With support for 
Keyword: SALTLAKECITYWATERDAMAGE
Reverse Whois » KEYWORD [saltlakecitywaterdamage ] { 9 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | saltlakecitywaterdamage.net | GoDaddy.com, LLC | 25 Jun 2020 | 26 Jun 2024 | 25 Jun 2025 |
| 2 | saltlakecitywaterdamage.com | DropCatch.com 899 LLC | 5 Sep 2023 | 16 Oct 2024 | 5 Sep 2024 |
| 3 | saltlakecitywaterdamage.us | GoDaddy.com, LLC | 14 Oct 2020 | 20 Oct 2024 | 14 Oct 2025 |
| 4 | saltlakecitywaterdamageservices.com | eNom, Inc. | 22 Feb 2016 | 22 Feb 2016 | 22 Feb 2017 |
| 5 | saltlakecitywaterdamagepros.com | GoDaddy.com, LLC | 10 Mar 2016 | 10 Mar 2016 | 10 Mar 2017 |
| 6 | saltlakecitywaterdamagerestoration.com | DropCatch.com 1248 LLC | 14 May 2024 | 14 May 2024 | 14 May 2025 |
| 7 | saltlakecitywaterdamagecompany.com | Moniker Online Services LLC | 30 May 2012 | 31 May 2017 | 30 May 2018 |
| 8 | saltlakecitywaterdamagerepair.com | GoDaddy.com, LLC | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 9 | saltlakecitywaterdamageandrestoration.com | NameCheap, Inc. | 18 Mar 2023 | 7 Mar 2024 | 18 Mar 2025 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=saltlakecitywaterdamage
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |