014 | 24 Nov 2017 | 19 Nov 2017 |
| 467 | packaging4u.com | DropCatch.com 410 LLC | 20 Nov 2014 | 19 Dec 2024 | 20 Nov 2025 |
| 468 | packaging-analytics.com | GoDaddy.com, LLC | 5 Oct 2014 | 6 Sep 2016 | 5 Oct 2018 |
| 469 | packaging-supplies.us | GoDaddy.com, LLC | 5 Oct 2014 | 10 Oct 2017 | 4 Oct 2018 |
| 470 | packaging-by-nature.com | CSC Corporate Domains, Inc. | 23 Sep 2014 | 26 Aug 2024 | 23 Sep 2025 |
| 471 | packaging-boxes.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 15 Jun 2023 | 14 Jun 2024 | 15 Jun 2025 |
| 472 | packagingprogram.com | Network Solutions, LLC | 21 Nov 2014 | 22 Sep 2024 | 21 Nov 2025 |
| 473 | packaging-boxes.us | GoDaddy.com, LLC | 7 Oct 2014 | 12 Oct 2017 | 6 Oct 2018 |
| 474 | packagingboxes.us | GoDaddy.com, LLC | 7 Oct 2014 | 12 Oct 2017 | 6 Oct 2018 |
| 475 | packagingheroes.com | NameCheap, Inc. | 9 Jun 2020 | 10 May 2024 | 9 Jun 2025 |
| 476 | packagingmachinepartstoolbox.com | GoDaddy.com, LLC | 7 Oct 2014 | 8 Oct 2024 | 7 Oct 2025 |
| 477 | packagingspecialistsllc.us | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Oct 2014 | 7 Oct 2014 | 6 Oct 2015 |
| 478 | packagingwholesalers.us | GoDaddy.com, LLC | 7 Oct 2014 | 12 Oct 2024 | 6 Oct 2025 |
| 479 | packagingbynature.com | CSC Corporate Domains, Inc. | 24 Sep 2014 | 26 Aug 2024 | 24 Sep 2025 |
| 480 | packagingwebsites.com | NameCheap, Inc. | 1 Nov 2024 | 8 Nov 2024 | 1 Nov 2025 |
| 481 | packagingahora.com | 1&1 Internet AG | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2015 |
| 482 | packagingwholesalersdistributorwebsite.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2016 |
| 483 | packagingconfezioniabbigliamento.com | NetEarth One Inc. d/b/a NetEarth | 24 Sep 2014 | 12 Nov 2024 | 24 Sep 2025 |
| 484 | packagingfilmsresources.com | GoDaddy.com, LLC | 24 Sep 2014 | 24 Sep 2014 | 24 Sep 2016 |
| 485 | packagingwholesalerscatalogwebsite.com | GoDaddy.com, LLC | 24 Sep 2014 | 15 Sep 2016 | 24 Sep 2017 |
| 486 | packagingwholesalerswebsite.com | GoDaddy.com, LLC | 24 Sep 2014 | 15 Sep 2016 | 24 Sep 2017 |
| 487 | packagingsupplies.us | GoDaddy.com, LLC | 27 Sep 2014 | 28 Sep 2024 | 26 Sep 2025 |
| 488 | packagingimpressions.com | GoDaddy.com, LLC | 8 Oct 2014 | 8 Oct 2024 | 8 Oct 2027 |
| 489 | packagingwasteforum.com | SafeNames Ltd. | 8 Oct 2014 | 9 Oct 2024 | 8 Oct 2025 |
| 490 | packagingwerks.com | GoDaddy.com, LLC | 29 Sep 2014 | 29 Sep 2014 | 29 Sep 2015 |
| 491 | packagingdr.com | Tucows Domains Inc. | 30 Sep 2014 | 4 Oct 2018 | 30 Sep 2018 |
| 492 | packagingspecialistsllc.com | DropCatch.com 415 LLC | 16 Oct 2014 | 17 Oct 2017 | 16 Oct 2018 |
| 493 | packagingsol.com | Wild West Domains, LLC | 16 Oct 2014 | 17 Oct 2024 | 16 Oct 2025 |
| 494 | packagingsociety.com | DotArai Co., Ltd. | 12 Oct 2014 | 31 Aug 2023 | 12 Oct 2026 |
| 495 | packagingodor.com | GoDaddy.com, LLC | 25 Sep 2014 | 25 Sep 2014 | 25 Sep 2015 |
| 496 | packaging-eu.com | GoDaddy.com, LLC | 27 Sep 2014 | 11 Sep 2024 | 27 Sep 2025 |
| 497 | packaging-cn.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 19 Jan 2025 | 19 Jan 2025 | 19 Jan 2026 |
| 498 | packaging-asean.com | GoDaddy.com, LLC | 27 Sep 2014 | 8 Aug 2016 | 27 Sep 2017 |
| 499 | packaginginternational.com | Annulet LLC | 25 Apr 2015 | 12 Jun 2024 | 25 Apr 2025 |
| 500 | packagingtapeexpress.com | eNom, Inc. | 24 Nov 2014 | 23 Nov 2024 | 24 Nov 2025 |
| 501 | packagingmobi.com | Name.com, Inc. | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 502 | packagingpro.biz | Wild West Domains, LLC | 13 Oct 2014 | 21 Sep 2024 | 12 Oct 2025 |
| 503 | packagingstorealameda.com | eNom, Inc. | 17 Oct 2014 | 17 Oct 2014 | 17 Oct 2015 |
| 504 | packagingdesigndubai.com | Tucows Domains Inc. | 14 Oct 2009 | 18 Oct 2014 | 14 Oct 2015 |
| 505 | packagingsolutionstx.com | register.com, Inc. | 25 Nov 2014 | 26 Nov 2024 | 25 Nov 2025 |
| 506 | packagingfilmsrecource.com | GoDaddy.com, LLC | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 507 | packagingfilmresource.com | GoDaddy.com, LLC | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 508 | packaginganddesign.biz | Key-Systems GmbH | 15 Oct 2014 | 24 Apr 2016 | 14 Oct 2025 |
| 509 | packaginganddesign.org | Key-Systems GmbH | 15 Oct 2014 | 7 Jun 2022 | 15 Oct 2025 |
| 510 | packagingbagswholesale.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 25 May 2023 | 30 Nov 2024 | 25 May 2025 |
| 511 | packagingnewslatam.com | GoDaddy.com, LLC | 29 Nov 2014 | 4 Jun 2024 | 3 Jun 2025 |
| 512 | packaginghorror.com | Wild West Domains, LLC | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 513 | packaging-jngp.com | GoDaddy.com, LLC | 29 Nov 2014 | 29 Nov 2014 | 29 Nov 2015 |
| 514 | packagingbologna.com | Tucows Domains Inc. | 28 Apr 2022 | 21 Apr 2024 | 28 Apr 2025 |
| 515 | packagingrepresentatives.com | FastDomain Inc. | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 516 | packaging-labellingasia.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2016 |
| 517 | packagingcompliancelabs.com | GoDaddy.com, LLC | 4 Dec 2014 | 5 Dec 2024 | 4 Dec 2026 |
| 518 | packagingplan.com | Annulet LLC | 11 Nov 2017 | 29 Dec 2024 | 11 Nov 2025 |
| 519 | packaging-donckers.info | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 520 | packagingdesignservices.com | Dynadot, LLC | 4 Jul 2017 | 5 Jul 2024 | 4 Jul 2025 |
| 521 | packagingsuppliesbymailbeta.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2024 | 10 Dec 2025 |
| 522 | packagingsuppliesandshippingsupplies.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 523 | packagingmaterialsandshippingsupplies.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 524 | packagingfoodservice.com | GoDaddy.com, LLC | 11 Dec 2014 | 11 Dec 2016 | 11 Dec 2017 |
| 525 | packagingsuppliesmarcushook.com | eNom, Inc. | 11 Dec 2014 | 10 Nov 2015 | 11 Dec 2017 |
| 526 | packagingsouthasiac.com | - | - | - | - |
| 527 | packagingcreatives.com | GoDaddy.com, LLC | 12 Dec 2014 | 12 Dec 2014 | 12 Dec 2015 |
| 528 | packagingcompanyvn.com | GMO Internet Inc. | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 529 | packagingbags4u.com | Namesilo, LLC | 7 May 2022 | 8 May 2023 | 7 May 2024 |
| 530 | packagingsuppliesandshippingsupplies.org | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 531 | packagingsuppliesandshippingsupplies.net | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 532 | packagingmaterialsandshippingsupplies.org | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 533 | packagingmaterialsandshippingsupplies.net | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 534 | packagingprod.biz | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 8 Dec 2015 |
| 535 | packaging-prod.biz | OVH sas | 9 Dec 2013 | 13 Dec 2014 | 8 Dec 2015 |
| 536 | packaging-prod.com | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 9 Dec 2015 |
| 537 | packagingprod.info | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 9 Dec 2015 |
| 538 | packaging-prod.info | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 9 Dec 2015 |
| 539 | packagingprod.org | OVH sas | 9 Dec 2013 | 13 Dec 2014 | 9 Dec 2015 |
| 540 | packagingprod.net | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 9 Dec 2015 |
| 541 | packaging-prod.org | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 9 Dec 2015 |
| 542 | packaging-prod.net | OVH sas | 9 Dec 2013 | 12 Dec 2014 | 9 Dec 2015 |
| 543 | packagingecologique.com | GoDaddy.com, LLC | 14 Dec 2014 | 14 Dec 2014 | 14 Dec 2015 |
| 544 | packagingarihant.com | GoDaddy.com, LLC | 12 Jul 2018 | 12 Jul 2018 | 12 Jul 2020 |
| 545 | packagingwpassion.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2015 |
| 546 | packagingshoppe.com | - | - | - | - |
| 547 | packagingmaterialsuppliersinindore.com | Infocom Network Ltd. | 18 Dec 2014 | 18 Dec 2014 | 18 Dec 2016 |
| 548 | packagingleader.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 Aug 2017 | 30 Jul 2024 | 14 Aug 2025 |
| 549 | packagingexplorer.com | GoDaddy.com, LLC | 18 Dec 2014 | 18 Dec 2024 | 18 Dec 2025 |
| 550 | packagingcatalog.com | Amazon Registrar, Inc. | 8 Apr 2015 | 30 Apr 2024 | 8 Apr 2027 |
| 551 | packaginginnovators.com | Tucows Domains Inc. | 28 Mar 2008 | 20 Apr 2023 | 28 Mar 2025 |
| 552 | packagingmachinerymanufacturers.com | eNom, Inc. | 20 Dec 2014 | 21 Nov 2016 | 20 Dec 2017 |
| 553 | packaginghotels.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 554 | packagingdesigns.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Dec 2014 | 20 Dec 2024 | 20 Dec 2025 |
| 555 | packagingengineeringbooks.com | GoDaddy.com, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 556 | packaginggoods.com | Azdomainz LLC | 27 May 2018 | 12 Jul 2024 | 27 May 2025 |
| 557 | packagingeuropemailing.com | Tucows Domains Inc. | 20 Dec 2013 | 24 Dec 2014 | 20 Dec 2015 |
| 558 | packagingartwork.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jan 2020 | 8 Jan 2025 | 23 Jan 2026 |
| 559 | packaging-personnalise.com | OVH sas | 18 Jun 2019 | 19 Jun 2024 | 18 Jun 2025 |
| 560 | packagingwords.com | GMO Internet Inc. | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 561 | packagingmachinecn.com | HiChina Zhicheng Technology Limited | 4 Nov 2017 | 4 Nov 2017 | 4 Nov 2018 |
| 562 | packagingdemo.com | GoDaddy.com, LLC | 26 Dec 2014 | 26 Dec 2014 | 26 Dec 2015 |
| 563 | packagingofchina.com | - | 25 Dec 2007 | 24 Dec 2024 | 25 Dec 2029 |
| 564 | packaging151.com | GoDaddy.com, LLC | 12 Jun 2023 | 4 Jun 2024 | 12 Jun 2025 |
| 565 | packagingplasticbags.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 566 | packagingrecruiters.us | GoDaddy.com, LLC | 11 Dec 2012 | 4 Jan 2015 | 10 Dec 2017 |
| 567 | packagingsz.com | Name.com, Inc. | 19 Mar 2023 | 19 Mar 2024 | 19 Mar 2025 |
| 568 | packagingconsultantsllc.com | Domain.com, LLC | 15 Feb 2024 | 15 Feb 2024 | 15 Feb 2026 |
| 569 | packagingpig.com | Tucows Domains Inc. | 30 Dec 2009 | 3 Jan 2015 | 30 Dec 2015 |
| 570 | packaginglife.com | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 571 | packagingstore.biz | GoDaddy.com, LLC | 4 Jan 2015 | 9 Jan 2025 | 3 Jan 2026 |
| 572 | packagingfor.photos | - | 1 Jul 2014 | 1 Jul 2014 | 1 Jul 2015 |
| 573 | packagingfor.photography | - | 1 Jul 2014 | 1 Jul 2014 | 1 Jul 2015 |
| 574 | packagingservices.xyz | Network Solutions, LLC | 17 Jul 2014 | 18 Jul 2014 | 17 Jul 2015 |
| 575 | packagingstore.xyz | Uniregistrar Corp | 3 Jun 2016 | 23 Sep 2016 | 3 Jun 2017 |
| 576 | packaging-design.tokyo | GMO Internet Inc. | 24 Jul 2014 | 24 Jul 2014 | 24 Jul 2015 |
| 577 | packagingproducts.xyz | Network Solutions, LLC | 23 Jul 2014 | 3 Jun 2024 | 23 Jul 2025 |
| 578 | packagingsalesinc.xyz | Network Solutions, LLC | 31 Jul 2014 | 31 Jul 2014 | 31 Jul 2015 |
| 579 | packagingindex.directory | 1&1 Internet AG | 6 Aug 2014 | 6 Jan 2017 | 6 Aug 2017 |
| 580 | packagingandshippingsupplies.xyz | GoDaddy.com, LLC | 28 Aug 2014 | 8 Dec 2016 | 28 Aug 2017 |
| 581 | packaginghope.nyc | GoDaddy.com, LLC | 22 Oct 2014 | 2 Dec 2023 | 21 Oct 2023 |
| 582 | packagingconsult.solutions | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 583 | packagingconsult.services | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 584 | packagingconsult.guru | GoDaddy.com, LLC | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 585 | packagingstrategist.com | CSC Corporate Domains, Inc. | 11 Aug 2015 | 7 Aug 2024 | 11 Aug 2025 |
| 586 | packaging-strategists.net | CSC Corporate Domains, Inc. | 11 Aug 2015 | 7 Aug 2024 | 11 Aug 2025 |
| 587 | packagingmachines.ooo | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Nov 2014 | 3 Nov 2014 | 3 Nov 2015 |
| 588 | packagingsupplydepot.nyc | GoDaddy.com, LLC | 1 Nov 2014 | 6 Nov 2024 | 31 Oct 2029 |
| 589 | packagingsupplies.nyc | GoDaddy.com, LLC | 1 Nov 2014 | 6 Nov 2024 | 31 Oct 2029 |
| 590 | packaging-system.xyz | GMO Internet Inc. | 31 Oct 2014 | 31 Oct 2014 | 31 Oct 2015 |
| 591 | packagingdesign.company | GoDaddy.com, LLC | 2 Dec 2014 | 2 Dec 2023 | 2 Dec 2024 |
| 592 | packagingdesign.agency | NameCheap, Inc. | 21 Apr 2024 | 26 Apr 2024 | 21 Apr 2027 |
| 593 | packaging-infuse.blue | GMO Internet Inc. | 30 Dec 2014 | - | 30 Dec 2015 |
| 594 | packagingmachine.xn--ses554g | Internet Domain Name System Beijing Engineering Re… | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2018 |
| 595 | packagingstrategists.org | CSC Corporate Domains, Inc. | 12 Aug 2015 | 13 Aug 2024 | 12 Aug 2025 |
| 596 | packagingstrategists.net | CSC Corporate Domains, Inc. | 12 Aug 2015 | 8 Aug 2024 | 12 Aug 2025 |
| 597 | packagingstrategists.com | CSC Corporate Domains, Inc. | 12 Aug 2015 | 8 Aug 2024 | 12 Aug 2025 |
| 598 | packagingstrategist.org | CSC Corporate Domains, Inc. | 12 Aug 2015 | 13 Aug 2024 | 12 Aug 2025 |
| 599 | packagingstrategist.net | CSC Corporate Domains, Inc. | 12 Aug 2015 | 8 Aug 2024 | 12 Aug 2025 |
| 600 | packaging-strategists.org | CSC Corporate Domains, Inc. | 12 Aug 2015 | 13 Aug 2024 | 12 Aug 2025 |
| 601 | packaging-strategist.org | CSC Corporate Domains, Inc. | 12 Aug 2015 | 13 Aug 2024 | 12 Aug 2025 |
| 602 | packaging-strategist.net | CSC Corporate Domains, Inc. | 12 Aug 2015 | 8 Aug 2024 | 12 Aug 2025 |
| 603 | packaging-strategist.com | CSC Corporate Domains, Inc. | 12 Aug 2015 | 8 Aug 2024 | 12 Aug 2025 |
| 604 | packagingsupplies.sydney | Synergy Wholesale Pty Ltd | 18 Feb 2015 | 30 Nov 2024 | 18 Feb 2026 |
| 605 | packagingdesign.nrw | 1&1 Internet AG | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 606 | packagingyc.com | Web Commerce Communications Limited dba WebNic.cc | 4 Jan 2024 | 5 Jan 2025 | 4 Jan 2026 |
| 607 | packaging-product.com | GoDaddy.com, LLC | 5 Nov 2024 | 5 Nov 2024 | 5 Nov 2025 |
| 608 | packagingmaterialsupplier.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jan 2021 | 11 Mar 2021 | 8 Jan 2031 |
| 609 | packagingcertificate.com | Namesilo, LLC | 14 Aug 2015 | 15 Aug 2024 | 14 Aug 2025 |
| 610 | packagingforpaintings.com | Domain.com, LLC | 5 May 2010 | 10 Jan 2015 | 5 May 2015 |
| 611 | packagingro.com | GoDaddy.com, LLC | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2017 |
| 612 | packagingnews.net | GoDaddy.com, LLC | 7 Apr 2021 | 7 Apr 2024 | 7 Apr 2027 |
| 613 | packagingwrap.com | HiChina Zhicheng Technology Limited | 17 Jun 2020 | 17 Jun 2020 | 17 Jun 2021 |
| 614 | packagingpignaniprinting.com | Tucows Domains Inc. | 19 Apr 2010 | 23 Apr 2018 | 19 Apr 2018 |
| 615 | packagingequipmentparts.com | Tucows Domains Inc. | 14 Feb 2019 | 2 Feb 2025 | 14 Feb 2026 |
| 616 | packagingandmachinery.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 19 Mar 2020 | 19 Mar 2020 | 19 Mar 2021 |
| 617 | packaging-store.com | - | 19 Feb 2020 | 17 Feb 2025 | 19 Feb 2026 |
| 618 | packagingrecruitment.com | Webfusion Ltd. | 14 Jan 2015 | 15 Jan 2025 | 14 Jan 2026 |
| 619 | packagingforthefuture.com | One.com A/S | 15 Jan 2021 | 16 Dec 2024 | 15 Jan 2026 |
| 620 | packagingsoft.com | GoDaddy.com, LLC | 6 Apr 2022 | 29 Oct 2024 | 6 Apr 2025 |
| 621 | packagingca.solutions | GoDaddy.com, LLC | 27 May 2015 | 11 Jul 2017 | 27 May 2018 |
| 622 | packagingmachines.sale | Name.com, Inc. | 31 May 2015 | 14 May 2017 | 31 May 2018 |
| 623 | packagingaccessibility.tools | Tucows Domains Inc. | 2 Jun 2015 | 6 Jun 2019 | 2 Jun 2020 |
| 624 | packagingmachines.news | DomainSite, Inc. | 15 Jul 2015 | 28 Jun 2017 | 15 Jul 2018 |
| 625 | packagingmaterials.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 30 Jul 2015 | 30 Jul 2015 | 30 Jul 2016 |
| 626 | packagingpatterns.com | eNom, Inc. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 627 | packagingcenter.net | DomainPeople, Inc. | 21 Jun 2024 | 21 Jun 2024 | 21 Jun 2025 |
| 628 | packaging-machinery-usa.com | Network Solutions, LLC | 17 Aug 2015 | 5 Mar 2017 | 17 Aug 2018 |
| 629 | packagingmade.com | Google, Inc. | 24 Nov 2020 | 10 Nov 2024 | 24 Nov 2025 |
| 630 | packaginghorizons.org | GoDaddy.com, LLC | 21 Jan 2003 | 22 Jan 2025 | 21 Jan 2026 |
| 631 | packaginghorizons.net | GoDaddy.com, LLC | 21 Jan 2003 | 22 Jan 2025 | 21 Jan 2026 |
| 632 | packagingboxess.com | BigRock Solutions Ltd. | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 633 | packagingbazaar.com | GoDaddy.com, LLC | 23 Jan 2015 | 28 Jan 2025 | 23 Jan 2026 |
| 634 | packagingbox.info | Tucows Domains Inc. | 21 Jan 2009 | 25 Jan 2015 | 21 Jan 2016 |
| 635 | packagingcenters.com | GoDaddy.com, LLC | 27 Jan 2015 | 27 Jan 2015 | 27 Jan 2020 |
| 636 | packagingnewsafrica.com | Hosting Concepts B.V. dba Openprovider | 18 Aug 2015 | 9 Sep 2024 | 18 Aug 2025 |
| 637 | packagingmarket.net | eNom, Inc. | 16 Jan 2021 | 23 Dec 2024 | 16 Jan 2026 |
| 638 | packagingpositioning.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Jan 2015 | 12 Jan 2025 | 28 Jan 2026 |
| 639 | packagingalliancecorp.com | Tucows Domains Inc. | 24 Jan 2014 | 28 Jan 2015 | 24 Jan 2016 |
| 640 | packagingmvp.com | GoDaddy.com, LLC | 16 Jun 2016 | 17 Jun 2024 | 16 Jun 2025 |
| 641 | packaginguk.com | Mesh Digital Limited | 27 Jan 2003 | 22 Jan 2025 | 27 Jan 2026 |
| 642 | packagingpositive.com | GoDaddy.com, LLC | 29 Jan 2015 | 30 Jan 2025 | 29 Jan 2026 |
| 643 | packagingliquidator.com | GoDaddy.com, LLC | 25 Mar 2022 | 6 Apr 2023 | 25 Mar 2024 |
| 644 | packagingfreedom.com | Crazy Domains FZ-LLC | 2 Oct 2023 | 24 Sep 2024 | 2 Oct 2025 |
| 645 | packagingpositive.org | GoDaddy.com, LLC | 29 Jan 2015 | 29 Jan 2025 | 29 Jan 2026 |
| 646 | packaginginnovation.design | Tucows Domains Inc. | 12 May 2015 | 22 Jun 2017 | 12 May 2017 |
| 647 | packaginginnovation.london | Tucows Domains Inc. | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 648 | packaginginnovation.consulting | Tucows Domains Inc. | 11 May 2015 | 15 May 2017 | 11 May 2018 |
| 649 | packaginginnovation.agency | Tucows Domains Inc. | 11 May 2015 | 15 May 2017 | 11 May 2018 |
| 650 | packaging-shipping-boxes.com | GoDaddy.com, LLC | 1 Feb 2015 | 17 Sep 2022 | 1 Feb 2029 |
| 651 | packaging-handles.com | GoDaddy.com, LLC | 1 Feb 2015 | 17 Sep 2022 | 1 Feb 2029 |
| 652 | packagingifts.com | 35 Technology Co., Ltd. | 2 Feb 2015 | 2 Feb 2015 | 2 Feb 2016 |
| 653 | packagingartists.com | TLD Registrar Solutions Ltd. | 1 Feb 2015 | 27 Jan 2016 | 1 Feb 2018 |
| 654 | packagingmachine-fillingmachine.com | HiChina Zhicheng Technology Limited | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2018 |
| 655 | packagingis.com | Instra Corporation Pty Ltd. | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2017 |
| 656 | packagingdesign-brandidentity.com | Network Solutions, LLC | 19 Aug 2015 | 17 Aug 2016 | 19 Aug 2017 |
| 657 | packagingandfillingmachine.com | HiChina Zhicheng Technology Limited | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2018 |
| 658 | packaging-project.com | FastDomain Inc. | 2 Feb 2015 | 2 Feb 2017 | 2 Feb 2018 |
| 659 | packagingmk.com | Tucows Domains Inc. | 18 Oct 2016 | 22 Oct 2018 | 18 Oct 2018 |
| 660 | packagingevolution.com | Annulet LLC | 22 Apr 2016 | 9 Jun 2024 | 22 Apr 2025 |
| 661 | packagingadvisorsinternational.com | GoDaddy.com, LLC | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2017 |
| 662 | packagingsupplies.biz | GoDaddy.com, LLC | 4 Feb 2015 | 4 Feb 2015 | 3 Feb 2016 |
| 663 | packaging52.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Feb 2015 | 8 Feb 2025 | 4 Feb 2026 |
| 664 | packaging-paper.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Apr 2022 | 2 Apr 2024 | 28 Apr 2025 |
| 665 | packagingsupplies.org | GoDaddy.com, LLC | 22 Jun 2022 | 27 Aug 2024 | 22 Jun 2025 |
| 666 | packagingdd.net | OnlineNIC, Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 667 | packagingdesignlab.net | Tucows Domains Inc. | 2 Feb 2010 | 6 Feb 2015 | 2 Feb 2016 |
| 668 | packagingdesignlab.info | Tucows Domains Inc. | 2 Feb 2010 | 6 Feb 2015 | 2 Feb 2016 |
| 669 | packagingsardegna.org | Register.it SPA | 5 Feb 2015 | - | 5 Feb 2016 |
| 670 | packagingtapeusa.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2017 |
| 671 | packagingtapeus.com | GoDaddy.com, LLC | 7 Feb 2015 | 7 Feb 2015 | 7 Feb 2017 |
| 672 | packagingoptimization.com | united-domains AG | 15 Oct 2024 | 14 Dec 2024 | 15 Oct 2025 |
| 673 | packaging-projects.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 674 | packagingmaterialsnewyork.com | GoDaddy.com, LLC | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 675 | packagingmachinemanufacturers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2015 | 10 Feb 2025 | 10 Feb 2025 |
| 676 | packaging-company.info | GoDaddy.com, LLC | 9 Feb 2015 | - | 9 Feb 2016 |
| 677 | packaginglumber.com | GoDaddy.com, LLC | 11 Feb 2015 | 12 Feb 2025 | 11 Feb 2027 |
| 678 | packaging-lumber.com | GoDaddy.com, LLC | 11 Feb 2015 | 12 Feb 2025 | 11 Feb 2027 |
| 679 | packagingnation.com | eNom, Inc. | 12 Feb 2015 | 5 Feb 2025 | 12 Feb 2027 |
| 680 | packaging2order.com | GoDaddy.com, LLC | 13 Feb 2015 | 12 Feb 2024 | 13 Feb 2026 |
| 681 | packaging-london.com | Gandi SAS | 2 Apr 2019 | 1 Feb 2025 | 2 Apr 2025 |
| 682 | packaging-cosmetics.com | Web Commerce Communications Limited dba WebNic.cc | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2019 |
| 683 | packaginginnovation.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Feb 2015 | 5 Feb 2020 | 13 Feb 2021 |
| 684 | packagingdesignarchive.info | Tucows Domains Inc. | 10 Feb 2009 | 14 Feb 2015 | 10 Feb 2016 |
| 685 | packagingdesignarchive.net | Tucows Domains Inc. | 10 Feb 2009 | 14 Feb 2015 | 10 Feb 2016 |
| 686 | packagingops.com | GoDaddy.com, LLC | 10 Nov 2022 | 6 Nov 2024 | 10 Nov 2025 |
| 687 | packagingbagsforyou.com | - | - | - | - |
| 688 | packagingbagforyou.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 689 | packagingandtheirproducts.com | Tucows Domains Inc. | 14 Feb 2013 | 18 Feb 2015 | 14 Feb 2016 |
| 690 | packagingwithoutboundaries.com | Tucows Domains Inc. | 15 Feb 2008 | 19 Feb 2015 | 15 Feb 2016 |
| 691 | packagingmachine-cb.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 15 Feb 2012 | 18 Feb 2015 | 15 Feb 2016 |
| 692 | packagingchina.mobi | HiChina Zhicheng Technology Limited | 18 Oct 2018 | 19 Oct 2018 | 18 Oct 2019 |
| 693 | packagingwithoutboundaries.net | Tucows Domains Inc. | 15 Feb 2008 | 19 Feb 2015 | 15 Feb 2016 |
| 694 | packagingorp.com | Chengdu West Dimension Digital Technology Co., Ltd… | 2 Feb 2022 | 16 Mar 2024 | 2 Feb 2024 |
| 695 | packagingmachineindonesia2.com | Web Commerce Communications Limited dba WebNic.cc | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 696 | packagingmaterialscenter-springfield.com | GoDaddy.com, LLC | 24 Feb 2015 | 24 Feb 2015 | 24 Feb 2016 |
| 697 | packaging-logistics.com | Gabia, Inc. | 26 Feb 2015 | 23 Feb 2017 | 26 Feb 2018 |
| 698 | packagingcompany.net | Mvpdomainnames.com LLC | 24 Feb 2015 | 3 Aug 2017 | 24 Feb 2018 |
| 699 | packaging-machinery.net | GoDaddy.com, LLC | 21 Feb 2000 | 22 Feb 2025 | 21 Feb 2026 |
| 700 | packagingmaterialsnyc.com | GoDaddy.com, LLC | 26 Feb 2015 | 26 Feb 2015 | 26 Feb 2016 |
| 701 | packagingkc.com | GoDaddy.com, LLC | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 702 | packagingpm.com | Webfusion Ltd. | 2 Mar 2015 | 3 Mar 2025 | 2 Mar 2026 |
| 703 | packagingpharma.com | GoDaddy.com, LLC | 17 Jun 2023 | 17 Jun 2023 | 17 Jun 2026 |
| 704 | packagingindore.com | GoDaddy.com, LLC | 21 Jul 2017 | 3 Sep 2024 | 21 Jul 2025 |
| 705 | packagingafrica.com | Domain.com, LLC | 4 Mar 2015 | 12 Aug 2024 | 4 Mar 2025 |
| 706 | packagingeauction.com | GoDaddy.com, LLC | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 707 | packaging-home.com | Name.com, Inc. | 5 Mar 2015 | 8 Feb 2025 | 5 Mar 2026 |
| 708 | packagingstoreut.com | Google, Inc. | 6 Mar 2015 | 10 May 2024 | 6 Mar 2025 |
| 709 | packaginglatam.com | GoDaddy.com, LLC | 6 Mar 2015 | 7 Mar 2024 | 6 Mar 2025 |
| 710 | packagingdesigntemplates.net | GoDaddy.com, LLC | 21 Apr 2017 | 21 Apr 2017 | 21 Apr 2018 |
| 711 | packaging-home.org | Name.com, Inc. | 5 Mar 2015 | 5 Mar 2015 | 5 Mar 2016 |
| 712 | packaging-home.net | Name.com, Inc. | 5 Mar 2015 | 6 Mar 2021 | 5 Mar 2021 |
| 713 | packagingsupplies-packagingsupplies-maintenancesupplies.com | Tucows Domains Inc. | 7 Mar 2015 | 11 Mar 2017 | 7 Mar 2017 |
| 714 | packagingparafotografos.com | Mesh Digital Limited | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 715 | packagingmaterialsinnyc.com | GoDaddy.com, LLC | 9 Mar 2015 | 9 Mar 2015 | 9 Mar 2016 |
| 716 | packaging-bottles.com | Xin Net Technology Corporation | 25 Aug 2015 | 12 Jan 2024 | 25 Aug 2025 |
| 717 | packagingmaterialsmanhattan.com | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2015 | 9 Mar 2016 |
| 718 | packagingformobiles.com | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2023 | 9 Mar 2025 |
| 719 | packaging-days-2015.com | RegistryGate GmbH | 9 Mar 2015 | 22 Jan 2025 | 9 Mar 2025 |
| 720 | packagingboxdelhi.com | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 721 | packaging-bids.com | GoDaddy.com, LLC | 7 Sep 2018 | 7 Sep 2018 | 7 Sep 2019 |
| 722 | packagingprice.org | Amazon Registrar, Inc. | 12 Mar 2015 | 26 Feb 2024 | 12 Mar 2025 |
| 723 | packagingprice.net | Amazon Registrar, Inc. | 12 Mar 2015 | 21 Feb 2024 | 12 Mar 2025 |
| 724 | packagingsuppliesforless.com | GoDaddy.com, LLC | 25 Aug 2015 | 26 Aug 2024 | 25 Aug 2025 |
| 725 | packagingmachienry.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 726 | packagingfoodproducts.com | GoDaddy.com, LLC | 25 Aug 2015 | 26 Aug 2015 | 25 Aug 2016 |
| 727 | packagingcentercn.com | GoDaddy.com, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 728 | packagingformats.com | Annulet LLC | 15 Mar 2015 | 2 May 2024 | 15 Mar 2025 |
| 729 | packaging-answers.com | GoDaddy.com, LLC | 28 Jun 2005 | 16 Sep 2024 | 28 Jun 2026 |
| 730 | packagingforprosperity.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 17 Mar 2015 | 17 Mar 2015 | 17 Mar 2016 |
| 731 | packagingequip.com | Annulet LLC | 4 Jun 2016 | 22 Jul 2024 | 4 Jun 2025 |
| 732 | packagingrobotics.com | Fabulous.com Pty Ltd. | 19 Feb 2013 | 4 Feb 2025 | 19 Feb 2026 |
| 733 | packaginglasistempack.com | Register.it SPA | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 734 | packagingsuppliesplus.com | GoDaddy.com, LLC | 30 Oct 2020 | 31 Oct 2024 | 30 Oct 2025 |
| 735 | packagingscout24.com | 1&1 Internet AG | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 736 | packagingready.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Feb 2025 | 16 Feb 2025 | 16 Feb 2026 |
| 737 | packagingissues.com | Annulet LLC | 9 Sep 2016 | 27 Oct 2024 | 9 Sep 2025 |
| 738 | packagingstore.net | GoDaddy.com, LLC | 19 Mar 2015 | 20 Mar 2024 | 19 Mar 2025 |
| 739 | packagingtechnologies-us.com | GoDaddy.com, LLC | 21 Mar 2015 | 21 Mar 2015 | 21 Mar 2020 |
| 740 | packagingpoland.com | eNom, Inc. | 23 Sep 2020 | 4 Nov 2024 | 23 Sep 2024 |
| 741 | packagingvalencia.com | Domain.com, LLC | 17 Apr 2012 | 23 Mar 2015 | 17 Apr 2016 |
| 742 | packagingmachineinindia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 743 | packagingsolutions.info | GoDaddy.com, LLC | 28 Jul 2023 | 8 Sep 2024 | 28 Jul 2024 |
| 744 | packagingyourpurpose.com | GoDaddy.com, LLC | 14 Apr 2018 | 15 Apr 2024 | 14 Apr 2026 |
| 745 | packagingcn.net | HiChina Zhicheng Technology Limited | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 746 | packaging-box.net | HiChina Zhicheng Technology Limited | 26 Mar 2015 | 1 May 2017 | 26 Mar 2018 |
| 747 | packagingmozzarella.com | eNom, Inc. | 30 Mar 2015 | 30 Mar 2015 | 30 Mar 2016 |
| 748 | packagingmachinesindia.com | Hosting Concepts B.V. dba Openprovider | 5 Sep 2020 | 5 Sep 2020 | 5 Sep 2021 |
| 749 | packagingcorrp.com | GoDaddy.com, LLC | 8 Nov 2022 | 20 Dec 2023 | 8 Nov 2023 |
| 750 | packagingegyptian.com | Name.com, Inc. | 31 Mar 2015 | 23 Mar 2024 | 31 Mar 2025 |
| 751 | packagingegypt.com | Name.com, Inc. | 31 Mar 2015 | 23 Mar 2024 | 31 Mar 2025 |
| 752 | packaging-egyptian.com | Name.com, Inc. | 31 Mar 2015 | 23 Mar 2024 | 31 Mar 2025 |
| 753 | packagingprototypes.com | Annulet LLC | 1 Apr 2015 | 19 May 2024 | 1 Apr 2025 |
| 754 | packaginginsanrafaelca.com | eNom, Inc. | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 755 | packaginginsanjoseca.com | eNom, Inc. | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 756 | packaginginoaklandca.com | eNom, Inc. | 28 Aug 2015 | 28 Aug 2015 | 28 Aug 2016 |
| 757 | packagingsearch.com | TurnCommerce, Inc. DBA NameBright.com | 2 Apr 2015 | 27 Mar 2021 | 2 Apr 2025 |
| 758 | packagingtitan.com | GoDaddy.com, LLC | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 759 | packagingalimentare.com | GoDaddy.com, LLC | 7 Apr 2015 | 8 Apr 2024 | 7 Apr 2025 |
| 760 | packagingshopping.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 761 | packagingbenefits.com | eNom, Inc. | 1 Sep 2015 | 1 Sep 2015 | 1 Sep 2016 |
| 762 | packaging-engineer.com | 1&1 Internet AG | 2 Jan 2024 | 2 Jan 2024 | 2 Jan 2026 |
| 763 | packagingmania.com | NameCheap, Inc. | 22 Jul 2020 | 23 Jun 2024 | 22 Jul 2025 |
| 764 | packagingydiscapacidad.com | eNom, Inc. | 2 Sep 2015 | 11 Sep 2016 | 2 Sep 2017 |
| 765 | packagingsouthafrica.com | DiaMatrix C.C. | 2 Sep 2015 | 19 Aug 2024 | 2 Sep 2025 |
| 766 | packagingdelhi.com | GoDaddy.com, LLC | 4 Mar 2019 | 4 Mar 2019 | 4 Mar 2021 |
| 767 | packagingandprintdirectory.com | Tucows Domains Inc. | 2 Sep 2015 | 4 Aug 2016 | 2 Sep 2017 |
| 768 | packagingsolutionsusa.com | GoDaddy.com, LLC | 4 Sep 2023 | 13 Oct 2023 | 4 Sep 2025 |
| 769 | packagingmachineegypt.com | Name.com, Inc. | 8 Apr 2015 | 15 Apr 2024 | 8 Apr 2025 |
| 770 | packagingflessibili.com | Tucows Domains Inc. | 5 Apr 2013 | 9 Apr 2015 | 5 Apr 2016 |
| 771 | packaging-machines-egypt.com | Name.com, Inc. | 8 Apr 2015 | 15 Apr 2024 | 8 Apr 2025 |
| 772 | packaging-machine-egypt.com | Name.com, Inc. | 8 Apr 2015 | 15 Apr 2024 | 8 Apr 2025 |
| 773 | packagingalimentare.net | GoDaddy.com, LLC | 7 Apr 2015 | 8 Apr 2024 | 7 Apr 2025 |
| 774 | packagingforcells.com | GoDaddy.com, LLC | 9 Apr 2015 | 10 Apr 2023 | 9 Apr 2025 |
| 775 | packagingengineercareers.com | GoDaddy.com, LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 776 | packagingconverter.com | CloudFlare, Inc. | 10 Apr 2015 | 7 Apr 2024 | 10 Apr 2025 |
| 777 | packagingdeluxe.com | Annulet LLC | 11 Apr 2015 | 29 May 2024 | 11 Apr 2025 |
| 778 | packaging-supplier.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 14 Oct 2024 | 15 Oct 2024 | 14 Oct 2025 |
| 779 | packagingpulse.com | Wild West Domains, LLC | 23 Mar 2024 | 23 Mar 2024 | 23 Mar 2025 |
| 780 | packagingconsultant.info | LCN.COM Ltd. | 4 Sep 2015 | 4 Sep 2015 | 4 Sep 2016 |
| 781 | packagingedge.com | GoDaddy.com, LLC | 18 Nov 2018 | 20 Sep 2024 | 18 Nov 2025 |
| 782 | packagingdirector.com | Metaregistrar BV Applications | 16 Apr 2015 | 15 Apr 2024 | 16 Apr 2024 |
| 783 | packagingofvietnam.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2016 |
| 784 | packagingcalc.com | GoDaddy.com, LLC | 18 Apr 2015 | 18 Apr 2015 | 18 Apr 2016 |
| 785 | packaging-supply-china.com | HiChina Zhicheng Technology Limited | 18 Apr 2015 | 12 Apr 2017 | 18 Apr 2018 |
| 786 | packagingmoving.com | GoDaddy.com, LLC | 19 Apr 2015 | 20 Apr 2015 | 19 Apr 2016 |
| 787 | packagingandfinishing.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Apr 2015 | 20 Apr 2015 | 19 Apr 2016 |
| 788 | packagingrx.com | TurnCommerce, Inc. DBA NameBright.com | 15 Dec 2023 | 9 Dec 2024 | 15 Dec 2025 |
| 789 | packagingnewslive.com | GoDaddy.com, LLC | 21 Apr 2015 | 22 Apr 2024 | 21 Apr 2025 |
| 790 | packagingfortrust.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2025 |
| 791 | packagingforsharing.com | IHS Telekom, Inc. | 21 Apr 2015 | 19 Oct 2020 | 21 Apr 2025 |
| 792 | packagingforsenses.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Jun 2015 | 21 Apr 2025 |
| 793 | packagingforlove.com | IHS Telekom, Inc. | 21 Apr 2015 | 28 Oct 2020 | 21 Apr 2025 |
| 794 | packagingforlife.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2025 |
| 795 | packagingforfun.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Jun 2015 | 21 Apr 2025 |
| 796 | packagingforfriendship.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Jun 2015 | 21 Apr 2025 |
| 797 | packagingforfreshness.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2025 |
| 798 | packagingforfreedom.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2025 |
| 799 | packagingforearth.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2025 |
| 800 | packagingforcare.com | IHS Telekom, Inc. | 21 Apr 2015 | 21 Jun 2015 | 21 Apr 2025 |
| 801 | packagingdesignassociation.com | GoDaddy.com, LLC | 21 Apr 2015 | 21 Apr 2023 | 21 Apr 2025 |
| 802 | packaging-design-solutions.com | Tucows Domains Inc. | 1 Mar 2010 | 5 Mar 2016 | 1 Mar 2017 |
| 803 | packagingmetrics.com | GoDaddy.com, LLC | 21 Apr 2015 | 22 Apr 2024 | 21 Apr 2025 |
| 804 | packagingimports.com | TurnCommerce, Inc. DBA NameBright.com | 22 Apr 2015 | 16 Apr 2021 | 22 Apr 2025 |
| 805 | packagingboom.com | Xiamen Domains, Inc. | 6 Dec 2019 | 8 Dec 2019 | 6 Dec 2020 |
| 806 | packagingdesignassociation.org | GoDaddy.com, LLC | 21 Apr 2015 | 9 Jul 2024 | 21 Apr 2026 |
| 807 | packaginghorizonsmag.com | Dynadot, LLC | 30 Jul 2016 | 27 Nov 2024 | 30 Jul 2025 |
| 808 | packagingbusinessforsale.com | GoDaddy.com, LLC | 25 Apr 2015 | 25 Apr 2024 | 25 Apr 2025 |
| 809 | packagingbusinessesforsale.com | GoDaddy.com, LLC | 25 Apr 2015 | 25 Apr 2024 | 25 Apr 2025 |
| 810 | packagingandbusinessinnovationshow.com | eNom, Inc. | 24 Apr 2015 | 24 Apr 2015 | 24 Apr 2016 |
| 811 | packagingsolutionsagency.com | Network Solutions, LLC | 8 Sep 2015 | 8 Sep 2015 | 8 Sep 2016 |
| 812 | packagingdigitalprinting.com | GoDaddy.com, LLC | 26 Apr 2015 | 26 Apr 2015 | 26 Apr 2016 |
| 813 | packagingmachinemanufacturer.net | GoDaddy.com, LLC | 31 Jul 2018 | 31 Jul 2018 | 31 Jul 2019 |
| 814 | packagingdepotdirect.com | GoDaddy.com, LLC | 27 Apr 2015 | 18 Sep 2022 | 27 Apr 2025 |
| 815 | packagingtop.com | Online SAS | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 816 | packagingservicescorp.com | Tucows Domains Inc. | 17 Jan 2017 | 21 Jan 2019 | 17 Jan 2019 |
| 817 | packagingscout.com | TurnCommerce, Inc. DBA NameBright.com | 25 Nov 2016 | 19 Nov 2020 | 25 Nov 2025 |
| 818 | packaging-pop-marketing.com | EuroDNS S.A. | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2017 |
| 819 | packagingoptimized.com | GoDaddy.com, LLC | 1 May 2015 | 18 Sep 2022 | 1 May 2025 |
| 820 | packaginghappiness.com | TurnCommerce, Inc. DBA NameBright.com | 19 Jul 2019 | 13 Jul 2020 | 19 Jul 2025 |
| 821 | packaginghappiness.info | GoDaddy.com, LLC | 1 May 2015 | 30 Jun 2015 | 1 May 2018 |
| 822 | packagingproz.com | Domain.com, LLC | 2 May 2015 | 2 May 2015 | 2 May 2016 |
| 823 | packaginghappiness.org | GoDaddy.com, LLC | 1 May 2015 | 1 Jul 2015 | 1 May 2018 |
| 824 | packaginghappiness.net | GoDaddy.com, LLC | 1 May 2015 | 1 May 2015 | 1 May 2018 |
| 825 | packagingsolutionsforyou.com | Network Solutions, LLC | 3 May 2015 | 13 Jun 2024 | 3 May 2026 |
| 826 | packagingmachineryinindia.com | GoDaddy.com, LLC | 7 May 2015 | 7 May 2015 | 7 May 2016 |
| 827 | packagingboutique.us | Google, Inc. | 6 May 2015 | 6 May 2015 | 5 May 2016 |
| 828 | packagingdesignshop.com | Key-Systems GmbH | 8 May 2015 | 7 May 2017 | 8 May 2018 |
| 829 | packagingbeauty.com | Annulet LLC | 10 Oct 2019 | 27 Nov 2024 | 10 Oct 2025 |
| 830 | packagingportalsouthafrica.com | Tucows Domains Inc. | 11 Sep 2015 | 13 Aug 2016 | 11 Sep 2017 |
| 831 | packagingdirectorysouthafrica.com | DiaMatrix C.C. | 11 Sep 2015 | 29 Aug 2024 | 11 Sep 2025 |
| 832 | packagingcompanydirectory.com | DiaMatrix C.C. | 11 Sep 2015 | 29 Aug 2024 | 11 Sep 2025 |
| 833 | packaging-central.com | UdomainName.com LLC | 24 Oct 2024 | 12 Nov 2024 | 24 Oct 2025 |
| 834 | packaging-in-china.com | HiChina Zhicheng Technology Limited | 15 May 2015 | 26 Feb 2024 | 15 May 2025 |
| 835 | packaging-expo-milano-imballaggi-goglio.com | Register.it SPA | 15 May 2015 | 15 May 2015 | 15 May 2016 |
| 836 | packagingguru.info | GoDaddy.com, LLC | 16 May 2015 | - | 16 May 2016 |
| 837 | packagingandpricingbootcamp.com | DreamHost, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 838 | packaging-productions.com | Tucows Domains Inc. | 14 May 2013 | 18 May 2015 | 14 May 2016 |
| 839 | packagingguru.org | GoDaddy.com, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 840 | packagingguru.net | GoDaddy.com, LLC | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 841 | packaging66.com | Shanghai Best Oray Information S&T Co., Ltd | 2 Aug 2016 | 3 Aug 2016 | 2 Aug 2017 |
| 842 | packagingsuppliesblog.com | GoDaddy.com, LLC | 29 Jul 2019 | 29 Jul 2019 | 29 Jul 2020 |
| 843 | packagingcareers.org | Tucows Domains Inc. | 1 Dec 2023 | 10 Feb 2025 | 1 Dec 2024 |
| 844 | packagingsavesfood.com | DropCatch.com 860 LLC | 8 Aug 2016 | 9 Aug 2017 | 8 Aug 2018 |
| 845 | packagingresourcesinc.com | Hostinger, UAB | 20 May 2015 | 8 Aug 2024 | 20 May 2025 |
| 846 | packagingresourcesca.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 847 | packagingpatel.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 848 | packagingdesigner.net | Nics Telekomünikasyon Ticaret Ltd. Şti. | 10 Nov 2019 | 20 Jan 2025 | 10 Nov 2024 |
| 849 | packagingandwarehousing.com | Tucows Domains Inc. | 17 May 2011 | 21 May 2015 | 17 May 2016 |
| 850 | packaging-focus.com | HiChina Zhicheng Technology Limited | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 851 | packagingeducationalliance.com | Network Solutions, LLC | 13 Jan 2011 | 15 May 2015 | 13 Jan 2017 |
| 852 | packagingsavesfood.org | Network Solutions, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 853 | packagingsavesfood.net | Network Solutions, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 854 | packaging-solutions.net | GoDaddy.com, LLC | 20 May 2015 | 20 Apr 2024 | 20 May 2028 |
| 855 | packaging-art.com | HiChina Zhicheng Technology Limited | 1 Apr 2021 | 1 Apr 2021 | 1 Apr 2022 |
| 856 | packagingroom.com | Azprivatez LLC | 1 Dec 2016 | 16 Jan 2025 | 1 Dec 2025 |
| 857 | packagingeducationalliance.org | Network Solutions, LLC | 13 Jan 2011 | 21 May 2015 | 13 Jan 2017 |
| 858 | packagingeducationalliance.net | Network Solutions, LLC | 13 Jan 2011 | 15 May 2015 | 13 Jan 2017 |
| 859 | packagingperfumes.com | FastDomain Inc. | 23 May 2015 | 23 May 2023 | 23 May 2025 |
| 860 | packagingift.com | HiChina Zhicheng Technology Limited | 23 May 2015 | 23 May 2015 | 23 May 2020 |
| 861 | packagingandfoodmachinary.com | Tucows Domains Inc. | 16 Aug 2020 | 22 Jul 2024 | 16 Aug 2025 |
| 862 | packagingpublicrelations.com | eNom, Inc. | 25 May 2015 | 25 May 2015 | 25 May 2016 |
| 863 | packaginglowcost.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 May 2015 | 26 May 2015 | 26 May 2016 |
| 864 | packagingsolutionsca.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2018 |
| 865 | packagingmachinerybuyers.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 May 2015 | 1 Jun 2017 | 27 May 2019 |
| 866 | packaging4partners.com | - | 17 Aug 2022 | 17 Aug 2022 | 17 Aug 2023 |
| 867 | packagingdesignwebshop.com | Key-Systems GmbH | 28 May 2015 | 27 May 2017 | 28 May 2018 |
| 868 | packagingpower.net | Key-Systems GmbH | 27 May 2015 | 18 Jul 2017 | 27 May 2018 |
| 869 | packagingportal.org | Sibername Internet and Software Technologies Inc. | 27 May 2015 | 8 Jul 2017 | 27 May 2018 |
| 870 | packagingsupplyguys.com | GoDaddy.com, LLC | 29 May 2015 | 29 May 2015 | 29 May 2017 |
| 871 | packagingandpadrus.com | Tucows Domains Inc. | 29 May 2015 | 29 May 2015 | 29 May 2017 |
| 872 | packaging-egypt.com | Xin Net Technology Corporation | 19 Aug 2018 | 20 Aug 2018 | 19 Aug 2019 |
| 873 | packagingaccessibility.com | DropCatch.com 587 LLC | 20 Aug 2023 | 21 Aug 2023 | 20 Aug 2025 |
| 874 | packagingaccessibility.org | Tucows Domains Inc. | 2 Jun 2015 | 26 May 2017 | 2 Jun 2018 |
| 875 | packagingaccessibility.net | Tucows Domains Inc. | 2 Jun 2015 | 6 Jun 2019 | 2 Jun 2019 |
| 876 | packagingaccessibility.info | Tucows Domains Inc. | 2 Jun 2015 | 6 Jun 2020 | 2 Jun 2021 |
| 877 | packagingclubitalia.com | - | - | - | - |
| 878 | packaging-4u.com | OVH sas | 27 Mar 2019 | 27 Mar 2019 | 27 Mar 2020 |
| 879 | packagingzone.net | Tucows Domains Inc. | 4 Jun 2015 | 8 Jun 2020 | 4 Jun 2020 |
| 880 | packagingprnews.com | Pipeline Domains, LLC | 9 Jun 2015 | 15 Jul 2017 | 9 Jun 2018 |
| 881 | packagingforliquid.net | Wild West Domains, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2017 |
| 882 | packagingforliquid.com | Wild West Domains, LLC | 17 Sep 2015 | 17 Sep 2015 | 17 Sep 2017 |
| 883 | packaginginnovationanddesign.com | GoDaddy.com, LLC | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2018 |
| 884 | packagingid.com | GoDaddy.com, LLC | 11 Jun 2015 | 22 Jul 2024 | 11 Jun 2025 |
| 885 | packagingfranchise.com | - | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2017 |
| 886 | packagingverde.com | Register.it SPA | 11 Jun 2015 | 11 Jun 2015 | 11 Jun 2016 |
| 887 | packagingpakistan.com | GoDaddy.com, LLC | 6 Dec 2023 | 6 Dec 2023 | 6 Dec 2026 |
| 888 | packagingbrigade.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2024 | 12 Jun 2025 |
| 889 | packagingandtesting.com | Nominalia Internet S.L. | 18 May 2023 | 28 Apr 2024 | 18 May 2025 |
| 890 | packagingdesignscompanies.com | PSI-USA, Inc. dba Domain Robot | 2 Sep 2020 | 2 Sep 2020 | 2 Sep 2021 |
| 891 | packagingandisplay.com | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 892 | packagingyoga.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2015 | 10 Feb 2024 | 13 Jun 2025 |
| 893 | packagingproduction.com | TurnCommerce, Inc. DBA NameBright.com | 31 Aug 2019 | 10 Oct 2024 | 31 Aug 2024 |
| 894 | packagingmentors.com | Squarespace Domains LLC | 28 Jun 2024 | 8 Oct 2024 | 28 Jun 2034 |
| 895 | packaging-yoga.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2015 | 10 Feb 2024 | 13 Jun 2025 |
| 896 | packaging-mentors.com | - | - | - | - |
| 897 | packagingdevelopments.com | Mesh Digital Limited | 22 Sep 2020 | 17 Sep 2024 | 22 Sep 2025 |
| 898 | packagingtutorials.com | Namesilo, LLC | 14 May 2010 | 15 May 2024 | 14 May 2025 |
| 899 | packagingsuppliersuk.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Jun 2012 | 15 Jun 2015 | 5 Jun 2016 |
| 900 | packagingschool.com | Namesilo, LLC | 18 Jun 2010 | 19 Jun 2024 | 18 Jun 2025 |
| 901 | packagingmachinery-online.com | Metaregistrar BV Applications | 16 Jun 2015 | 18 Jun 2024 | 16 Jun 2025 |
| 902 | packaging-zone.com | Launchpad, Inc. | 16 Jun 2015 | 1 Jun 2024 | 16 Jun 2025 |
| 903 | packagingstudy.com | Key-Systems GmbH | 19 Sep 2015 | 15 Oct 2016 | 19 Sep 2017 |
| 904 | packagingsuppliesinphiladelphiapa.com | eNom, Inc. | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 905 | packagingdiscountoutlet.com | Network Solutions, LLC | 18 Jun 2015 | 19 Apr 2024 | 18 Jun 2025 |
| 906 | packagingcorp.net | Network Solutions, LLC | 22 Feb 2017 | 30 Jan 2024 | 22 Feb 2027 |
| 907 | packagingyourpurpose.info | GoDaddy.com, LLC | 18 Jun 2015 | - | 18 Jun 2016 |
| 908 | packagingoriginal.com | 1&1 Internet AG | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 909 | packagingmaterial4u.com | Beijing Innovative Linkage Technology Ltd. dba dns… | 17 Sep 2012 | 20 Sep 2015 | 17 Sep 2016 |
| 910 | packagingquicap.com | Register.it SPA | 21 Jun 2015 | 21 Jun 2015 | 21 Jun 2016 |
| 911 | packaging-products.com | GoDaddy.com, LLC | 5 Nov 2024 | 5 Nov 2024 | 5 Nov 2025 |
| 912 | packagingmachineryadvisor.com | NameCheap, Inc. | 22 Jun 2015 | 23 May 2023 | 22 Jun 2024 |
| 913 | packagingequipmentadvisor.com | NameCheap, Inc. | 22 Jun 2015 | 3 Sep 2024 | 22 Jun 2024 |
| 914 | packagingnmore.com | GoDaddy.com, LLC | 21 Apr 2020 | 21 Apr 2020 | 21 Apr 2021 |
| 915 | packaging-label.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 21 Mar 2022 | 21 Mar 2022 | 21 Mar 2025 |
| 916 | packagingbag.org | Interweb Advertising D.B.A. Profile Builder | 7 Oct 2016 | 7 Oct 2016 | 7 Oct 2017 |
| 917 | packagingproductionline.com | HiChina Zhicheng Technology Limited | 25 Jun 2015 | 2 Aug 2020 | 25 Jun 2020 |
| 918 | packagingprocessingadvisor.com | NameCheap, Inc. | 26 Jun 2015 | 25 Jun 2024 | 26 Jun 2025 |
| 919 | packagingmadrid.com | Gandi SAS | 23 Apr 2019 | 23 Jan 2025 | 23 Apr 2025 |
| 920 | packagingmachineguide.com | HiChina Zhicheng Technology Limited | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2018 |
| 921 | packaginginnovationsconference.com | 1&1 Internet AG | 25 Jun 2015 | 4 Oct 2018 | 25 Jun 2025 |
| 922 | packaginginnovationconference.com | 1&1 Internet AG | 25 Jun 2015 | 17 Mar 2018 | 25 Jun 2025 |
| 923 | packagingforstartups.com | Metaregistrar BV Applications | 20 Dec 2024 | 25 Dec 2024 | 20 Dec 2025 |
| 924 | packagingfilmsexperts.com | Network Solutions, LLC | 26 Jun 2015 | 26 Jun 2017 | 26 Jun 2017 |
| 925 | packagingaccshop.com | GoDaddy.com, LLC | 22 Sep 2015 | 22 Sep 2015 | 22 Sep 2018 |
| 926 | packagingmaui.net | register.com, Inc. | 23 Sep 2015 | 24 Sep 2024 | 23 Sep 2025 |
| 927 | packagingbag5.com | HiChina Zhicheng Technology Limited | 24 Sep 2015 | 23 Aug 2024 | 24 Sep 2025 |
| 928 | packagingplastic.org | Tucows Domains Inc. | 29 Jun 2009 | 3 Jul 2015 | 29 Jun 2016 |
| 929 | packaginggrp.com | GoDaddy.com, LLC | 6 Sep 2023 | 6 Sep 2023 | 6 Sep 2024 |
| 930 | packaginglinedesignllc.com | Domain.com, LLC | 25 Sep 2015 | 5 Sep 2024 | 25 Sep 2025 |
| 931 | packagingitalia.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 7 Feb 2025 | 7 Feb 2025 | 7 Feb 2026 |
| 932 | packagingaustralia.com | TurnCommerce, Inc. DBA NameBright.com | 25 Sep 2015 | 19 Sep 2020 | 25 Sep 2025 |
| 933 | packaging-machineries.com | Beijing Lanhai Jiye Technology Co., Ltd | 3 Jul 2021 | 4 Sep 2024 | 3 Jul 2024 |
| 934 | packagingpartnersinc.com | GoDaddy.com, LLC | 9 Jul 2015 | 10 Jul 2020 | 9 Jul 2025 |
| 935 | packaging-marevi.com | Arsys Internet, S.L. dba NICLINE.COM | 9 Jul 2015 | 10 Jul 2024 | 9 Jul 2025 |
| 936 | packagingbase.com | GoDaddy.com, LLC | 25 Sep 2020 | 20 Sep 2024 | 25 Sep 2025 |
| 937 | packagingquote.info | Network Solutions, LLC | 13 Jul 2015 | 11 Jul 2017 | 13 Jul 2018 |
| 938 | packagingforprofessionals.com | One.com A/S | 15 Jul 2015 | 17 Jun 2024 | 15 Jul 2025 |
| 939 | packaging4professionals.com | One.com A/S | 15 Jul 2015 | 17 Jun 2024 | 15 Jul 2025 |
| 940 | packaging-for-professionals.com | One.com A/S | 15 Jul 2015 | 17 Jun 2024 | 15 Jul 2025 |
| 941 | packaging-4-professionals.com | One.com A/S | 15 Jul 2015 | 17 Jun 2024 | 15 Jul 2025 |
| 942 | packagingplusservices.com | Google, Inc. | 21 Mar 2023 | 20 Apr 2024 | 21 Mar 2024 |
| 943 | packagingcompanychicago.com | GoDaddy.com, LLC | 16 Jul 2015 | 16 Jul 2015 | 16 Jul 2016 |
| 944 | packagingcannabis.com | TurnCommerce, Inc. DBA NameBright.com | 9 Jan 2019 | 3 Jan 2021 | 9 Jan 2025 |
| 945 | packagingtalks.com | Namesilo, LLC | 31 Oct 2021 | 31 Jan 2025 | 31 Oct 2027 |
| 946 | packagingperformance.com | Hosting Concepts B.V. dba Openprovider | 18 Jun 2021 | 18 Jun 2021 | 18 Jun 2022 |
| 947 | packagingmanagement.org | NameCheap, Inc. | 25 Sep 2023 | 6 Nov 2024 | 25 Sep 2024 |
| 948 | packagingonthego.com | Webfusion Ltd. | 17 Jul 2015 | 18 Jul 2024 | 17 Jul 2025 |
| 949 | packaging-lpi.com | Domain.com, LLC | 17 Jul 2015 | 27 Jun 2024 | 17 Jul 2025 |
| 950 | packaging-depot.net | Domain.com, LLC | 19 Jul 2015 | 9 Mar 2017 | 19 Jul 2018 |
| 951 | packagingos.com | MarkMonitor Inc. | 28 Sep 2015 | 13 Jan 2025 | 28 Sep 2025 |
| 952 | packagingindustry.biz | BigRock Solutions Ltd. | 21 Jul 2015 | 21 Jul 2015 | 20 Jul 2016 |
| 953 | packagingsupplydiract.com | GoDaddy.com, LLC | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 954 | packaging-plastico.com | GoDaddy.com, LLC | 22 Jul 2015 | 17 Jan 2024 | 22 Jul 2026 |
| 955 | packagingexpressmi.com | Tucows Domains Inc. | 20 Jul 2010 | 24 Jul 2015 | 20 Jul 2016 |
| 956 | packagingcloud.com | GoDaddy.com, LLC | 23 Jul 2015 | 24 Jul 2024 | 23 Jul 2025 |
| 957 | packaging-alimentaire.com | Tucows Domains Inc. | 1 Oct 2024 | 1 Oct 2024 | 1 Oct 2025 |
| 958 | packagingthailand.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Sep 2024 | 5 Sep 2024 | 5 Sep 2025 |
| 959 | packagingrockstar.com | GoDaddy.com, LLC | 29 Sep 2015 | 29 Sep 2015 | 29 Sep 2018 |
| 960 | packaging4wine.com | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 961 | packagingmachine.info | Register.it SPA | 30 Oct 2015 | 30 Oct 2016 | 30 Oct 2017 |
| 962 | packagingremedy.com | Atak Domain Hosting Internet d/b/a Atak Teknoloji | 8 Aug 2022 | 8 Aug 2022 | 8 Aug 2023 |
| 963 | packaginggenie.com | TurnCommerce, Inc. DBA NameBright.com | 28 Sep 2019 | 22 Sep 2020 | 28 Sep 2025 |
| 964 | packagingboxessell.com | GoDaddy.com, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 965 | packagingnprinter.com | Network Solutions, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 966 | packaging-review.com | GoDaddy.com, LLC | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2017 |
| 967 | packagingboutique.net | GoDaddy.com, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 968 | packagingitems.com | GoDaddy.com, LLC | 2 Oct 2015 | 23 Aug 2024 | 22 Aug 2026 |
| 969 | packaginginsurance.com | GoDaddy.com, LLC | 7 Aug 2015 | 8 Aug 2023 | 7 Aug 2025 |
| 970 | packagingonly.com | DomainAdministration.com, LLC | 3 Oct 2015 | 18 Nov 2024 | 3 Oct 2025 |
| 971 | packagingmate.com | GoDaddy.com, LLC | 3 Oct 2015 | 20 Sep 2024 | 3 Oct 2025 |
| 972 | packagingproductscorp.com | GoDaddy.com, LLC | 21 Jun 1997 | 20 Jun 2024 | 20 Jun 2025 |
| 973 | packagingpersonified.com | Network Solutions, LLC | 18 Dec 1998 | 30 Mar 2023 | 18 Dec 2027 |
| 974 | packagingeurope.net | Hetzner Online AG | 19 Dec 2017 | 19 Dec 2017 | 19 Dec 2018 |
| 975 | packagingagricultural.net | Name.com, Inc. | 4 Oct 2015 | 4 Oct 2015 | 4 Oct 2016 |
| 976 | packagingagricultural.com | NameCheap, Inc. | 25 Apr 2022 | 26 Mar 2024 | 25 Apr 2025 |
| 977 | packagingdecoration.com | GoDaddy.com, LLC | 5 Oct 2015 | 6 Oct 2015 | 5 Oct 2016 |
| 978 | packagingdecoartion.com | - | - | - | - |
| 979 | packaging-magazine.com | Internet Domain Services BS Corp | 30 Nov 2019 | 30 Nov 2019 | 30 Nov 2020 |
| 980 | packagingcajas.com | Soluciones Corporativas IP, SLU | 6 Oct 2015 | 2 Aug 2017 | 6 Oct 2017 |
| 981 | packagingjobsintl.com | Webfusion Ltd. | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2017 |
| 982 | packagingjobsinternational.com | GoDaddy.com, LLC | 8 Oct 2015 | 20 Nov 2024 | 8 Oct 2025 |
| 983 | packagingmaterialslubbock.com | Tucows Domains Inc. | 6 Oct 2010 | 10 Oct 2015 | 6 Oct 2016 |
| 984 | packagingmachinemakers.com | GoDaddy.com, LLC | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 985 | packagingbags.org | Netowl, Inc. | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 986 | packaging-systems-sales.com | eNom, Inc. | 9 Oct 2015 | 9 Oct 2015 | 9 Oct 2016 |
| 987 | packaging-hub.com | GoDaddy.com, LLC | 20 May 2020 | 24 May 2024 | 20 May 2025 |
| 988 | packagingyourportfolio.com | GoDaddy.com, LLC | 11 Oct 2015 | 12 Oct 2024 | 11 Oct 2025 |
| 989 | packagingmachinesindia.net | Namesilo, LLC | 13 Jan 2020 | 14 Jan 2020 | 13 Jan 2021 |
| 990 | packagingsuppliers.net | HiChina Zhicheng Technology Limited | 14 Oct 2015 | 12 Oct 2016 | 14 Oct 2017 |
| 991 | packagingservicesexpo.com | NameCheap, Inc. | 14 Oct 2015 | 13 Oct 2024 | 14 Oct 2025 |
| 992 | packagingmachinerylines.com | Nics Telekomünikasyon Ticaret Ltd. Şti. | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 993 | packagingsourcing.net | GoDaddy.com, LLC | 16 Oct 2015 | 16 Oct 2015 | 16 Oct 2016 |
| 994 | packagingsourcing.com | GoDaddy.com, LLC | 16 Oct 2015 | 12 Oct 2024 | 16 Oct 2025 |
| 995 | packagingoftalmico.com | Tucows Domains Inc. | 16 Oct 2015 | 9 Oct 2024 | 16 Oct 2025 |
| 996 | packaginggoogle.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2018 |
| 997 | packagingebay.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2018 |
| 998 | packagingamazon.com | Chengdu West Dimension Digital Technology Co., Ltd… | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2018 |
| 999 | packagingcompanyltd.com | Mesh Digital Limited | 21 Oct 2015 | 21 Oct 2015 | 21 Oct 2016 |
| 1000 | packagingupdate.com | Corehub, S.R.L. | 22 Oct 2015 | 22 Oct 2023 | 22 Oct 2025 |
Displaying 1,000 out of 9,034 domains starting with the keyword "PACKAGING". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=packaging
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |