With support for 
Keyword: SATELLITES
Reverse Whois » KEYWORD [satellites ] { 1,376 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | satellites.co.uk | - | 30 Apr 1997 | 3 Sep 2024 | 30 Apr 2025 |
| 2 | satellites.me | Global Domains International, Inc. DBA DomainCostC… | 1 May 2017 | 30 Jun 2017 | 1 May 2018 |
| 3 | satellites.biz | NameKing.com Inc. | 16 Jan 2024 | 22 Dec 2024 | 16 Jan 2026 |
| 4 | satellites.space | Uniregistrar Corp | 28 Jan 2015 | 6 Jun 2024 | 28 Jan 2026 |
| 5 | satellites.top | Dynadot, LLC | 20 Sep 2021 | 7 Dec 2021 | 20 Sep 2022 |
| 6 | satellites.moe | GoDaddy.com, LLC | 3 Mar 2015 | 5 Jun 2024 | 2 Mar 2025 |
| 7 | satellites.club | Global Domains International, Inc. DBA DomainCostC… | 8 Dec 2018 | 8 Dec 2018 | 8 Dec 2019 |
| 8 | satellites.website | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 9 | satellites.world | GoDaddy.com, LLC | 3 Aug 2020 | 17 Sep 2024 | 3 Aug 2025 |
| 10 | satellites.ovh | OVH sas | 18 Dec 2015 | 18 Dec 2015 | 18 Dec 2016 |
| 11 | satellites.net | TurnCommerce, Inc. DBA NameBright.com | 9 Sep 1999 | 1 Aug 2024 | 9 Sep 2025 |
| 12 | satellites.online | NameCheap, Inc. | 21 Jan 2016 | 21 Jan 2016 | 21 Jan 2017 |
| 13 | satellites.site | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 14 | satellites.mobi | GoDaddy.com, LLC | 8 Feb 2016 | 4 Feb 2017 | 8 Feb 2018 |
| 15 | satellites.tech | GMO Internet Inc. | 10 Mar 2016 | 10 Mar 2016 | 10 Mar 2017 |
| 16 | satellites.com | GoDaddy.com, LLC | 22 May 1995 | 30 Dec 2024 | 23 May 2026 |
| 17 | satellites.social | eNom, Inc. | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 18 | satellites.rent | - | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 19 | satellites.company | GoDaddy.com, LLC | 3 Jul 2016 | 3 Jul 2016 | 3 Jul 2017 |
| 20 | satellites.guru | Uniregistrar Corp | 5 Feb 2014 | 29 Apr 2017 | 5 Feb 2018 |
| 21 | satellites.sexy | Name.com, Inc. | 5 Jun 2014 | 18 May 2017 | 5 Jun 2018 |
| 22 | satellites.international | Uniregistrar Corp | 9 Apr 2014 | 10 Jun 2024 | 9 Apr 2028 |
| 23 | satellites.lol | Name.com, Inc. | 12 Aug 2015 | 26 Jul 2017 | 12 Aug 2018 |
| 24 | satellites.link | Uniregistrar Corp | 15 Apr 2014 | 11 May 2016 | 15 Apr 2017 |
| 25 | satellites.tel | Namesilo, LLC | 13 Jan 2023 | 12 Feb 2024 | 13 Jan 2024 |
| 26 | satellites.technology | Uniregistrar Corp | 4 Sep 2016 | 9 Sep 2024 | 4 Sep 2026 |
| 27 | satellites.equipment | Uniregistrar Corp | 4 Sep 2016 | 9 Sep 2024 | 4 Sep 2026 |
| 28 | satellites.contractors | Uniregistrar Corp | 9 Sep 2016 | 9 Sep 2024 | 9 Sep 2026 |
| 29 | satellites.info | GoDaddy.com, LLC | 18 Sep 2001 | 2 Nov 2024 | 18 Sep 2025 |
| 30 | satellites.org | Dynadot, LLC | 14 Dec 2000 | 16 Dec 2024 | 14 Dec 2025 |
| 31 | satellites.us | GoDaddy.com, LLC | 24 Apr 2002 | 16 May 2017 | 23 Apr 2018 |
| 32 | satellites.xyz | TLD Registrar Solutions Ltd. | 3 Dec 2014 | 16 Jan 2025 | 3 Dec 2029 |
| 33 | satellites.de | - | - | 16 Mar 2022 | - |
| 34 | satellites.cc | HiChina Zhicheng Technology Limited | 1 Mar 2019 | 8 Mar 2024 | 1 Mar 2025 |
| 35 | satellites.ltd | Chengdu West Dimension Digital Technology Co., Ltd… | 17 Oct 2017 | 17 Oct 2024 | 17 Oct 2025 |
| 36 | satellites.solutions | Google, Inc. | 27 Dec 2017 | 27 Dec 2017 | 27 Dec 2018 |
| 37 | satellites.live | CommuniGal Communication Ltd. | 13 Apr 2024 | 18 Apr 2024 | 13 Apr 2025 |
| 38 | satellites.network | Namesilo, LLC | 12 Mar 2024 | 17 Mar 2024 | 12 Mar 2025 |
| 39 | satellites.services | Name.com, Inc. | 9 Mar 2018 | 5 May 2018 | 9 Mar 2019 |
| 40 | satellites.systems | Porkbun, LLC | 29 Jun 2022 | 11 Jul 2023 | 29 Jun 2024 |
| 41 | satellites.solar | Name.com, Inc. | 9 Mar 2018 | 5 May 2018 | 9 Mar 2019 |
| 42 | satellites.cloud | GoDaddy.com, LLC | 11 Sep 2018 | 11 Sep 2018 | 11 Sep 2019 |
| 43 | satellites.pro | Limited Liability Company "Registrar of domain nam… | 28 Dec 2017 | 11 Feb 2025 | 28 Dec 2026 |
| 44 | satellites.dev | 1API GmbH | 11 May 2021 | 25 Jun 2024 | 11 May 2025 |
| 45 | satellites.life | Dynadot, LLC | 10 Sep 2022 | 10 Sep 2023 | 10 Sep 2024 |
| 46 | satellites.ruhr | 1&1 Internet AG | 21 Oct 2020 | 30 Jan 2025 | 21 Oct 2025 |
| 47 | satellites.love | Google, Inc. | 21 Apr 2021 | 6 Jun 2024 | 21 Apr 2025 |
| 48 | satellites.cfd | Porkbun, LLC | 30 Apr 2021 | 3 May 2021 | 30 Apr 2022 |
| 49 | satellites.group | Mesh Digital Limited | 13 Oct 2021 | 17 Oct 2024 | 13 Oct 2025 |
| 50 | satellites.sbs | Porkbun, LLC | 10 Nov 2021 | 10 Nov 2021 | 10 Nov 2022 |
| 51 | satellites.asia | Porkbun, LLC | 2 Feb 2022 | 4 Feb 2022 | 2 Feb 2023 |
| 52 | satellites.direct | Network Solutions, LLC | 8 May 2022 | 20 Jul 2023 | 8 May 2023 |
| 53 | satellites.digital | GoDaddy.com, LLC | 8 May 2022 | 19 Jul 2023 | 8 May 2023 |
| 54 | satellites.bz | Network Solutions, LLC | 28 Aug 2006 | 2 Nov 2024 | 28 Aug 2024 |
| 55 | satellites.run | Porkbun, LLC | 29 Jun 2022 | 11 Jul 2023 | 29 Jun 2024 |
| 56 | satellites.icu | NameCheap, Inc. | 1 Dec 2019 | 13 Dec 2021 | 1 Dec 2023 |
| 57 | satellites.app | NameKing.com Inc. | 17 Apr 2024 | 28 Jan 2025 | 17 Apr 2025 |
| 58 | satellites.eu.com | NameCheap, Inc. | 17 Jul 2022 | 27 Sep 2023 | 17 Jul 2023 |
| 59 | satellites.fun | Hostinger, UAB | 26 Feb 2023 | 3 Apr 2024 | 26 Feb 2024 |
| 60 | satellites.adult | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 61 | satellites.agency | NameCheap, Inc. | 23 Dec 2024 | 28 Dec 2024 | 23 Dec 2025 |
| 62 | satellites.army | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 63 | satellites.attorney | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 64 | satellites.associates | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 65 | satellites.auction | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 66 | satellites.band | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 67 | satellites.bar | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 68 | satellites.beer | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 69 | satellites.best | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 70 | satellites.bingo | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 71 | satellites.bike | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 72 | satellites.bio | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 73 | satellites.boutique | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 74 | satellites.builders | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 75 | satellites.business | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 76 | satellites.cafe | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 77 | satellites.cam | Porkbun, LLC | 23 Mar 2024 | 18 Jun 2024 | 23 Mar 2025 |
| 78 | satellites.camera | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 79 | satellites.camp | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 80 | satellites.capital | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 81 | satellites.care | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 82 | satellites.center | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 83 | satellites.ceo | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 84 | satellites.chat | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 85 | satellites.cheap | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 86 | satellites.church | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 87 | satellites.city | NameCheap, Inc. | 15 Jul 2023 | 26 Aug 2024 | 15 Jul 2024 |
| 88 | satellites.claims | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 89 | satellites.cleaning | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 90 | satellites.clinic | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 91 | satellites.clothing | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 92 | satellites.coach | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 93 | satellites.codes | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 94 | satellites.coffee | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 95 | satellites.condos | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 96 | satellites.construction | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 97 | satellites.faith | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 98 | satellites.ink | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 99 | satellites.airforce | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 100 | satellites.baby | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 101 | satellites.navy | NameCheap, Inc. | 15 Mar 2023 | 15 Mar 2023 | 15 Mar 2024 |
| 102 | satellites.wiki | GoDaddy.com, LLC | 25 Feb 2025 | 25 Feb 2025 | 25 Feb 2026 |
| 103 | satellites.earth | GoDaddy.com, LLC | 18 Dec 2019 | 22 Dec 2024 | 18 Dec 2025 |
| 104 | satellites.it | - | 26 Jun 2011 | 18 Jul 2024 | 2 Jul 2025 |
| 105 | satellites.news | GoDaddy.com, LLC | 21 Apr 2023 | 2 Jul 2024 | 21 Apr 2024 |
| 106 | satellites.one | - | 31 Jul 2024 | 18 Sep 2024 | 31 Jul 2025 |
| 107 | satellites.co.nz | - | 5 May 2016 | 31 Oct 2022 | - |
| 108 | satellites.observer | Gandi SAS | 5 Apr 2018 | 21 May 2024 | 5 Apr 2025 |
| 109 | satellites.casa | Dynadot, LLC | 27 Apr 2023 | 27 Apr 2024 | 27 Apr 2024 |
| 110 | satellites.media | Namesilo, LLC | 31 May 2023 | 15 Nov 2024 | 31 May 2025 |
| 111 | satellites.ro | - | 12 Jun 2019 | - | 10 Jun 2025 |
| 112 | satellites.airbus | CSC Corporate Domains, Inc. | 29 Oct 2024 | 3 Nov 2024 | 29 Oct 2025 |
| 113 | satellites.design | NameCheap, Inc. | 12 Sep 2023 | 27 Sep 2024 | 12 Sep 2024 |
| 114 | satellites.studio | GoDaddy.com, LLC | 18 May 2020 | 2 Jul 2024 | 18 May 2025 |
| 115 | satellites.uk | - | 4 Jul 2019 | 24 Jan 2025 | 4 Jul 2025 |
| 116 | satellites.ru | - | 13 Feb 2005 | - | 13 Feb 2026 |
| 117 | satellites.dk | - | 29 May 2019 | - | 31 May 2025 |
| 118 | satellites.su | - | 20 Aug 2024 | - | 20 Aug 2025 |
| 119 | satellitesales.com | GoDaddy.com, LLC | 25 Aug 2002 | 26 Aug 2024 | 25 Aug 2025 |
| 120 | satellitesolutions.com | NameCheap, Inc. | 14 Nov 2003 | 15 Oct 2024 | 14 Nov 2025 |
| 121 | satellitesuperstore.com | Tucows Domains Inc. | 8 Mar 2000 | 4 Mar 2024 | 8 Mar 2026 |
| 122 | satelliteshopper.net | GoDaddy.com, LLC | 30 May 2013 | 31 May 2015 | 30 May 2016 |
| 123 | satelliteselections.com | GoDaddy.com, LLC | 6 Mar 2005 | 30 Jan 2010 | 6 Mar 2019 |
| 124 | satelliteshelters.com | eNom, Inc. | 12 Jun 1999 | 13 Jun 2024 | 12 Jun 2025 |
| 125 | satellitestrategy.com | Tucows Domains Inc. | 30 Dec 2023 | 15 Dec 2024 | 30 Dec 2025 |
| 126 | satelliteshack.com | GoDaddy.com, LLC | 16 Jul 2003 | 16 Jul 2024 | 16 Jul 2025 |
| 127 | satellitesoftware.com | GoDaddy.com, LLC | 21 Jun 2002 | 1 Jun 2024 | 21 Jun 2025 |
| 128 | satellitesearch.com | GoDaddy.com, LLC | 7 Jan 2000 | 11 Sep 2024 | 1 Oct 2025 |
| 129 | satellitesuccess.com | eNom, Inc. | 10 Aug 2013 | 15 Jul 2017 | 10 Aug 2017 |
| 130 | satellitesensors.com | Dynadot, LLC | 24 Nov 2023 | 22 Dec 2024 | 24 Nov 2025 |
| 131 | satellitesystemscorp.com | GoDaddy.com, LLC | 29 May 2018 | 30 May 2024 | 29 May 2025 |
| 132 | satellitesolutionshi.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 133 | satellitesolutionshawaii.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 134 | satelliteschools.com | GoDaddy.com, LLC | 30 Jun 2004 | 2 Jul 2024 | 30 Jun 2025 |
| 135 | satellitespeed.com | GoDaddy.com, LLC | 5 Jun 2023 | 6 Jun 2024 | 5 Jun 2025 |
| 136 | satellitesurvey.com | TurnCommerce, Inc. DBA NameBright.com | 19 Dec 2014 | 7 Oct 2024 | 19 Dec 2025 |
| 137 | satellitestv.com | GoDaddy.com, LLC | 20 Jan 2024 | 25 Jan 2025 | 20 Jan 2026 |
| 138 | satellitesources.net | GoDaddy.com, LLC | 14 Apr 2006 | 7 Aug 2024 | 14 Apr 2025 |
| 139 | satellitesystem.net | Dynadot, LLC | 30 Dec 2000 | 31 Dec 2016 | 30 Dec 2017 |
| 140 | satellitesystem.org | Dynadot, LLC | 1 Jan 2001 | 10 Feb 2015 | 1 Jan 2016 |
| 141 | satellitesolar.com | Annulet LLC | 18 Jan 2016 | 6 Mar 2024 | 18 Jan 2025 |
| 142 | satellitespecialist.com | TurnCommerce, Inc. DBA NameBright.com | 10 Dec 2001 | 12 Dec 2024 | 10 Dec 2025 |
| 143 | satellitesunlimited.com | eNom, Inc. | 13 May 1998 | 11 May 2024 | 12 May 2025 |
| 144 | satellitesystemscorporation.net | GoDaddy.com, LLC | 29 May 2018 | 30 May 2024 | 29 May 2025 |
| 145 | satellitesystemscorp.net | GoDaddy.com, LLC | 29 May 2018 | 30 May 2024 | 29 May 2025 |
| 146 | satelliteselfstorage.com | Network Solutions, LLC | 17 Oct 1997 | 30 Aug 2020 | 16 Oct 2025 |
| 147 | satellitespecialoffer.com | Wild West Domains, LLC | 20 Mar 2007 | 16 Apr 2015 | 20 Mar 2016 |
| 148 | satellitesource.com | GoDaddy.com, LLC | 24 Dec 2001 | 4 Dec 2024 | 24 Dec 2025 |
| 149 | satellitestarinternet.com | Brandsight, Inc. | 8 Aug 2008 | 2 Jan 2025 | 2 Feb 2026 |
| 150 | satelliteseeing.com | Dynadot, LLC | 16 Feb 2007 | 17 Jan 2015 | 16 Feb 2016 |
| 151 | satelliteservicesodeassa.com | GoDaddy.com, LLC | 6 Jun 2014 | 7 Jun 2015 | 6 Jun 2016 |
| 152 | satellitespaceselfies.com | Realtime Register B.V. | 4 Nov 2014 | 29 Mar 2017 | 4 Nov 2017 |
| 153 | satellitespaceselfie.com | Realtime Register B.V. | 4 Nov 2014 | 29 Mar 2017 | 4 Nov 2017 |
| 154 | satellitesalesspecial.com | GoDaddy.com, LLC | 14 Jun 2010 | 15 Jun 2015 | 14 Jun 2016 |
| 155 | satellitesalesoffer.com | GoDaddy.com, LLC | 14 Jun 2010 | 15 Jun 2015 | 14 Jun 2016 |
| 156 | satellitesalesspecials.com | GoDaddy.com, LLC | 14 Jun 2010 | 15 Jun 2015 | 14 Jun 2016 |
| 157 | satellitesalesoffers.com | GoDaddy.com, LLC | 14 Jun 2010 | 15 Jun 2015 | 14 Jun 2016 |
| 158 | satellitestaff.com | GoDaddy.com, LLC | 3 Sep 2019 | 3 Sep 2019 | 3 Sep 2020 |
| 159 | satellitesmendoza.com | Wild West Domains, LLC | 16 Jun 2014 | 17 Jun 2015 | 16 Jun 2016 |
| 160 | satellitesolutionsuk.com | GoDaddy.com, LLC | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 161 | satellitespaceselfies.org | Mijn InternetOplossing B.V. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 162 | satellitespaceselfie.org | Mijn InternetOplossing B.V. | 4 Nov 2014 | 4 Nov 2014 | 4 Nov 2015 |
| 163 | satellitespecials.com | GoDaddy.com, LLC | 28 Feb 2015 | 24 Mar 2024 | 28 Feb 2025 |
| 164 | satellitesourcing.com | GoDaddy.com, LLC | 12 Dec 2020 | 7 Dec 2022 | 12 Dec 2027 |
| 165 | satellitescompare.com | DomainContext, Inc. | 13 Aug 2014 | 13 Aug 2014 | 13 Aug 2015 |
| 166 | satellitesdirecttv.com | GoDaddy.com, LLC | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 167 | satellitestartup.com | GoDaddy.com, LLC | 15 Feb 2024 | 15 Feb 2025 | 15 Feb 2026 |
| 168 | satellitesalesrs.net | 1API GmbH | 14 Aug 2014 | 24 Mar 2017 | 14 Aug 2018 |
| 169 | satelliteswift.com | GoDaddy.com, LLC | 1 Jan 2015 | 2 Jan 2025 | 1 Jan 2026 |
| 170 | satellitesixteen.com | FastDomain Inc. | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 171 | satelliteservicesault.com | Tucows Domains Inc. | 27 Aug 2011 | 31 Aug 2014 | 27 Aug 2015 |
| 172 | satellitesmartphone.com | Namesilo, LLC | 30 Aug 2022 | 17 Aug 2024 | 30 Aug 2025 |
| 173 | satellitesensor.com | Dynadot, LLC | 4 Dec 2023 | 22 Dec 2024 | 4 Dec 2025 |
| 174 | satelliteshowertrailers.com | GoDaddy.com, LLC | 8 Sep 2014 | 20 Oct 2024 | 8 Sep 2024 |
| 175 | satellitesystemshawaii.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2016 |
| 176 | satellitesystemshi.com | GoDaddy.com, LLC | 2 Oct 2014 | 2 Oct 2014 | 2 Oct 2016 |
| 177 | satellitestars.com | TurnCommerce, Inc. DBA NameBright.com | 5 Oct 2014 | 29 Sep 2020 | 5 Oct 2025 |
| 178 | satellitesystemsinc.com | GoDaddy.com, LLC | 7 Sep 2021 | 27 Jul 2024 | 15 Jun 2024 |
| 179 | satellitespectrum.com | Annulet LLC | 1 May 2019 | 18 Jun 2024 | 1 May 2025 |
| 180 | satellitesmarttv.com | GoDaddy.com, LLC | 23 Nov 2014 | 24 Nov 2016 | 23 Nov 2017 |
| 181 | satellitespynetwork.com | GoDaddy.com, LLC | 11 Oct 2014 | 11 Oct 2014 | 11 Oct 2016 |
| 182 | satellitesecurite.com | OVH sas | 24 Nov 2014 | 24 Nov 2014 | 24 Nov 2015 |
| 183 | satellitesystemsmalta.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Nov 2014 | 27 Nov 2014 | 27 Nov 2015 |
| 184 | satellitesleuth.com | Google, Inc. | 28 Nov 2014 | 13 Nov 2024 | 28 Nov 2025 |
| 185 | satellitesolutions.us | Tucows Domains Inc. | 27 Mar 2024 | 1 Apr 2024 | 27 Mar 2025 |
| 186 | satellitescheduler.com | Google, Inc. | 4 Aug 2018 | 4 Aug 2018 | 4 Aug 2019 |
| 187 | satellitescope.com | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2024 | 9 Dec 2025 |
| 188 | satellitesupplyco.com | GoDaddy.com, LLC | 9 Dec 2014 | 15 Dec 2024 | 9 Dec 2025 |
| 189 | satellitesuperstore.info | eNom, Inc. | 17 Dec 2014 | 27 Mar 2017 | 17 Dec 2017 |
| 190 | satellitesites.net | Key-Systems GmbH | 18 Dec 2014 | 17 Dec 2016 | 18 Dec 2017 |
| 191 | satellitesrus.net | GoDaddy.com, LLC | 24 Mar 2024 | 27 Mar 2024 | 24 Mar 2025 |
| 192 | satellitestation.us | GoDaddy.com, LLC | 23 Dec 2014 | 8 Jan 2017 | 22 Dec 2018 |
| 193 | satellitesalesstars.com | register.com, Inc. | 26 Dec 2014 | 26 Dec 2016 | 26 Dec 2017 |
| 194 | satellitesyndrome.com | DropCatch.com 952 LLC | 16 Mar 2016 | 17 Mar 2017 | 16 Mar 2018 |
| 195 | satellitesamurai.ninja | Mesh Digital Limited | 29 Jun 2014 | 10 Jan 2017 | 29 Jun 2017 |
| 196 | satelliteservicesofdaytona.xyz | Network Solutions, LLC | 17 Jul 2014 | 17 Jul 2014 | 17 Jul 2015 |
| 197 | satellitesuperstores.xyz | Network Solutions, LLC | 23 Jun 2014 | 24 Jun 2014 | 23 Jun 2015 |
| 198 | satellitescience.xyz | Network Solutions, LLC | 5 Jun 2014 | 6 Jun 2014 | 5 Jun 2015 |
| 199 | satelliteservice.center | InterNetworX Ltd. & Co. KG | 19 Apr 2016 | 4 May 2017 | 19 Apr 2018 |
| 200 | satellitestation.guru | GoDaddy.com, LLC | 23 Dec 2014 | 6 Feb 2020 | 23 Dec 2020 |
| 201 | satellitesignature.net | Google, Inc. | 14 Aug 2015 | 13 Sep 2024 | 14 Aug 2024 |
| 202 | satellitesandstereos.band | Crazy Domains FZ-LLC | 12 Apr 2015 | 12 Apr 2015 | 12 Apr 2016 |
| 203 | satellitestage.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2017 |
| 204 | satellitesinasia.com | eNom, Inc. | 14 Aug 2015 | 19 Jul 2017 | 14 Aug 2017 |
| 205 | satellitesignature.org | Google, Inc. | 14 Aug 2015 | 14 Aug 2024 | 14 Aug 2025 |
| 206 | satellitesecrets.org | eNom, Inc. | 14 Aug 2015 | 16 Jul 2017 | 14 Aug 2018 |
| 207 | satellitesecrets.net | eNom, Inc. | 14 Aug 2015 | 16 Jul 2017 | 14 Aug 2018 |
| 208 | satellitesecrets.com | DropCatch.com 1536 LLC | 1 Nov 2018 | 1 Nov 2018 | 1 Nov 2019 |
| 209 | satellitesecret.com | Annulet LLC | 1 Nov 2018 | 2 Nov 2024 | 1 Nov 2025 |
| 210 | satellitesite.org | Tucows Domains Inc. | 4 Jan 2009 | 8 Jan 2015 | 4 Jan 2016 |
| 211 | satellitesunlimited-mo.com | Tucows Domains Inc. | 12 Aug 2011 | 16 Aug 2015 | 12 Aug 2016 |
| 212 | satellitesin.space | CloudFlare, Inc. | 30 Jan 2023 | 5 Jan 2025 | 30 Jan 2026 |
| 213 | satellitesafeprotect.com | Tucows Domains Inc. | 19 Jan 2015 | 19 Jan 2015 | 19 Jan 2016 |
| 214 | satellitesolar.info | GoDaddy.com, LLC | 17 Aug 2015 | - | 17 Aug 2016 |
| 215 | satellitescomic.com | Google, Inc. | 22 Jan 2015 | 22 Jan 2025 | 22 Jan 2025 |
| 216 | satellitesolutionsgroup.com | GoDaddy.com, LLC | 19 Jan 2019 | 17 Oct 2022 | 19 Jan 2029 |
| 217 | satellitesdirect.net | Network Solutions, LLC | 28 Jan 2015 | 3 Jan 2025 | 28 Jan 2027 |
| 218 | satellitesurvey.net | Mesh Digital Limited | 3 Feb 2015 | 19 Jan 2017 | 3 Feb 2018 |
| 219 | satellitestudy.us | eNom, Inc. | 3 Feb 2015 | 3 Feb 2015 | 2 Feb 2016 |
| 220 | satellitesigna.com | OnlineNIC, Inc. | 6 Feb 2015 | 6 Feb 2015 | 6 Feb 2016 |
| 221 | satellitesaustralia.com | - | - | - | - |
| 222 | satellitestreamtv.com | 1&1 Internet AG | 9 Feb 2015 | 9 Feb 2015 | 9 Feb 2016 |
| 223 | satellitesignatures.com | Google, Inc. | 9 Feb 2015 | 26 Jan 2025 | 9 Feb 2026 |
| 224 | satellitescience.org | GMO Internet Inc. | 24 Jul 2017 | 24 Jul 2017 | 24 Jul 2018 |
| 225 | satellitesynapse.com | GoDaddy.com, LLC | 14 Feb 2015 | 15 Feb 2024 | 14 Feb 2025 |
| 226 | satellitesolutionsofnorthermichigan.com | register.com, Inc. | 21 Aug 2015 | 21 Aug 2015 | 21 Aug 2017 |
| 227 | satellitesteve.org | GoDaddy.com, LLC | 18 Feb 2015 | 2 Feb 2017 | 18 Feb 2018 |
| 228 | satellitesolutionsnorthernmi.com | register.com, Inc. | 19 Feb 2015 | 19 Feb 2015 | 19 Feb 2016 |
| 229 | satellitesweethearts.com | Tucows Domains Inc. | 22 Feb 2015 | 26 Feb 2017 | 22 Feb 2017 |
| 230 | satellitesavvy.org | NameCheap, Inc. | 14 Jul 2017 | 14 Jul 2017 | 14 Jul 2018 |
| 231 | satellitesouthernil.com | Tucows Domains Inc. | 19 Aug 2010 | 23 Aug 2015 | 19 Aug 2016 |
| 232 | satellites-for-nonproliferation.org | Wild West Domains, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 233 | satellitesapps.com | RegistryGate GmbH | 26 Feb 2015 | 27 Feb 2017 | 26 Feb 2018 |
| 234 | satellitesecurityconnections.com | register.com, Inc. | 27 Feb 2015 | 27 Feb 2015 | 27 Feb 2016 |
| 235 | satellitesweeper.com | - | 11 Apr 2024 | 30 Dec 2024 | 11 Apr 2025 |
| 236 | satellitesites.info | GoDaddy.com, LLC | 16 Mar 2015 | 17 Mar 2015 | 16 Mar 2016 |
| 237 | satellitesite2.info | GoDaddy.com, LLC | 16 Mar 2015 | 17 Mar 2015 | 16 Mar 2016 |
| 238 | satellitesite1.info | GoDaddy.com, LLC | 16 Mar 2015 | 17 Mar 2015 | 16 Mar 2016 |
| 239 | satellitesources.com | Fabulous.com Pty Ltd. | 15 Feb 2005 | 31 Jan 2025 | 15 Feb 2026 |
| 240 | satellitesatellite.org | GMO Internet Inc. | 23 Mar 2015 | 16 Feb 2017 | 23 Mar 2018 |
| 241 | satellitesat.com | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Dec 2022 | 20 Jan 2024 | 13 Dec 2023 |
| 242 | satelliteseeker.com | NameCheap, Inc. | 8 Oct 2021 | - | 8 Oct 2022 |
| 243 | satellitesguy.com | GoDaddy.com, LLC | 27 Mar 2015 | 27 Mar 2015 | 27 Mar 2016 |
| 244 | satellitescanner.com | GoDaddy.com, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 245 | satellitesuitcase.com | Xin Net Technology Corporation | 15 Oct 2018 | 19 Oct 2024 | 15 Oct 2025 |
| 246 | satelliteshome.com | eNom, Inc. | 8 Apr 2015 | 8 Apr 2015 | 8 Apr 2016 |
| 247 | satellitesfindpets.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 248 | satelliteseattle.com | GMO Internet Inc. | 2 Jul 2021 | 2 Jul 2021 | 2 Jul 2022 |
| 249 | satellitescoop.com | Sitefrenzy.com LLC | 9 Apr 2015 | 9 Apr 2015 | 9 Apr 2016 |
| 250 | satellitesnaija.com | GoDaddy.com, LLC | 10 Apr 2015 | 10 Apr 2015 | 10 Apr 2016 |
| 251 | satelliteseattle.org | GoDaddy.com, LLC | 9 Apr 2015 | 10 Apr 2017 | 9 Apr 2018 |
| 252 | satellitesolutionsworldwidegroupplc.com | Tucows Domains Inc. | 13 Apr 2015 | 17 Apr 2020 | 13 Apr 2020 |
| 253 | satellitesolutionsworldwidegroup.com | Tucows Domains Inc. | 13 Apr 2015 | 17 Apr 2020 | 13 Apr 2020 |
| 254 | satellitesymposium2015.org | Name.com, Inc. | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 255 | satellites-nonproliferation.org | FastDomain Inc. | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 256 | satelliteselfie.com | GoDaddy.com, LLC | 12 Mar 2018 | 13 Mar 2024 | 12 Mar 2025 |
| 257 | satelliteshare.com | GoDaddy.com, LLC | 12 Feb 2020 | 24 Jan 2025 | 12 Feb 2026 |
| 258 | satellitesavvy.com | GoDaddy.com, LLC | 11 Aug 2021 | 29 Jul 2024 | 11 Aug 2025 |
| 259 | satellitestemcell.com | DreamHost, LLC | 24 Nov 2017 | 24 Nov 2017 | 24 Nov 2018 |
| 260 | satellitesmoothies.com | Gandi SAS | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 261 | satellitestone.com | GoDaddy.com, LLC | 10 May 2015 | 10 May 2015 | 10 May 2016 |
| 262 | satelliteswarm.com | GoDaddy.com, LLC | 4 Feb 2023 | 29 Jan 2025 | 4 Feb 2026 |
| 263 | satellitesolutionsworldwide-ir.com | Tucows Domains Inc. | 11 May 2015 | 15 May 2018 | 11 May 2018 |
| 264 | satellitestars.org | Tucows Domains Inc. | 25 May 2020 | 15 May 2024 | 25 May 2025 |
| 265 | satelliteservicesaver.com | GoDaddy.com, LLC | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 266 | satellitesectors.com | eNom, Inc. | 25 May 2015 | 7 Jul 2017 | 25 May 2017 |
| 267 | satellitesector.com | DropCatch.com 402 LLC | 13 Aug 2017 | 13 Aug 2017 | 13 Aug 2018 |
| 268 | satellitesun.com | TurnCommerce, Inc. DBA NameBright.com | 27 Apr 2018 | 21 Apr 2021 | 27 Apr 2025 |
| 269 | satellitesector.org | eNom, Inc. | 25 May 2015 | 7 Jul 2017 | 25 May 2018 |
| 270 | satellitesector.net | eNom, Inc. | 25 May 2015 | 7 Jul 2017 | 25 May 2017 |
| 271 | satellitesandmoresi.com | Tucows Domains Inc. | 28 May 2014 | 1 Jun 2015 | 28 May 2016 |
| 272 | satelliteshots.com | eNom, Inc. | 12 Nov 2017 | 12 Nov 2017 | 12 Nov 2019 |
| 273 | satelliteshelter.com | Azprivatez LLC | 23 Aug 2020 | 8 Oct 2024 | 23 Aug 2025 |
| 274 | satellitesource.net | GoDaddy.com, LLC | 16 Mar 2021 | 26 Apr 2024 | 16 Mar 2024 |
| 275 | satellitesfall.com | Tucows Domains Inc. | 1 Apr 2023 | 30 Nov 2023 | 1 Apr 2025 |
| 276 | satellites-internet.com | RegistryGate GmbH | 11 Jun 2015 | 16 Jul 2017 | 11 Jun 2018 |
| 277 | satelliteseminars.com | register.com, Inc. | 18 Sep 2015 | 19 Sep 2024 | 18 Sep 2025 |
| 278 | satellitesafety.com | GoDaddy.com, LLC | 26 Jun 2015 | 27 Jun 2024 | 26 Jun 2026 |
| 279 | satellitesales.org | Azdomainz LLC | 28 Jun 2015 | 29 Jun 2017 | 28 Jun 2018 |
| 280 | satellitestockbridge.com | GoDaddy.com, LLC | 23 Sep 2015 | 7 Oct 2023 | 23 Sep 2025 |
| 281 | satellitestadium.com | NameCheap, Inc. | 12 Nov 2024 | 12 Nov 2024 | 12 Nov 2025 |
| 282 | satellitestunner.com | 1&1 Internet AG | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 283 | satellitestores.com | GoDaddy.com, LLC | 13 Oct 2021 | 13 Oct 2021 | 13 Oct 2022 |
| 284 | satellites-xml.com | GoDaddy.com, LLC | 25 Sep 2015 | 26 Sep 2024 | 25 Sep 2025 |
| 285 | satellitesystemscorporation.com | GoDaddy.com, LLC | 11 Jul 2007 | 12 Jul 2024 | 11 Jul 2025 |
| 286 | satellitespycam.com | eNom, Inc. | 18 Jul 2015 | 18 Jul 2015 | 18 Jul 2016 |
| 287 | satellitesweeps.com | DOMAIN NAME NETWORK PTY LTD | 4 Aug 2021 | 4 Aug 2021 | 4 Aug 2022 |
| 288 | satellitespycamera.com | Name.com, Inc. | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 289 | satelliteservices.us | Wild West Domains, LLC | 30 May 2024 | 4 Jun 2024 | 30 May 2025 |
| 290 | satellitesplusmore.com | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 1 Oct 2015 | 2 Oct 2015 | 1 Oct 2016 |
| 291 | satellitescreen.com | NameCheap, Inc. | 8 Oct 2021 | - | 8 Oct 2022 |
| 292 | satellitesalesms.com | GoDaddy.com, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 293 | satellitesshop.net | - | - | - | - |
| 294 | satellitesystemsmt.com | Tucows Domains Inc. | 4 Oct 2011 | 8 Oct 2015 | 4 Oct 2016 |
| 295 | satellitestock.com | NameCheap, Inc. | 28 Aug 2021 | - | 28 Aug 2022 |
| 296 | satellitestreamer.com | GoDaddy.com, LLC | 20 Oct 2015 | 20 Oct 2015 | 20 Oct 2016 |
| 297 | satelliteserve.com | TurnCommerce, Inc. DBA NameBright.com | 22 Oct 2021 | 23 Nov 2023 | 22 Oct 2023 |
| 298 | satelliteservicesandiego.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 299 | satellitesplussc.com | GoDaddy.com, LLC | 26 Jun 2018 | 26 Jun 2018 | 26 Jun 2019 |
| 300 | satelliteseemydatanewrepeats.info | Network Solutions, LLC | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 301 | satellitesshop.com | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 302 | satelliteslumberpetbeds.info | Network Solutions, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 303 | satellitesolutions.consulting | GoDaddy.com, LLC | 17 Nov 2015 | 17 Nov 2015 | 17 Nov 2016 |
| 304 | satellitesymbolism.com | eNom, Inc. | 4 Dec 2015 | 31 Jul 2017 | 4 Dec 2017 |
| 305 | satellitesmile.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 306 | satellitesystemservice.com | Tucows Domains Inc. | 18 Dec 2015 | 22 Dec 2016 | 18 Dec 2016 |
| 307 | satellitesupply.net | Rebel.com Corp. | 26 Dec 2015 | 24 Jun 2017 | 26 Dec 2017 |
| 308 | satelliteselecttv.com | GoDaddy.com, LLC | 14 Apr 2009 | 26 May 2011 | 2 Feb 2017 |
| 309 | satellitesr.us | Wild West Domains, LLC | 21 Jan 2016 | 21 Jan 2016 | 20 Jan 2017 |
| 310 | satellitesinter.net | Wild West Domains, LLC | 26 Jan 2016 | 26 Jan 2016 | 26 Jan 2017 |
| 311 | satellitespecials.net | GoDaddy.com, LLC | 10 Apr 2019 | 11 Apr 2024 | 10 Apr 2025 |
| 312 | satellitesupercenter.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 313 | satellitesystems.org | GoDaddy.com, LLC | 8 Feb 2016 | 7 Feb 2017 | 8 Feb 2018 |
| 314 | satellitesolutionsar.net | GoDaddy.com, LLC | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2017 |
| 315 | satellitespecials.info | Epik Inc. | 27 Apr 2020 | 27 Apr 2020 | 27 Apr 2021 |
| 316 | satellitesinmotion.com | - | 7 Oct 2024 | 7 Oct 2024 | 7 Oct 2025 |
| 317 | satellitescorpionsfootball.com | Tucows Domains Inc. | 17 Feb 2016 | 21 Feb 2017 | 17 Feb 2017 |
| 318 | satellitesup.com | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 319 | satellitesys.com | Annulet LLC | 8 Mar 2016 | 25 Apr 2024 | 8 Mar 2025 |
| 320 | satellitesolutionsupmi.com | Tucows Domains Inc. | 10 Mar 2016 | 14 Mar 2018 | 10 Mar 2018 |
| 321 | satelliteship.com | GMO Internet Inc. | 15 Mar 2016 | 8 Mar 2021 | 15 Mar 2027 |
| 322 | satellitessignalsandsecuritys.com | Tucows Domains Inc. | 15 Mar 2011 | 15 Mar 2011 | 15 Mar 2017 |
| 323 | satellitesseo.com | GoDaddy.com, LLC | 19 Mar 2016 | 30 Apr 2024 | 19 Mar 2024 |
| 324 | satelliteshoppingnetwork.com | Synergy Wholesale Pty Ltd | 20 Mar 2016 | 7 Mar 2024 | 20 Mar 2025 |
| 325 | satellitesitesurveys.net | GoDaddy.com, LLC | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 326 | satellitestation.com | GoDaddy.com, LLC | 24 Nov 1998 | 24 Nov 2024 | 23 Nov 2025 |
| 327 | satellitesubmarine.com | GoDaddy.com, LLC | 25 Mar 2016 | 25 Mar 2016 | 25 Mar 2017 |
| 328 | satellitesandmeteorites.com | Tucows Domains Inc. | 3 Aug 2018 | 7 Aug 2019 | 3 Aug 2019 |
| 329 | satellitesagency.com | DROPCATCH.COM 824 LLC | 19 Jun 2018 | 19 Jun 2018 | 19 Jun 2019 |
| 330 | satellitesocialnetwork.com | Jiangsu Bangning Science and technology Co. Ltd. | 15 Dec 2019 | 15 Dec 2019 | 15 Dec 2020 |
| 331 | satellitesymposium.com | PSI-USA, Inc. dba Domain Robot | 5 Apr 2016 | 26 May 2024 | 5 Apr 2025 |
| 332 | satellitesymposia.com | PSI-USA, Inc. dba Domain Robot | 5 Apr 2016 | 26 May 2024 | 5 Apr 2025 |
| 333 | satellitesolutionsmt.com | GoDaddy.com, LLC | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2018 |
| 334 | satellitesons.com | GoDaddy.com, LLC | 7 Apr 2016 | 7 Apr 2016 | 7 Apr 2018 |
| 335 | satellitesaturation.com | - | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 336 | satellitestreamers.com | GoDaddy.com, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 337 | satellitesender.com | GoDaddy.com, LLC | 21 Apr 2016 | 21 Apr 2016 | 21 Apr 2017 |
| 338 | satellitesimages.com | eNom, Inc. | 24 Apr 2016 | 24 Apr 2016 | 24 Apr 2017 |
| 339 | satellitesteamingservers.com | GoDaddy.com, LLC | 10 May 2023 | 22 Jul 2024 | 10 May 2024 |
| 340 | satellitesandtelescopes.com | Tucows Domains Inc. | 23 Apr 2014 | 23 Apr 2014 | 23 Apr 2017 |
| 341 | satellitesam.net | - | 28 Apr 2016 | 28 Apr 2016 | 28 Apr 2017 |
| 342 | satellitesinaction.com | Wild West Domains, LLC | 27 Apr 2016 | 28 Apr 2024 | 27 Apr 2025 |
| 343 | satellitesam.com | - | 11 Jan 2022 | 12 Jan 2022 | 11 Jan 2023 |
| 344 | satellitesvcs.com | eNom, Inc. | 12 Nov 2017 | 12 Nov 2017 | 12 Nov 2019 |
| 345 | satelliteselfies.com | GoDaddy.com, LLC | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2017 |
| 346 | satellitesocialresearch.com | Tucows Domains Inc. | 2 May 2016 | 6 May 2021 | 2 May 2021 |
| 347 | satellitesystemsgf.com | Launchpad, Inc. | 14 May 2016 | 29 Apr 2017 | 14 May 2018 |
| 348 | satellitesetinnovation.org | Network Solutions, LLC | 22 May 2016 | 22 May 2016 | 22 May 2017 |
| 349 | satellitespotting.com | GoDaddy.com, LLC | 28 May 2016 | 29 May 2023 | 28 May 2025 |
| 350 | satellitesms.com | Chengdu West Dimension Digital Technology Co., Ltd… | 14 Sep 2021 | 14 Sep 2021 | 14 Sep 2022 |
| 351 | satellitessalon.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Jun 2016 | 4 Jun 2017 | 5 Jun 2018 |
| 352 | satellitesupport.net | GoDaddy.com, LLC | 1 Dec 2008 | 13 Jan 2025 | 1 Dec 2025 |
| 353 | satellitesix.com | GoDaddy.com, LLC | 22 Feb 2010 | 1 Apr 2024 | 31 Mar 2025 |
| 354 | satellitesolutionspanama.com | Tucows Domains Inc. | 17 Jun 2014 | 17 Jun 2014 | 17 Jun 2017 |
| 355 | satelliteservices.org | Dynadot, LLC | 22 Jun 2016 | 22 Jun 2016 | 22 Jun 2017 |
| 356 | satellitesspace.com | - | 7 Feb 2022 | 7 Feb 2022 | 7 Feb 2023 |
| 357 | satellitess.com | GoDaddy.com, LLC | 20 Nov 2024 | 16 Dec 2024 | 20 Nov 2025 |
| 358 | satellitesigningservices.com | GoDaddy.com, LLC | 22 Jun 2016 | 23 Jun 2024 | 22 Jun 2025 |
| 359 | satellites-phone.com | - | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 360 | satellitesteamingservers.net | Network Solutions, LLC | 29 Jun 2016 | 3 Jul 2017 | 29 Jun 2018 |
| 361 | satellites-r-us.com | Tucows Domains Inc. | 29 Jun 2005 | 29 Jun 2005 | 29 Jun 2017 |
| 362 | satellitesportscafe.amsterdam | Hosting Concepts B.V. dba Openprovider | 17 Aug 2015 | 13 Nov 2024 | 17 Aug 2025 |
| 363 | satellitestarlight.com | Tucows Domains Inc. | 30 Sep 2008 | 1 Sep 2024 | 30 Sep 2025 |
| 364 | satellitesuperstore.systems | eNom, Inc. | 17 Jun 2014 | 15 Jun 2016 | 17 Jun 2017 |
| 365 | satellitespierrecardin.com | Tucows Domains Inc. | 11 Jul 2013 | 30 Nov 2024 | 11 Jul 2026 |
| 366 | satellitespierrecardin.net | Tucows Domains Inc. | 11 Jul 2013 | 30 Nov 2024 | 11 Jul 2026 |
| 367 | satellitespierrecardin.org | Tucows Domains Inc. | 11 Jul 2013 | 5 Dec 2024 | 11 Jul 2026 |
| 368 | satellitesystems.biz | GMO Internet Inc. | 4 Dec 2015 | 8 Dec 2015 | 3 Dec 2016 |
| 369 | satellitespace.biz | Japan Registry Services Co., Ltd. | 8 Dec 2021 | 11 Nov 2024 | 8 Dec 2025 |
| 370 | satelliteservices.biz | Network Solutions, LLC | 5 Mar 2010 | 19 Apr 2024 | 4 Mar 2025 |
| 371 | satellitestuff.net | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 372 | satellitesb.com | Tucows Domains Inc. | 27 Jul 2016 | 12 Dec 2024 | 27 Jul 2025 |
| 373 | satellitesuperstores.com | Tucows Domains Inc. | 21 Oct 2024 | 7 Nov 2024 | 21 Oct 2025 |
| 374 | satelliteservicesltd.com | Key-Systems GmbH | 11 Aug 2016 | 26 Jul 2024 | 11 Aug 2025 |
| 375 | satellitesamurai.com | Webfusion Ltd. | 8 Sep 2010 | 24 Jan 2023 | 8 Sep 2026 |
| 376 | satellitesandtelescopes.space | GMO Internet Inc. | 15 Oct 2022 | - | 15 Oct 2023 |
| 377 | satellitesdirect.info | Network Solutions, LLC | 21 Aug 2016 | 3 Oct 2017 | 21 Aug 2018 |
| 378 | satellitesku.com | GoDaddy.com, LLC | 26 Aug 2016 | 29 Sep 2022 | 26 Aug 2025 |
| 379 | satelliteskateboard.com | - | 2 Sep 2016 | 2 Sep 2016 | 2 Sep 2018 |
| 380 | satelliteskateboards.com | - | 2 Sep 2016 | 2 Sep 2016 | 2 Sep 2018 |
| 381 | satelliteskates.com | - | 2 Sep 2016 | 2 Sep 2016 | 2 Sep 2018 |
| 382 | satelliteskate.com | - | 2 Sep 2016 | 2 Sep 2016 | 2 Sep 2018 |
| 383 | satellitesherd.space | Xin Net Technology Corporation | 9 Sep 2016 | 9 Jan 2017 | 9 Sep 2019 |
| 384 | satellitesherd.com | Xin Net Technology Corporation | 9 Sep 2016 | 9 Sep 2016 | 9 Sep 2017 |
| 385 | satellitesherd.win | Xin Net Technology Corporation | 9 Sep 2016 | 9 Jan 2017 | 8 Sep 2019 |
| 386 | satellitestreets.com | - | 12 Sep 2016 | 12 Sep 2016 | 12 Sep 2017 |
| 387 | satellitestreamingservers.net | Hosting Concepts B.V. dba Openprovider | 30 Mar 2021 | 30 Mar 2024 | 30 Mar 2025 |
| 388 | satelliteshopping.com | Annulet LLC | 18 Sep 2016 | 4 Nov 2024 | 18 Sep 2025 |
| 389 | satellitesquared.com | - | 20 Sep 2016 | 20 Sep 2016 | 20 Sep 2017 |
| 390 | satelliteservice.it | Register.it SPA | 27 Sep 2014 | 13 Oct 2017 | 27 Sep 2018 |
| 391 | satellitesystemssales.com | Mat Bao Trading & Service Company Limited d/b/a Ma… | 30 Jul 2021 | 31 Jul 2021 | 30 Jul 2022 |
| 392 | satellitesignal.com | Annulet LLC | 9 Apr 2002 | 19 Aug 2024 | 9 Apr 2025 |
| 393 | satellitespeedinternet.com | GoDaddy.com, LLC | 5 Jun 2023 | 17 Jun 2024 | 5 Jun 2025 |
| 394 | satellitesandsonar.com | Deluxe Small Business Sales, Inc. d/b/a Aplus.net | 13 Sep 2013 | 13 Sep 2024 | 13 Sep 2025 |
| 395 | satellitesmith.com | 1&1 Internet AG | 25 Jun 2006 | 26 Jun 2024 | 25 Jun 2025 |
| 396 | satellitespeakertraining.com | MarkMonitor Inc. | 21 Sep 2010 | 4 Feb 2025 | 21 Sep 2026 |
| 397 | satelliteseries.com | Annulet LLC | 6 Feb 2004 | 7 Feb 2025 | 6 Feb 2026 |
| 398 | satellitesupportcell.com | Misk.com, Inc. | 26 Nov 2023 | 1 Jul 2024 | 26 Nov 2025 |
| 399 | satellites-teletravail.com | Internet Domain Services BS Corp | 10 May 2021 | 20 May 2021 | 10 May 2022 |
| 400 | satellitesurveys.com | Dynadot, LLC | 21 Feb 2024 | 23 May 2024 | 21 Feb 2025 |
| 401 | satellitesf.com | GoDaddy.com, LLC | 24 Feb 2025 | 24 Feb 2025 | 24 Feb 2026 |
| 402 | satellitesessions.com | NameCheap, Inc. | 12 Apr 2009 | 13 Mar 2024 | 12 Apr 2025 |
| 403 | satellitesurfreport.com | GoDaddy.com, LLC | 20 Feb 2014 | 29 Nov 2024 | 17 Sep 2024 |
| 404 | satellitesystemsseminar.com | FBS Inc. | 10 May 2013 | 12 Jun 2017 | 10 May 2018 |
| 405 | satelliteson.com | GoDaddy.com, LLC | 3 Dec 2008 | 4 Dec 2015 | 3 Dec 2016 |
| 406 | satellitespotlight.com | GoDaddy.com, LLC | 3 Mar 2010 | 15 May 2024 | 3 Mar 2024 |
| 407 | satellitesmap.com | Fabulous.com Pty Ltd. | 30 Aug 2005 | 2 Jul 2017 | 30 Aug 2018 |
| 408 | satellitesurfer.com | Moniker Online Services LLC | 30 Mar 2011 | 12 Nov 2024 | 30 Mar 2026 |
| 409 | satellitesupreme.com | Annulet LLC | 18 Oct 2010 | 5 Dec 2024 | 18 Oct 2025 |
| 410 | satellitesinvestments.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Aug 2011 | 19 Aug 2016 | 25 Aug 2017 |
| 411 | satellitesmistakenforstars.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 6 Nov 2003 | 3 Nov 2024 | 6 Nov 2025 |
| 412 | satellitesovermoscow.com | GoDaddy.com, LLC | 12 Sep 2010 | 13 Sep 2013 | 12 Sep 2016 |
| 413 | satellitesite-sync.com | GMO Internet Inc. | 29 May 2013 | 15 Apr 2024 | 29 May 2025 |
| 414 | satelliteseek.com | Internet Domain Services BS Corp | 2 Apr 2010 | 16 Apr 2017 | 2 Apr 2018 |
| 415 | satellitespeakerstands.com | Fabulous.com Pty Ltd. | 20 Jan 2005 | 21 Jan 2016 | 19 Jan 2017 |
| 416 | satellitesightseeing.com | Tucows Domains Inc. | 1 Sep 2005 | 2 Aug 2024 | 1 Sep 2025 |
| 417 | satellitesymphonics.com | GoDaddy.com, LLC | 27 May 2014 | 27 May 2014 | 27 May 2017 |
| 418 | satellitesurveyors.com | eNom, Inc. | 2 Jun 2012 | 23 May 2016 | 2 Jun 2017 |
| 419 | satellitesoftwares.com | GoDaddy.com, LLC | 18 Oct 2012 | 6 Nov 2015 | 18 Oct 2016 |
| 420 | satellites-for-nature.com | united-domains AG | 23 Dec 2012 | 13 Dec 2024 | 23 Dec 2025 |
| 421 | satellitesignature.com | Google, Inc. | 9 Jan 2014 | 25 Dec 2024 | 9 Jan 2026 |
| 422 | satellitespeakers.com | GoDaddy.com, LLC | 22 Oct 2002 | 2 Oct 2024 | 22 Oct 2025 |
| 423 | satellitesolutionsofwny.com | eNom, Inc. | 2 Apr 2024 | 3 Apr 2024 | 2 Apr 2025 |
| 424 | satellitespace.com | NameSecure L.L.C. | 24 Jan 2000 | 2 Jul 2020 | 24 Jan 2027 |
| 425 | satellitesellersusa.com | Tucows Domains Inc. | 23 Oct 2009 | 27 Oct 2020 | 23 Oct 2020 |
| 426 | satellitesisters.com | Network Solutions, LLC | 27 Oct 1998 | 4 Sep 2021 | 26 Oct 2026 |
| 427 | satellitesolutionsltd.com | GoDaddy.com, LLC | 30 Jun 2004 | 1 Jul 2024 | 30 Jun 2026 |
| 428 | satelliteset.com | GoDaddy.com, LLC | 6 Jan 2021 | 18 Mar 2024 | 6 Jan 2024 |
| 429 | satellitespectrums.com | NameCheap, Inc. | 7 Oct 2008 | 7 Sep 2024 | 7 Oct 2025 |
| 430 | satellitesphones.com | GoDaddy.com, LLC | 28 Dec 2005 | 29 Jan 2025 | 28 Jan 2026 |
| 431 | satellitesnottowers.com | Tucows Domains Inc. | 3 May 2010 | 7 May 2017 | 3 May 2017 |
| 432 | satelliteservicecenter.com | NameCheap, Inc. | 19 May 2000 | 23 Jul 2024 | 19 May 2025 |
| 433 | satellitespies.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jan 2012 | 10 Mar 2020 | 25 Jan 2025 |
| 434 | satellites-and-africa.com | OVH sas | 9 Jan 2012 | 2 Jan 2024 | 9 Jan 2025 |
| 435 | satelliteserviceproviders.com | GoDaddy.com, LLC | 20 Feb 2002 | 31 Jan 2025 | 20 Feb 2026 |
| 436 | satellitesights.com | NameKing.com Inc. | 17 Nov 2007 | 1 Feb 2025 | 17 Nov 2025 |
| 437 | satellitesportstv.com | Hosting Concepts B.V. dba Openprovider | 17 May 2001 | 17 May 2017 | 17 May 2018 |
| 438 | satellitestudios.com | Network Solutions, LLC | 27 Oct 1998 | 27 Aug 2024 | 26 Oct 2025 |
| 439 | satellitesavers.com | eNom, Inc. | 27 Jan 2004 | 29 Dec 2016 | 27 Jan 2018 |
| 440 | satellitespectrumplots.com | Google, Inc. | 9 Feb 2014 | 9 Feb 2025 | 9 Feb 2025 |
| 441 | satellitesurveillancesystems.com | GoDaddy.com, LLC | 19 Jan 2000 | 24 Jan 2025 | 19 Jan 2026 |
| 442 | satellitesformotorhomes.com | Tucows Domains Inc. | 18 Jul 2011 | 18 Feb 2018 | 18 Jul 2018 |
| 443 | satellitesurplusstore.com | Wild West Domains, LLC | 1 Apr 2009 | 2 Apr 2016 | 1 Apr 2017 |
| 444 | satellitescientific.com | GoDaddy.com, LLC | 19 Apr 2002 | 20 Apr 2024 | 19 Apr 2026 |
| 445 | satellitesupply.com | GoDaddy.com, LLC | 8 Jun 1999 | 20 May 2024 | 8 Jun 2025 |
| 446 | satelliteservice.com | Uniregistrar Corp | 11 Jun 2001 | 22 May 2024 | 11 Jun 2025 |
| 447 | satellitesecuritysystems.com | Uniregistrar Corp | - | - | - |
| 448 | satellitesapp.com | GoDaddy.com, LLC | 19 Jun 2024 | 19 Jun 2024 | 19 Jun 2026 |
| 449 | satellitesky.com | Name.com, Inc. | 3 Jan 2004 | 13 Feb 2025 | 3 Jan 2026 |
| 450 | satellitesolutionsar.com | GoDaddy.com, LLC | 15 Aug 2011 | 20 Aug 2023 | 15 Aug 2025 |
| 451 | satellitesound.com | DropCatch.com 360 LLC | 3 Sep 2024 | 27 Oct 2024 | 3 Sep 2025 |
| 452 | satelliteseo.com | TurnCommerce, Inc. DBA NameBright.com | 5 Nov 2013 | 15 Dec 2024 | 5 Nov 2024 |
| 453 | satellitesh.com | HiChina Zhicheng Technology Limited | 1 Jan 2020 | 1 Jan 2020 | 1 Jan 2021 |
| 454 | satellitesimplicity.com | GoDaddy.com, LLC | 2 Jun 2006 | 4 May 2024 | 2 Jun 2025 |
| 455 | satelliteserver.com | TurnCommerce, Inc. DBA NameBright.com | 10 Jan 1999 | 19 Jun 2024 | 10 Jan 2026 |
| 456 | satelliteservices.com | TurnCommerce, Inc. DBA NameBright.com | 27 May 1998 | 17 Jun 2024 | 26 May 2025 |
| 457 | satelliteseoul.com | GoDaddy.com, LLC | 31 Mar 2014 | 31 Mar 2014 | 31 Mar 2019 |
| 458 | satellites01.com | Register.it SPA | 14 Sep 2011 | 3 Sep 2015 | 14 Sep 2017 |
| 459 | satellitest.com | eNom, Inc. | 30 Apr 2014 | 23 Apr 2024 | 30 Apr 2025 |
| 460 | satellites-gallore.com | GoDaddy.com, LLC | 14 Mar 2014 | 25 May 2023 | 14 Mar 2023 |
| 461 | satellitesoda.com | eNom, Inc. | 5 Jul 2004 | 9 Sep 2020 | 5 Jul 2028 |
| 462 | satellitessales.com | eNom, Inc. | 22 Jan 2006 | 24 Dec 2016 | 22 Jan 2018 |
| 463 | satellitesfree.com | GoDaddy.com, LLC | 7 Mar 2014 | 8 Mar 2016 | 7 Mar 2017 |
| 464 | satellitespot.com | Annulet LLC | 24 Feb 2017 | 12 Apr 2024 | 24 Feb 2025 |
| 465 | satelliteserviceedmond.com | eNom, Inc. | 20 Nov 2013 | 24 Oct 2017 | 20 Nov 2018 |
| 466 | satelliteshopper.com | GoDaddy.com, LLC | 24 Dec 2005 | 4 Dec 2024 | 24 Dec 2025 |
| 467 | satellitesoftcom.com | Wild West Domains, LLC | 4 Jan 2008 | 5 Jan 2025 | 4 Jan 2026 |
| 468 | satellitesmartcards.com | Uniregistrar Corp | - | - | - |
| 469 | satellitesusa.com | Annulet LLC | 15 Jan 2007 | 27 Jan 2025 | 15 Jan 2025 |
| 470 | satellitesignage.com | GoDaddy.com, LLC | 20 Nov 2010 | 20 Nov 2015 | 20 Nov 2017 |
| 471 | satellitesforcaravans.com | Tucows Domains Inc. | 18 Jul 2011 | 18 Jun 2017 | 18 Jul 2018 |
| 472 | satellitesetup.com | GoDaddy.com, LLC | 1 Apr 2002 | 12 Mar 2024 | 1 Apr 2025 |
| 473 | satellitestatusmag.com | Tucows Domains Inc. | 2 Mar 2012 | 6 Mar 2021 | 2 Mar 2021 |
| 474 | satellitesports.com | Annulet LLC | 12 May 2005 | 29 Jun 2024 | 12 May 2025 |
| 475 | satelliteseven.com | Tucows Domains Inc. | 14 Nov 2023 | 17 Feb 2024 | 14 Nov 2026 |
| 476 | satellitesupplier.com | DropCatch.com 1260 LLC | 11 Mar 2017 | 14 Mar 2017 | 11 Mar 2018 |
| 477 | satellitesplus.com | Annulet LLC | 19 Aug 2009 | 19 Aug 2024 | 19 Aug 2025 |
| 478 | satellitesreceive.com | GoDaddy.com, LLC | 16 May 2007 | 28 Jul 2023 | 16 May 2023 |
| 479 | satellitesignalmeters.com | Tucows Domains Inc. | 29 Jul 2002 | 10 Aug 2017 | 29 Jul 2018 |
| 480 | satellitesymphony.com | eNom, Inc. | 23 May 2006 | 16 May 2024 | 23 May 2025 |
| 481 | satellitestudio.com | Tucows Domains Inc. | 12 Mar 2000 | 11 Mar 2024 | 12 Mar 2025 |
| 482 | satellitesaints.com | DreamHost, LLC | 20 Dec 2009 | 15 Nov 2024 | 20 Dec 2025 |
| 483 | satellitesystemsincfl.com | Tucows Domains Inc. | 21 Jan 2014 | 25 Jan 2017 | 21 Jan 2017 |
| 484 | satellitesolutionsfargo.com | 1&1 Internet AG | 28 Jun 2011 | 29 Jun 2024 | 28 Jun 2025 |
| 485 | satellitessystems.com | eNom, Inc. | 14 Nov 2003 | 9 Nov 2017 | 14 Nov 2017 |
| 486 | satellitesister.com | PSI-USA, Inc. dba Domain Robot | 31 May 2023 | 31 May 2024 | 31 May 2024 |
| 487 | satellitesteeltrading.com | GoDaddy.com, LLC | 11 Oct 2010 | 12 Oct 2015 | 11 Oct 2017 |
| 488 | satellitesforeveryone.com | Webfusion Ltd. | 3 Apr 2014 | 4 Apr 2024 | 3 Apr 2025 |
| 489 | satellitesolutionsworldwide.com | TurnCommerce, Inc. DBA NameBright.com | 27 Nov 2008 | 15 Jan 2020 | 27 Nov 2025 |
| 490 | satelliteservicesinc.com | GoDaddy.com, LLC | 7 Sep 2021 | 4 Jul 2024 | 15 Jun 2025 |
| 491 | satelliteservers.com | GoDaddy.com, LLC | 8 Dec 2024 | 8 Dec 2024 | 8 Dec 2025 |
| 492 | satellitestar.com | Moniker Online Services LLC | 7 Jul 2002 | 16 Aug 2024 | 7 Jul 2025 |
| 493 | satellitesimulators.com | 1&1 Internet AG | 1 Dec 2004 | 2 Dec 2016 | 1 Dec 2017 |
| 494 | satellitesams.com | TurnCommerce, Inc. DBA NameBright.com | 8 May 2012 | 9 Jun 2024 | 8 May 2024 |
| 495 | satellitesolutionscenter.com | Wild West Domains, LLC | 4 Mar 2005 | 4 Mar 2016 | 4 Mar 2017 |
| 496 | satellitesandaerials.com | TurnCommerce, Inc. DBA NameBright.com | 27 Jun 2014 | 21 Jun 2020 | 27 Jun 2025 |
| 497 | satellitesimulator.com | Google, Inc. | 25 Aug 2023 | 10 Aug 2024 | 25 Aug 2025 |
| 498 | satellitesteve.com | GoDaddy.com, LLC | 12 Apr 2007 | 26 Apr 2024 | 24 May 2025 |
| 499 | satelliteslumberpetbeds.com | Network Solutions, LLC | 27 Aug 2007 | 29 Jan 2015 | 27 Aug 2017 |
| 500 | satellitesurfvoip.com | Network Solutions, LLC | 4 Apr 2014 | 3 Feb 2018 | 4 Apr 2019 |
| 501 | satellitesandiego.com | GoDaddy.com, LLC | 14 Dec 2013 | 15 Dec 2023 | 14 Dec 2025 |
| 502 | satelliteseemydatanewrepeats.com | Network Solutions, LLC | 5 Aug 2014 | 5 Aug 2024 | 5 Aug 2034 |
| 503 | satellitestarsinternet.com | GoDaddy.com, LLC | 23 Nov 2010 | 26 May 2011 | 23 Nov 2016 |
| 504 | satelliteservicesinfo.com | eNom, Inc. | 1 Feb 2006 | 11 Jul 2016 | 1 Feb 2017 |
| 505 | satellitesightseer.com | Dynadot, LLC | 16 Feb 2007 | 2 Mar 2017 | 16 Feb 2018 |
| 506 | satellitesportsnetwork.com | GMO Internet Inc. | 20 Nov 2024 | 21 Nov 2024 | 20 Nov 2025 |
| 507 | satelliteshine.com | GoDaddy.com, LLC | 10 Jul 2009 | 10 Oct 2024 | 10 Oct 2025 |
| 508 | satelliteshowroom.com | Annulet LLC | 26 Feb 1998 | 19 Aug 2024 | 25 Feb 2025 |
| 509 | satellites-africa.com | OVH sas | 9 Jan 2012 | 2 Jan 2024 | 9 Jan 2025 |
| 510 | satellitestations.com | GoDaddy.com, LLC | 7 Jun 2003 | 4 Oct 2023 | 7 Jun 2025 |
| 511 | satelliteserviceprovider.com | GoDaddy.com, LLC | 12 Feb 2002 | 23 Jan 2025 | 12 Feb 2026 |
| 512 | satellitespeaker.com | GoDaddy.com, LLC | 22 Nov 2002 | 2 Nov 2024 | 22 Nov 2025 |
| 513 | satellitesforsale.com | TPP Wholesale Pty Ltd. | 29 Apr 2018 | 29 Apr 2018 | 29 Apr 2019 |
| 514 | satellitescan.com | TierraNet Inc. d/b/a DomainDiscover | 21 Aug 2001 | 6 Aug 2024 | 21 Aug 2025 |
| 515 | satellitesantacruz.com | GoDaddy.com, LLC | 21 Sep 2012 | 2 Aug 2023 | 1 Aug 2025 |
| 516 | satellitescolliding.com | Dynadot, LLC | 16 Feb 2009 | 28 Jan 2025 | 16 Feb 2026 |
| 517 | satelliteskysolutions.com | GoDaddy.com, LLC | 8 Nov 2011 | 9 Nov 2024 | 8 Nov 2025 |
| 518 | satellitesynergy.com | GoDaddy.com, LLC | 17 Nov 2021 | 19 Sep 2023 | 17 Nov 2023 |
| 519 | satellitestereo.com | Annulet LLC | 7 Aug 2017 | 23 Sep 2024 | 7 Aug 2025 |
| 520 | satellitestorage.com | Dot Holding Inc. | 29 Jun 2006 | 15 Aug 2024 | 29 Jun 2026 |
| 521 | satellitesolution.com | GoDaddy.com, LLC | 19 Jun 2001 | 30 May 2024 | 19 Jun 2025 |
| 522 | satelliteskin.com | Tucows Domains Inc. | 10 Sep 2006 | 11 Aug 2024 | 10 Sep 2025 |
| 523 | satellitesistersonline.com | Network Solutions, LLC | 11 Apr 2008 | 8 Apr 2016 | 11 Apr 2017 |
| 524 | satellitesmart.com | GoDaddy.com, LLC | 20 Oct 2004 | 28 Nov 2024 | 20 Oct 2025 |
| 525 | satellitesportsservice.com | GoDaddy.com, LLC | 6 May 2023 | 6 May 2024 | 6 May 2025 |
| 526 | satellitestlouis.com | NameSecure L.L.C. | 13 Jan 2010 | 22 Mar 2017 | 13 Jan 2018 |
| 527 | satellitesoft.com | NameCheap, Inc. | 5 Sep 2006 | 6 Aug 2024 | 5 Sep 2025 |
| 528 | satellitesession.com | GoDaddy.com, LLC | 3 Nov 2010 | 4 Nov 2024 | 3 Nov 2025 |
| 529 | satelliteservicesllc.com | Tucows Domains Inc. | 2 Aug 2010 | 3 Aug 2023 | 2 Aug 2025 |
| 530 | satellitesplitter.com | eNom, Inc. | 25 Dec 2002 | 11 Dec 2016 | 25 Dec 2017 |
| 531 | satellites02.com | Register.it SPA | 14 Sep 2011 | 3 Sep 2015 | 14 Sep 2017 |
| 532 | satellitesportsconnection.com | GoDaddy.com, LLC | 23 Sep 2004 | 27 Sep 2023 | 23 Sep 2025 |
| 533 | satellitesignalstrengthmeter.com | GoDaddy.com, LLC | 11 Jun 2009 | 10 Jun 2016 | 11 Jun 2017 |
| 534 | satellitesportcafe.com | Hosting Concepts B.V. dba Openprovider | 17 May 2001 | 17 May 2024 | 17 May 2025 |
| 535 | satellitesband.com | - | 21 May 2023 | 22 Jun 2024 | 21 May 2024 |
| 536 | satellitesantenna.com | GoDaddy.com, LLC | 6 Feb 2006 | 17 Jan 2025 | 6 Feb 2026 |
| 537 | satellitesocial.com | 1API GmbH | 12 Sep 2019 | 13 Sep 2019 | 12 Sep 2020 |
| 538 | satellitesalesworld.com | Tucows Domains Inc. | 10 Jun 2014 | 26 May 2024 | 10 Jun 2025 |
| 539 | satellitesystemsbusiness.com | register.com, Inc. | 26 Jan 2012 | 14 Mar 2017 | 26 Jan 2018 |
| 540 | satellitestream.com | TurnCommerce, Inc. DBA NameBright.com | 1 Mar 2000 | 19 Jun 2024 | 1 Mar 2025 |
| 541 | satelliteswitch.com | TurnCommerce, Inc. DBA NameBright.com | 6 Mar 2012 | 28 Feb 2021 | 6 Mar 2025 |
| 542 | satellitesmusic.com | GoDaddy.com, LLC | 23 May 2023 | 23 May 2024 | 23 May 2025 |
| 543 | satellitesong.com | FastDomain Inc. | 19 Oct 2011 | 4 Oct 2024 | 19 Oct 2025 |
| 544 | satellitesystemsalesbemidji.com | NameCheap, Inc. | 27 May 2014 | 27 Apr 2024 | 27 May 2025 |
| 545 | satelliteshoptx.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Nov 2021 | 24 Nov 2023 | 23 Nov 2024 |
| 546 | satellitesheltersinc.com | Network Solutions, LLC | 16 Oct 2013 | 5 Mar 2017 | 16 Oct 2018 |
| 547 | satellitesecretary.com | Tucows Domains Inc. | 16 Mar 2006 | 15 Feb 2025 | 16 Mar 2026 |
| 548 | satellitesgymnastics.com | Tucows Domains Inc. | 20 May 2024 | 14 Jan 2025 | 20 May 2025 |
| 549 | satellitesync.com | GoDaddy.com, LLC | 13 Feb 2007 | 13 Feb 2025 | 13 Feb 2026 |
| 550 | satellitestarradio.com | GoDaddy.com, LLC | 20 Aug 2008 | 26 May 2011 | 20 Aug 2017 |
| 551 | satellitestreams.com | TurnCommerce, Inc. DBA NameBright.com | 23 Sep 2010 | 14 Aug 2021 | 23 Sep 2025 |
| 552 | satellitesradio.com | GoDaddy.com, LLC | 29 Mar 2024 | 29 Mar 2024 | 29 Mar 2025 |
| 553 | satelliteshares.com | GoDaddy.com, LLC | 2 Aug 2012 | 3 Aug 2015 | 2 Aug 2017 |
| 554 | satellites03.com | Register.it SPA | 14 Sep 2011 | 3 Sep 2015 | 14 Sep 2017 |
| 555 | satellitestate.com | Annulet LLC | 23 Jun 2009 | 19 Aug 2024 | 23 Jun 2025 |
| 556 | satellitesignalmeter.com | GoDaddy.com, LLC | 24 Dec 2002 | 4 Dec 2024 | 24 Dec 2025 |
| 557 | satellitesamachar.com | eNom655, Inc. | 21 Apr 2022 | 5 Jul 2023 | 21 Apr 2023 |
| 558 | satellitesalesoffice.com | GoDaddy.com, LLC | 22 Jan 2012 | 22 Jan 2025 | 22 Jan 2026 |
| 559 | satellitestoday.com | TurnCommerce, Inc. DBA NameBright.com | 6 Mar 2014 | 28 Feb 2021 | 6 Mar 2025 |
| 560 | satellitesupports.com | DropCatch.com 626 LLC | 10 Jun 2018 | 10 Jun 2018 | 10 Jun 2019 |
| 561 | satellitesolutionsinc.com | GoDaddy.com, LLC | 8 Jul 2014 | 9 Jul 2016 | 8 Jul 2018 |
| 562 | satellitesurplus.com | Annulet LLC | 8 Jun 2006 | 19 Aug 2024 | 8 Jun 2025 |
| 563 | satelliteskymusic.com | GoDaddy.com, LLC | 11 Dec 2010 | 12 Dec 2024 | 11 Dec 2025 |
| 564 | satellitesoundsrecording.com | GoDaddy.com, LLC | 17 Jan 2012 | 18 Jan 2025 | 17 Jan 2026 |
| 565 | satellitesandmore.com | GoDaddy.com, LLC | 28 Oct 2005 | 21 Jun 2010 | 28 Oct 2019 |
| 566 | satellitesurf.com | GoDaddy.com, LLC | 8 Jun 2012 | 9 Jun 2024 | 8 Jun 2025 |
| 567 | satelliteservicewhitecounty.com | Tucows Domains Inc. | 14 May 2011 | 18 May 2017 | 14 May 2017 |
| 568 | satellitesolarsystems.com | GoDaddy.com, LLC | 7 Jan 2008 | 8 Jan 2016 | 7 Jan 2017 |
| 569 | satellitestocks.com | Internet Domain Services BS Corp | 13 Feb 2025 | 13 Feb 2025 | 13 Feb 2026 |
| 570 | satellitesoul.com | Annulet LLC | 11 Nov 2003 | 29 Dec 2024 | 11 Nov 2025 |
| 571 | satellitesounds.com | Annulet LLC | 19 Dec 2000 | 5 Feb 2025 | 19 Dec 2025 |
| 572 | satellitesgroup.com | Mesh Digital Limited | 13 Oct 2021 | 12 Oct 2024 | 13 Oct 2025 |
| 573 | satellitesrule.com | Authentic Web Inc. | 2 Feb 2008 | 4 Jan 2025 | 2 Feb 2026 |
| 574 | satellitesalesnow.com | DomainPeople, Inc. | 3 Jul 2013 | 4 Jun 2016 | 3 Jul 2017 |
| 575 | satellitesecurity.com | Network Solutions, LLC | 20 Jan 1999 | 20 Apr 2024 | 20 Jan 2026 |
| 576 | satelliteskymadrid.com | GoDaddy.com, LLC | 20 Jan 2011 | 21 Jan 2015 | 20 Jan 2017 |
| 577 | satellitesites.com | Annulet LLC | 5 Oct 2009 | 22 Nov 2024 | 5 Oct 2025 |
| 578 | satellitesystemsllc.com | register.com, Inc. | 17 Nov 2010 | 3 Jan 2017 | 17 Nov 2017 |
| 579 | satellitesupplies.com | GoDaddy.com, LLC | 24 Apr 2006 | 4 Apr 2024 | 24 Apr 2025 |
| 580 | satellitesrus.com | TurnCommerce, Inc. DBA NameBright.com | 8 Aug 2013 | 2 Aug 2020 | 8 Aug 2025 |
| 581 | satelliteshopireland.com | Blacknight Internet Solutions Ltd. | 2 Jan 2013 | 12 Dec 2015 | 2 Jan 2017 |
| 582 | satellitesoundz.com | eNom, Inc. | 23 May 2006 | 21 Oct 2017 | 23 May 2020 |
| 583 | satellites4everyone.com | Webfusion Ltd. | 3 Apr 2014 | 4 Apr 2024 | 3 Apr 2025 |
| 584 | satelliteshoppingmall.com | register.com, Inc. | 29 Oct 2006 | 29 Oct 2006 | 29 Oct 2016 |
| 585 | satelliteshanghai.com | Xin Net Technology Corporation | 27 Dec 2010 | 21 Apr 2015 | 27 Dec 2016 |
| 586 | satellitesavings.com | Brandsight, Inc. | 6 Dec 2004 | 5 Nov 2024 | 6 Dec 2025 |
| 587 | satellitesweden.com | Binero AB | - | - | - |
| 588 | satellitesport.com | NameCheap, Inc. | 22 Apr 2023 | 19 Apr 2024 | 22 Apr 2025 |
| 589 | satellitesite.com | Annulet LLC | 14 Feb 2001 | 19 Aug 2024 | 14 Feb 2025 |
| 590 | satellitesofsoul.com | Arsys Internet, S.L. dba NICLINE.COM | 23 Oct 2013 | 20 Aug 2023 | 23 Oct 2025 |
| 591 | satellitesenterprise.com | Internet Domain Services BS Corp | 16 Apr 2014 | 18 Apr 2016 | 16 Apr 2018 |
| 592 | satellitesignals.com | GoDaddy.com, LLC | 19 Jun 2003 | 30 May 2024 | 19 Jun 2025 |
| 593 | satellitesleuthing.com | DropCatch.com 912 LLC | 19 May 2018 | 19 May 2018 | 19 May 2019 |
| 594 | satellitestreetmaps.com | GoDaddy.com, LLC | 25 Aug 2011 | 5 Aug 2024 | 25 Aug 2025 |
| 595 | satellitesdirect.com | eNom, Inc. | 15 Jun 2007 | 17 May 2024 | 15 Jun 2025 |
| 596 | satellitesmovie.com | MarkMonitor Inc. | 4 Aug 2014 | 2 Aug 2024 | 4 Aug 2025 |
| 597 | satellitestationbroadcast.com | GoDaddy.com, LLC | 1 Jan 2006 | 2 Jan 2025 | 1 Jan 2026 |
| 598 | satelliteserviceoklahomacity.com | eNom, Inc. | 16 Nov 2010 | 24 Oct 2017 | 16 Nov 2018 |
| 599 | satellitestore.com | GoDaddy.com, LLC | 10 Aug 2007 | 18 Jun 2024 | 10 Aug 2026 |
| 600 | satelliteschoolofthearts.com | GoDaddy.com, LLC | 16 Feb 2005 | 17 Feb 2025 | 16 Feb 2026 |
| 601 | satelliteschool.com | Gabia, Inc. | 15 Mar 2000 | 9 Mar 2024 | 15 Mar 2025 |
| 602 | satellitesupportteam.com | Misk.com, Inc. | 26 May 2008 | 2 May 2024 | 26 May 2025 |
| 603 | satellitesinternet.com | NameCheap, Inc. | 9 Dec 2024 | 9 Dec 2024 | 9 Dec 2025 |
| 604 | satellitestatus.com | GoDaddy.com, LLC | 19 Nov 2018 | 20 Nov 2024 | 19 Nov 2026 |
| 605 | satellitessystem.com | NameTell.com LLC | 17 Oct 2013 | 18 Oct 2017 | 17 Oct 2018 |
| 606 | satellitesystemsboise.com | GoDaddy.com, LLC | 26 Jan 2014 | 19 Jan 2015 | 26 Jan 2017 |
| 607 | satellitesinstallation.com | Dynadot, LLC | 10 Sep 2012 | 10 Sep 2024 | 10 Sep 2025 |
| 608 | satellitesongs.com | GoDaddy.com, LLC | 21 Jan 2004 | 23 Dec 2024 | 21 Jan 2027 |
| 609 | satellitesignallevelmeter.com | GoDaddy.com, LLC | 11 Jun 2009 | 10 Jun 2016 | 11 Jun 2017 |
| 610 | satellitesettings.com | GoDaddy.com, LLC | 10 May 2005 | 20 Apr 2024 | 10 May 2025 |
| 611 | satellitesonline.com | GoDaddy.com, LLC | 14 Nov 2001 | 25 Oct 2024 | 14 Nov 2025 |
| 612 | satellitesystem.com | TurnCommerce, Inc. DBA NameBright.com | 10 Nov 1998 | 26 Dec 2023 | 9 Nov 2025 |
| 613 | satelliteshows.com | GoDaddy.com, LLC | 7 Dec 2022 | 7 Dec 2022 | 7 Dec 2023 |
| 614 | satelliteshops.com | GoDaddy.com, LLC | 10 Nov 2004 | 21 Oct 2024 | 10 Nov 2025 |
| 615 | satelliteserenade.com | GoDaddy.com, LLC | 18 Dec 2007 | 3 Dec 2024 | 18 Dec 2025 |
| 616 | satellitesystemsofnevada.com | GoDaddy.com, LLC | 17 Aug 2009 | 18 Aug 2016 | 17 Aug 2017 |
| 617 | satellitesewing.com | Tucows Domains Inc. | 29 Dec 2006 | 2 Jan 2017 | 29 Dec 2016 |
| 618 | satellitestop.com | eNom, Inc. | 7 Dec 2003 | 8 Nov 2017 | 7 Dec 2018 |
| 619 | satelliteshop.com | CPS-Datensysteme GmbH | 6 Aug 2008 | 16 Jan 2025 | 31 Jan 2026 |
| 620 | satellitesandyou.com | Tucows Domains Inc. | 28 Mar 2000 | 27 Jan 2024 | 28 Mar 2026 |
| 621 | satellitesuites.com | GoDaddy.com, LLC | 20 Aug 2009 | 21 Aug 2024 | 20 Aug 2025 |
| 622 | satellitesysteminfo.com | GoDaddy.com, LLC | 1 Feb 2006 | 11 Sep 2022 | 1 Feb 2031 |
| 623 | satelliteshoppers.com | Wild West Domains, LLC | 26 Jan 2015 | 27 Jan 2016 | 26 Jan 2017 |
| 624 | satellitesale.com | GoDaddy.com, LLC | 5 Aug 2003 | 16 Jul 2024 | 5 Aug 2025 |
| 625 | satellitestreaming.com | GoDaddy.com, LLC | 16 Jan 2006 | 28 Dec 2024 | 16 Jan 2026 |
| 626 | satellitesamerica.com | Annulet LLC | 30 Nov 2009 | 1 Dec 2024 | 30 Nov 2025 |
| 627 | satellitesportscafe.com | Hosting Concepts B.V. dba Openprovider | 17 May 2001 | 17 May 2024 | 17 May 2025 |
| 628 | satellitescienceproject.com | GoDaddy.com, LLC | 2 Jan 2011 | 3 Jan 2015 | 2 Jan 2017 |
| 629 | satelliteservicesodessa.com | DropCatch.com 1032 LLC | 8 Nov 2021 | 8 Nov 2021 | 8 Nov 2022 |
| 630 | satellitespy.com | GoDaddy.com, LLC | 11 Dec 2003 | 21 Nov 2024 | 11 Dec 2025 |
| 631 | satellitesatellite.com | GoDaddy.com, LLC | 16 Aug 2002 | 17 Aug 2024 | 16 Aug 2025 |
| 632 | satellitesuzy.com | GoDaddy.com, LLC | 2 Apr 2002 | 3 Apr 2016 | 2 Apr 2017 |
| 633 | satellitesoundstudios.com | 1&1 Internet AG | 15 Oct 2004 | 25 Oct 2017 | 15 Oct 2018 |
| 634 | satellitesunltd.com | GoDaddy.com, LLC | 29 Mar 2000 | 13 Sep 2022 | 29 Mar 2032 |
| 635 | satellitesocial-media.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 28 Mar 2014 | 24 Apr 2024 | 28 Mar 2026 |
| 636 | satellitesouth.com | GoDaddy.com, LLC | 26 Oct 2011 | 26 Oct 2011 | 26 Oct 2016 |
| 637 | satellitestuff.com | Network Solutions, LLC | 11 Jun 1999 | 10 Jun 2024 | 11 Jun 2025 |
| 638 | satellitestargift.com | GoDaddy.com, LLC | 13 Oct 2008 | 26 May 2011 | 2 Feb 2017 |
| 639 | satellitesporttv.com | Hosting Concepts B.V. dba Openprovider | 17 May 2001 | 17 May 2017 | 17 May 2018 |
| 640 | satellitesrecords.com | NameCheap, Inc. | 8 Jan 1997 | 9 Jan 2025 | 7 Jan 2026 |
| 641 | satellitespecial.com | Annulet LLC | 8 Dec 2001 | 25 Jan 2025 | 8 Dec 2025 |
| 642 | satellitesportsbar.com | NameCheap, Inc. | 27 Jul 2021 | - | 27 Jul 2022 |
| 643 | satellitesplusllc.com | Dynamic Network Services, Inc. | 12 Jan 2009 | 7 Feb 2025 | 12 Jan 2025 |
| 644 | satellitesubscriber.com | GoDaddy.com, LLC | 19 Jun 2007 | 4 Dec 2024 | 19 Jun 2025 |
| 645 | satellitesee.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Apr 2021 | 8 Apr 2023 | 7 Apr 2024 |
| 646 | satellitesurveillance.com | GoDaddy.com, LLC | 1 Apr 2002 | 13 May 2024 | 1 Apr 2025 |
| 647 | satelliteselene.com | Google, Inc. | 2 Jan 2017 | 19 Dec 2024 | 2 Jan 2026 |
| 648 | satellitesandsocialists.com | Wild West Domains, LLC | 22 Feb 2013 | 23 Feb 2016 | 22 Feb 2017 |
| 649 | satellitestartv.com | Brandsight, Inc. | 27 May 2005 | 5 May 2024 | 2 Jun 2025 |
| 650 | satellitesantamonica.com | GoDaddy.com, LLC | 1 May 2012 | 12 Sep 2024 | 1 Aug 2024 |
| 651 | satellitesuppliers.com | GoDaddy.com, LLC | 6 Nov 2010 | 1 Nov 2024 | 6 Nov 2025 |
| 652 | satellitesupportunit.com | Misk.com, Inc. | 26 May 2008 | 2 May 2024 | 26 May 2025 |
| 653 | satellitesinfo.com | GoDaddy.com, LLC | 4 Nov 2022 | 16 Jan 2024 | 4 Nov 2023 |
| 654 | satellitesandsirens.com | NameCheap, Inc. | 23 Aug 2024 | 16 Oct 2024 | 23 Aug 2025 |
| 655 | satellitestudiomedia.com | Tucows Domains Inc. | 7 Jul 2010 | 11 Jul 2017 | 7 Jul 2017 |
| 656 | satellitespecialists.com | Annulet LLC | 27 Jul 2003 | 19 Aug 2024 | 27 Jul 2025 |
| 657 | satellitesmartcard.com | GoDaddy.com, LLC | 9 Nov 2003 | 20 Oct 2024 | 9 Nov 2025 |
| 658 | satelliteservicing.com | Annulet LLC | 11 Sep 2008 | 19 Aug 2024 | 11 Sep 2025 |
| 659 | satellitespecialties.com | Tucows Domains Inc. | 23 Aug 2004 | 25 Jul 2017 | 23 Aug 2018 |
| 660 | satellitesalescenter.com | GoDaddy.com, LLC | 13 Feb 2009 | 14 Feb 2024 | 13 Feb 2027 |
| 661 | satellitesigns.com | GoDaddy.com, LLC | 29 Oct 2012 | 30 Oct 2024 | 29 Oct 2025 |
| 662 | satellitesupportcenter.com | Misk.com, Inc. | 26 Nov 2023 | 1 Jul 2024 | 26 Nov 2025 |
| 663 | satellitesharing.com | Edomains LLC | 2 Nov 2024 | 29 Dec 2024 | 2 Nov 2025 |
| 664 | satellitesurgeon.com | TurnCommerce, Inc. DBA NameBright.com | 28 Aug 2011 | 22 Aug 2020 | 28 Aug 2025 |
| 665 | satellitesaver.com | GoDaddy.com, LLC | 18 Oct 2004 | 19 Oct 2015 | 18 Oct 2016 |
| 666 | satelliteservicesofdaytona.com | Wild West Domains, LLC | 3 Jun 2019 | 27 Oct 2022 | 3 Jun 2025 |
| 667 | satelliteshot.com | GoDaddy.com, LLC | 16 Jul 2013 | 17 Jul 2024 | 16 Jul 2025 |
| 668 | satelliteshow.com | GoDaddy.com, LLC | 5 Dec 2002 | 15 Nov 2024 | 5 Dec 2025 |
| 669 | satelliteshrink.com | 1&1 Internet AG | 19 Mar 2008 | 20 Mar 2017 | 19 Mar 2018 |
| 670 | satellitesphere.com | NameCheap, Inc. | 30 May 2013 | 3 Jun 2024 | 30 May 2025 |
| 671 | satellitesets.com | Annulet LLC | 2 Oct 2003 | 15 Oct 2024 | 2 Oct 2025 |
| 672 | satellitesgesco.com | GoDaddy.com, LLC | 13 Apr 2014 | 13 Apr 2014 | 13 Apr 2019 |
| 673 | satellitesign.com | GoDaddy.com, LLC | 21 Aug 2008 | 22 Aug 2024 | 21 Aug 2025 |
| 674 | satellitesip.com | GoDaddy.com, LLC | 26 Sep 2016 | 29 Sep 2022 | 26 Sep 2026 |
| 675 | satellitesiptrunk.com | GoDaddy.com, LLC | 26 Sep 2016 | 29 Sep 2022 | 26 Sep 2026 |
| 676 | satellitesentinel.com | TurnCommerce, Inc. DBA NameBright.com | 1 Feb 2014 | 26 Jan 2021 | 1 Feb 2025 |
| 677 | satellitesupport.com | TurnCommerce, Inc. DBA NameBright.com | 30 Jan 2013 | 27 May 2024 | 30 Jan 2026 |
| 678 | satellitesystems.com | TurnCommerce, Inc. DBA NameBright.com | 15 Apr 1997 | 27 Sep 2023 | 16 Apr 2025 |
| 679 | satellitescience.com | Annulet LLC | 23 Oct 2000 | 9 Dec 2024 | 23 Oct 2025 |
| 680 | satellitespririt.com | - | 30 Sep 2016 | 30 Sep 2016 | 30 Sep 2017 |
| 681 | satellitespirit.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jul 2024 | 8 Aug 2024 | 25 Jul 2025 |
| 682 | satellitestorm.com | Namesilo, LLC | 3 Oct 2016 | 5 Nov 2017 | 3 Oct 2017 |
| 683 | satellitesoflove.com | GoDaddy.com, LLC | 5 Oct 2016 | 6 Oct 2024 | 5 Oct 2025 |
| 684 | satellitesnap.us | - | 3 Oct 2016 | 3 Oct 2016 | 2 Oct 2017 |
| 685 | satellitesum.us | Uniregistrar Corp | 3 Oct 2016 | 3 Oct 2016 | 2 Oct 2017 |
| 686 | satelliteshort.us | - | 4 Oct 2016 | 4 Oct 2016 | 3 Oct 2017 |
| 687 | satellitestyle.us | - | 4 Oct 2016 | 4 Oct 2016 | 3 Oct 2017 |
| 688 | satellitescary.us | - | 4 Oct 2016 | 4 Oct 2016 | 3 Oct 2017 |
| 689 | satelliteservices.info | NameCheap, Inc. | 2 Oct 2021 | 13 Dec 2023 | 2 Oct 2023 |
| 690 | satelliteshop.info | eNom, Inc. | 6 Mar 2002 | 10 Feb 2025 | 6 Mar 2026 |
| 691 | satellitesteve.info | GoDaddy.com, LLC | 18 May 2011 | 29 Jun 2024 | 18 May 2024 |
| 692 | satellitespy.info | Key-Systems GmbH | 22 Dec 2010 | 14 Jan 2025 | 22 Dec 2025 |
| 693 | satellitesurf.info | Network Solutions, LLC | 22 Apr 2014 | 20 Feb 2017 | 22 Apr 2018 |
| 694 | satellitespot.info | NameCheap, Inc. | 6 Jan 2020 | 6 Mar 2020 | 6 Jan 2021 |
| 695 | satellitespy.mobi | PlanetDomain Pty Ltd | 22 Dec 2010 | 22 Dec 2019 | 22 Dec 2020 |
| 696 | satellitesalesoffice.mobi | GoDaddy.com, LLC | 22 Jan 2012 | 23 Jan 2025 | 22 Jan 2026 |
| 697 | satellitesupport.info | Network Solutions, LLC | 31 Jul 2016 | 2 Aug 2017 | 31 Jul 2022 |
| 698 | satellitespy.net | Key-Systems GmbH | 22 Dec 2010 | 22 Jan 2025 | 22 Dec 2025 |
| 699 | satelliteskysolutions.net | DomainsAtCost Corporation | 8 Nov 2011 | 18 Oct 2016 | 8 Nov 2016 |
| 700 | satelliteserviceinternet.net | GoDaddy.com, LLC | 27 Apr 2010 | 26 May 2011 | 27 Apr 2017 |
| 701 | satelliteseo.net | GMO Internet Inc. | 13 Feb 2013 | 7 Jan 2025 | 13 Feb 2026 |
| 702 | satelliteserver.net | GoDaddy.com, LLC | 2 Mar 2005 | 4 Sep 2024 | 3 Sep 2025 |
| 703 | satellitespies.net | Tucows Domains Inc. | 28 Jan 2010 | 21 Jan 2025 | 28 Jan 2026 |
| 704 | satellitesolutionsfargo.net | 1&1 Internet AG | 16 Dec 2011 | 13 Dec 2017 | 16 Dec 2025 |
| 705 | satellitesandaerials.net | Easyspace LTD | 25 Oct 2002 | 30 Aug 2017 | 25 Oct 2018 |
| 706 | satellitesounds.net | Network Solutions, LLC | 20 Nov 2023 | 21 Dec 2023 | 20 Nov 2024 |
| 707 | satelliteshelters.net | Network Solutions, LLC | 8 Jun 2010 | 9 Apr 2020 | 8 Jun 2025 |
| 708 | satellitesorcery.net | CSC Corporate Domains, Inc. | 9 Jan 2003 | 5 Jan 2025 | 9 Jan 2026 |
| 709 | satellitestore.net | GoDaddy.com, LLC | 6 Sep 2021 | 18 Nov 2023 | 6 Sep 2023 |
| 710 | satellitesuperstore.net | eNom, Inc. | 18 Aug 2000 | 4 Aug 2017 | 18 Aug 2018 |
| 711 | satellitesalesoffice.net | GoDaddy.com, LLC | 22 Jan 2012 | 22 Jan 2025 | 22 Jan 2026 |
| 712 | satellitestoday.net | GoDaddy.com, LLC | 28 Jan 2014 | 29 Jan 2025 | 28 Jan 2026 |
| 713 | satelliteshop.net | GoDaddy.com, LLC | 27 May 2005 | 7 May 2024 | 27 May 2025 |
| 714 | satellitesky.net | GoDaddy.com, LLC | 10 Dec 2011 | 11 Dec 2024 | 10 Dec 2025 |
| 715 | satelliteservice.net | Dynadot, LLC | 23 Jun 2020 | 23 Jun 2020 | 23 Jun 2021 |
| 716 | satellitespace.net | NameSecure L.L.C. | 3 Oct 2003 | 9 Mar 2022 | 3 Oct 2027 |
| 717 | satellitesite.net | Annulet LLC | 4 Oct 2003 | 27 Oct 2017 | 4 Oct 2017 |
| 718 | satellitesupportcenter.net | Misk.com, Inc. | 26 Nov 2023 | 1 Jul 2024 | 26 Nov 2025 |
| 719 | satellitesound.net | GoDaddy.com, LLC | 3 Sep 2013 | 4 Sep 2024 | 3 Sep 2025 |
| 720 | satellitestudios.net | Tucows Domains Inc. | 12 Apr 2011 | 28 Mar 2024 | 12 Apr 2025 |
| 721 | satellitesales.net | Tucows Domains Inc. | 23 Jun 2004 | 3 Sep 2024 | 23 Jun 2024 |
| 722 | satellitesupportcell.net | Misk.com, Inc. | 26 Nov 2023 | 1 Jul 2024 | 26 Nov 2025 |
| 723 | satellitesonline.net | Wild West Domains, LLC | 28 Apr 2016 | 10 Mar 2017 | 28 Apr 2018 |
| 724 | satellitesaveus.net | Domain.com, LLC | 7 Feb 2013 | 23 Jan 2017 | 7 Feb 2018 |
| 725 | satellitesolutions.net | Wix.com Ltd. | 5 Jul 2024 | 22 Sep 2024 | 5 Jul 2025 |
| 726 | satellitesystems.net | eNom, Inc. | 25 Feb 2002 | 27 Jan 2017 | 25 Feb 2018 |
| 727 | satellitestudiomedia.net | Tucows Domains Inc. | 7 Jul 2010 | 11 Jul 2017 | 7 Jul 2017 |
| 728 | satelliteservices.net | GoDaddy.com, LLC | 16 Aug 2024 | 9 Oct 2024 | 16 Aug 2025 |
| 729 | satellitestudio.net | GoDaddy.com, LLC | 4 Aug 2003 | 5 Aug 2024 | 4 Aug 2025 |
| 730 | satellitesourcingllc.net | eNom, Inc. | 13 Apr 2014 | 3 Apr 2017 | 13 Apr 2018 |
| 731 | satelliteshow.net | GoDaddy.com, LLC | 11 Dec 2003 | 12 Dec 2024 | 11 Dec 2025 |
| 732 | satelliteskin.net | Tucows Domains Inc. | 10 Sep 2006 | 11 Aug 2024 | 10 Sep 2025 |
| 733 | satellitesolution.net | GoDaddy.com, LLC | 3 Feb 1999 | 4 Feb 2016 | 3 Feb 2017 |
| 734 | satellitesteve.net | Wild West Domains, LLC | 4 Apr 2011 | 30 Mar 2016 | 4 Apr 2017 |
| 735 | satellitesavings.net | GoDaddy.com, LLC | 13 Feb 2009 | 14 Feb 2024 | 13 Feb 2027 |
| 736 | satelliteservers.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 May 2006 | 23 Aug 2017 | 17 May 2018 |
| 737 | satellitestarter.com | Namesilo, LLC | 19 Oct 2016 | 21 Nov 2017 | 19 Oct 2017 |
| 738 | satellitesuperstore.org | eNom, Inc. | 18 Aug 2000 | 11 Aug 2017 | 18 Aug 2018 |
| 739 | satellitesforgood.org | Cronon AG | 23 Oct 2013 | 7 Dec 2024 | 23 Oct 2025 |
| 740 | satellitesolutions.org | Google, Inc. | 18 Feb 2023 | 19 Mar 2024 | 18 Feb 2024 |
| 741 | satellitestations.org | GoDaddy.com, LLC | 24 May 2003 | 8 Jun 2024 | 24 May 2025 |
| 742 | satellitespy.org | Key-Systems GmbH | 22 Dec 2010 | 16 Jan 2025 | 22 Dec 2025 |
| 743 | satellites-xml.org | GoDaddy.com, LLC | 4 May 2012 | 27 Jun 2024 | 4 May 2025 |
| 744 | satelliteservice.org | Tucows Domains Inc. | 19 Mar 2003 | 17 Mar 2024 | 19 Mar 2025 |
| 745 | satellites-for-nature.org | united-domains AG | 23 Dec 2012 | 24 Dec 2016 | 23 Dec 2017 |
| 746 | satelliteskin.org | Tucows Domains Inc. | 10 Sep 2006 | 16 Aug 2024 | 10 Sep 2025 |
| 747 | satelliteskiclub.org | Google, Inc. | 3 Mar 2009 | 15 Jun 2024 | 3 Mar 2025 |
| 748 | satellitesentinel.org | GMO Internet Inc. | 30 Mar 2017 | 30 May 2017 | 30 Mar 2018 |
| 749 | satellitesentinelproject.org | GoDaddy.com, LLC | 7 Apr 2014 | 31 Mar 2016 | 7 Apr 2017 |
| 750 | satellitesets.org | Google, Inc. | 7 Oct 2010 | 7 Oct 2017 | 7 Oct 2018 |
| 751 | satelliteschoolofthearts.org | GoDaddy.com, LLC | 12 Dec 2007 | 23 Jan 2025 | 12 Dec 2024 |
| 752 | satellitesecurity.org | Wild West Domains, LLC | 22 Aug 2008 | 3 Oct 2016 | 22 Aug 2017 |
| 753 | satellitesorcery.org | CSC Corporate Domains, Inc. | 9 Jan 2003 | 10 Jan 2025 | 9 Jan 2026 |
| 754 | satellitesmvnswim.org | GoDaddy.com, LLC | 14 Mar 2011 | 5 Feb 2014 | 14 Mar 2020 |
| 755 | satellitesuites.org | Tucows Domains Inc. | 12 May 2013 | 13 Apr 2017 | 12 May 2018 |
| 756 | satellitesolution.org | NameCheap, Inc. | 8 Mar 2023 | 4 Mar 2024 | 8 Mar 2025 |
| 757 | satellitestore.org | 1API GmbH | 9 Mar 2011 | 26 Jun 2024 | 9 Mar 2025 |
| 758 | satellitespace.org | Network Solutions, LLC | 17 Oct 2011 | 3 Feb 2016 | 17 Oct 2021 |
| 759 | satelliteschools.org | Tucows Domains Inc. | 20 Apr 2007 | 10 Apr 2024 | 20 Apr 2025 |
| 760 | satellitesk12.org | GoDaddy.com, LLC | 9 Sep 2009 | 24 Oct 2024 | 9 Sep 2025 |
| 761 | satelliteservice.us | NameCheap, Inc. | 25 Mar 2017 | 25 Mar 2017 | 24 Mar 2018 |
| 762 | satellitesystemsdc.com | - | 24 Oct 2016 | 24 Oct 2016 | 24 Oct 2017 |
| 763 | satellitescreen.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 764 | satellitestock.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 765 | satelliteseeingne.xyz | NameCheap, Inc. | 3 Jun 2016 | 28 Jun 2016 | 3 Jun 2017 |
| 766 | satellitesystems.xyz | TLD Registrar Solutions Ltd. | 3 Jun 2016 | 13 Jul 2016 | 3 Jun 2017 |
| 767 | satelliteshop.de | - | - | 2 Jul 2024 | - |
| 768 | satellitestadiums.com | - | 27 Oct 2016 | 27 Oct 2016 | 27 Oct 2018 |
| 769 | satellitesnmore.com | - | 27 Oct 2016 | 27 Oct 2016 | 27 Oct 2018 |
| 770 | satellites-xml.eu | - | - | - | - |
| 771 | satellitestudio.it | - | 14 Dec 2009 | 30 Dec 2024 | 14 Dec 2025 |
| 772 | satelliteshop.it | - | 12 Aug 1997 | 11 Nov 2017 | 26 Oct 2018 |
| 773 | satellitesuperstore.co.uk | - | 18 Aug 2000 | 11 Aug 2024 | 18 Aug 2026 |
| 774 | satellitespecialist.co.uk | - | 26 Jan 2010 | 26 Jan 2025 | 26 Jan 2026 |
| 775 | satellites02.co.uk | - | 28 Sep 2022 | 28 Sep 2023 | 28 Sep 2023 |
| 776 | satellitesandaerials.co.uk | - | 11 Dec 2007 | 1 Sep 2024 | 11 Dec 2029 |
| 777 | satellites01.co.uk | - | 14 Sep 2011 | 14 Sep 2017 | 14 Sep 2019 |
| 778 | satellitester.com | BigRock Solutions Ltd. | 29 Oct 2016 | 10 Dec 2017 | 29 Oct 2017 |
| 779 | satellitesnmore.us | GoDaddy.com, LLC | 27 Oct 2016 | 28 Apr 2017 | 26 Oct 2018 |
| 780 | satellitesharing.org | Vautron Rechenzentrum AG | 2 Nov 2016 | 3 Nov 2017 | 2 Nov 2018 |
| 781 | satellitestudios.co.uk | LCN.COM Ltd. | 2 Jun 2013 | 2 Jun 2021 | 2 Jun 2024 |
| 782 | satelliteselene.org | Google, Inc. | 23 Nov 2016 | 24 Nov 2017 | 23 Nov 2018 |
| 783 | satellitesolutionsnm.net | GoDaddy.com, LLC | 23 Nov 2016 | 23 Nov 2016 | 23 Nov 2017 |
| 784 | satellitespoor.com | Sibername Internet and Software Technologies Inc. | 28 Nov 2023 | 28 Nov 2023 | 28 Nov 2025 |
| 785 | satelliteservicedirect.com | GoDaddy.com, LLC | 3 Dec 2016 | 10 Oct 2022 | 3 Dec 2026 |
| 786 | satellitesolutionsredding.com | DropCatch.com 1311 LLC | 17 Feb 2022 | 30 Apr 2023 | 17 Feb 2023 |
| 787 | satellitesplusnd.com | GoDaddy.com, LLC | 30 Dec 2016 | 30 Dec 2016 | 30 Dec 2017 |
| 788 | satellitestrategies.com | Webfusion Ltd. | 10 Jan 2017 | 11 Jan 2025 | 10 Jan 2026 |
| 789 | satellitesessionsmusic.com | FastDomain Inc. | 13 Jan 2017 | 14 Jan 2017 | 13 Jan 2018 |
| 790 | satelliteschoolblueprint.com | GoDaddy.com, LLC | 19 Jan 2017 | 19 Jan 2017 | 19 Jan 2018 |
| 791 | satellitesue.com | GoDaddy.com, LLC | 31 Jan 2017 | 1 Feb 2025 | 31 Jan 2027 |
| 792 | satelliteseemydatanewrepeats.net | Network Solutions, LLC | 4 Feb 2017 | 5 Mar 2017 | 4 Feb 2018 |
| 793 | satellitesuite.com | GoDaddy.com, LLC | 28 Oct 2022 | 21 Sep 2024 | 28 Oct 2025 |
| 794 | satellitescrews.com | Online SAS | 26 Mar 2017 | 10 Mar 2024 | 26 Mar 2025 |
| 795 | satellitestreetmap.com | NameCheap, Inc. | 27 Mar 2017 | 16 May 2017 | 27 Mar 2018 |
| 796 | satellitesignalsrocks.com | GoDaddy.com, LLC | 31 Mar 2017 | 31 Mar 2017 | 31 Mar 2019 |
| 797 | satellitesecurityservices.com | Wild West Domains, LLC | 20 Apr 2021 | 21 Apr 2023 | 20 Apr 2025 |
| 798 | satelliteslayer.com | GoDaddy.com, LLC | 7 Apr 2017 | 7 Apr 2017 | 7 Apr 2018 |
| 799 | satellitesbypedro.com | Tucows Domains Inc. | 12 Apr 2017 | 23 Jun 2024 | 12 Apr 2024 |
| 800 | satellitesupplies.co.uk | Registry Installation | 22 Sep 2012 | 14 Dec 2018 | 22 Sep 2019 |
| 801 | satellitesales.co.uk | - | 14 Dec 2010 | 23 Apr 2024 | 14 Dec 2024 |
| 802 | satelliteservicesrl.it | Key-Systems GmbH | 18 Oct 2005 | 23 Jan 2025 | 7 Jan 2026 |
| 803 | satelliteshop.fr | - | 7 Nov 2015 | 9 Oct 2017 | 7 Nov 2018 |
| 804 | satellitesconnected.com | Google, Inc. | 18 Apr 2017 | 18 Apr 2017 | 18 Apr 2018 |
| 805 | satellitescreenprinting.com | GoDaddy.com, LLC | 19 Apr 2017 | 20 Apr 2024 | 19 Apr 2025 |
| 806 | satellitesurvival.com | NameCheap, Inc. | 20 Apr 2017 | 20 Apr 2017 | 20 Apr 2018 |
| 807 | satellitesaint.com | Automattic Inc. | 21 Apr 2017 | 1 Apr 2024 | 21 Apr 2025 |
| 808 | satellitesalesandinstallation.com | GoDaddy.com, LLC | 12 May 2017 | 12 May 2017 | 12 May 2019 |
| 809 | satelliteservicesforyou.com | eNom, Inc. | 31 May 2017 | 2 May 2024 | 31 May 2025 |
| 810 | satellitespecialdeals.com | GoDaddy.com, LLC | 1 Jun 2017 | 2 Jun 2024 | 1 Jun 2025 |
| 811 | satellitesales.info | Japan Registry Services Co., Ltd. | 22 Aug 2018 | 8 Jul 2024 | 22 Aug 2025 |
| 812 | satellitesos.com | GoDaddy.com, LLC | 13 Jun 2017 | 14 Jun 2023 | 13 Jun 2025 |
| 813 | satellitesociety.com | Tucows Domains Inc. | 1 Jun 2022 | 12 Jul 2024 | 1 Jun 2024 |
| 814 | satelliteservice.ca | - | 11 Apr 2012 | 26 May 2017 | 11 Apr 2018 |
| 815 | satellitesunrise.com | Tucows Domains Inc. | 11 Jul 2017 | 15 Jul 2019 | 11 Jul 2019 |
| 816 | satellitesbox.com | NameCheap, Inc. | 11 Jul 2017 | 11 Jul 2017 | 11 Jul 2018 |
| 817 | satellitesgymnastics.ca | - | 7 Jul 2016 | 12 Jul 2016 | 7 Jul 2018 |
| 818 | satellitesarefake.com | 1&1 Internet AG | 27 Jul 2017 | 27 Jul 2017 | 27 Jul 2018 |
| 819 | satellitesrecords.net | Network Solutions, LLC | 11 Aug 2017 | 11 Aug 2017 | 11 Aug 2018 |
| 820 | satellitesweets.com | Tucows Domains Inc. | 2 Nov 2023 | 11 Nov 2024 | 2 Nov 2025 |
| 821 | satellitesolutions.info | 1&1 Internet AG | 18 Aug 2017 | 18 Aug 2017 | 18 Aug 2018 |
| 822 | satelliteswiki.com | BigRock Solutions Ltd. | 22 Aug 2017 | 22 Aug 2017 | 22 Aug 2018 |
| 823 | satelliteservicesofdaytona.net | Network Solutions, LLC | 16 Sep 2017 | 16 Sep 2017 | 16 Sep 2018 |
| 824 | satellitesellers.com | Network Solutions, LLC | 20 Sep 2017 | 20 Sep 2017 | 20 Sep 2018 |
| 825 | satellitessl.com | NameCheap, Inc. | 25 Sep 2017 | 26 Aug 2024 | 25 Sep 2025 |
| 826 | satellitestox.com | Network Solutions, LLC | 28 Sep 2017 | 28 Sep 2017 | 28 Sep 2018 |
| 827 | satellitesale.info | GoDaddy.com, LLC | 29 Sep 2017 | 13 Nov 2024 | 29 Sep 2025 |
| 828 | satellitesale.org | GoDaddy.com, LLC | 29 Sep 2017 | 13 Nov 2024 | 29 Sep 2025 |
| 829 | satellitesbroadcast.biz | NameCheap, Inc. | 29 Sep 2017 | 29 Sep 2017 | 29 Sep 2018 |
| 830 | satellitesitepromotion.com | NameCheap, Inc. | 4 Oct 2017 | 4 Oct 2017 | 4 Oct 2018 |
| 831 | satellitestaffing.com | GoDaddy.com, LLC | 12 Oct 2017 | 23 Nov 2024 | 12 Oct 2024 |
| 832 | satellitespaceau.com | Name.com, Inc. | 23 Oct 2017 | 23 Oct 2017 | 23 Oct 2018 |
| 833 | satellitesitepromotions.com | NameCheap, Inc. | 1 Nov 2017 | 1 Nov 2017 | 1 Nov 2018 |
| 834 | satellitesonearth.com | FastDomain Inc. | 9 Nov 2017 | 10 Nov 2017 | 9 Nov 2018 |
| 835 | satellitesnelson.co.nz | 1API GmbH | 4 Dec 2013 | 4 Nov 2017 | 4 Dec 2018 |
| 836 | satellitestemcells.com | DreamHost, LLC | 24 Nov 2017 | 24 Nov 2017 | 24 Nov 2018 |
| 837 | satellitessolutions.com | GoDaddy.com, LLC | 21 Mar 2023 | 2 May 2024 | 21 Mar 2024 |
| 838 | satellitesimulator.co.uk | Reserved | 1 Jan 2010 | 31 Dec 2017 | 1 Jan 2020 |
| 839 | satellitesforeveryone.co.uk | - | 3 Apr 2014 | 8 Aug 2024 | 3 Apr 2025 |
| 840 | satellitesuppliers.co.uk | - | 18 Feb 2010 | 11 May 2016 | 18 Feb 2018 |
| 841 | satellitesforeveryone.uk | - | 10 Jun 2014 | 14 Aug 2024 | 10 Jun 2026 |
| 842 | satelliteservices-burton.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 25 Jan 2014 | 18 Jan 2016 | 25 Jan 2018 |
| 843 | satellitesystems.co.uk | - | 26 Jan 2012 | 6 Jan 2025 | 26 Jan 2026 |
| 844 | satelliteservices-ashby.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 25 Jan 2014 | 18 Jan 2016 | 25 Jan 2018 |
| 845 | satellitestore.co.uk | - | 23 Jun 1999 | 27 Jun 2023 | 23 Jun 2025 |
| 846 | satellites4everyone.uk | - | 10 Jun 2014 | 15 Aug 2024 | 10 Jun 2026 |
| 847 | satellitestorage.co.uk | - | 25 Jun 2007 | 18 Jun 2017 | 25 Jun 2019 |
| 848 | satellitesformotorhomes.co.uk | - | 18 Jul 2011 | 18 Jun 2017 | 18 Jul 2018 |
| 849 | satellites4everyone.co.uk | - | 3 Apr 2014 | 7 Aug 2024 | 3 Apr 2025 |
| 850 | satellitesolutionsworldwide.co.uk | - | 27 Nov 2008 | 28 Oct 2017 | 27 Nov 2018 |
| 851 | satellitesupportservice.co.uk | - | 2 Oct 2015 | 18 Sep 2017 | 2 Oct 2019 |
| 852 | satellitesmusic.co.uk | - | 28 May 2004 | 28 Apr 2017 | 28 May 2018 |
| 853 | satellitestalbans.co.uk | - | 5 Apr 2024 | 11 Aug 2024 | 5 Apr 2025 |
| 854 | satellitespy.co.uk | - | 22 Dec 2010 | 21 Dec 2024 | 22 Dec 2025 |
| 855 | satellitespeakers.co.uk | - | 4 Mar 2010 | 19 Apr 2017 | 4 Mar 2018 |
| 856 | satelliteservices-coalville.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 25 Jan 2014 | 18 Jan 2016 | 25 Jan 2018 |
| 857 | satelliteservice.co.uk | - | 3 Feb 2007 | 1 Feb 2017 | 3 Feb 2019 |
| 858 | satelliteshop.co.uk | - | 24 Mar 1998 | 10 Mar 2024 | 24 Mar 2025 |
| 859 | satelliteskin.co.uk | - | 10 Sep 2006 | 11 Aug 2024 | 10 Sep 2025 |
| 860 | satellitesforcaravans.co.uk | - | 18 Jul 2011 | 18 Jun 2017 | 18 Jul 2018 |
| 861 | satellitesolutions.uk | - | 4 Oct 2014 | 16 Jan 2017 | 4 Oct 2018 |
| 862 | satellitesolutions.co.uk | - | 12 Nov 2021 | 13 Nov 2024 | 12 Nov 2025 |
| 863 | satelliteservicecare.co.uk | - | 4 Oct 2010 | 20 Sep 2017 | 4 Oct 2018 |
| 864 | satellitestrategies.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 10 Jan 2017 | 17 Jan 2017 | 10 Jan 2019 |
| 865 | satellitesessions.co.uk | - | 8 Mar 2022 | 3 Sep 2024 | 8 Mar 2025 |
| 866 | satellitesoundandvision.co.uk | - | 5 Oct 2012 | 21 Dec 2024 | 5 Oct 2025 |
| 867 | satellitesband.co.uk | - | 13 Mar 2014 | 13 Mar 2017 | 13 Mar 2020 |
| 868 | satelliteservices.co.uk | - | 21 Dec 2022 | 7 Dec 2024 | 21 Dec 2025 |
| 869 | satellitespotting.co.uk | - | 11 Nov 2014 | 5 Jun 2016 | 11 Nov 2019 |
| 870 | satellitestatedisko.co.uk | - | 30 Apr 2014 | 23 Nov 2024 | 30 Apr 2025 |
| 871 | satellitesupport.co.uk | Key-Systems GmbH | 5 Mar 2013 | 20 Feb 2017 | 5 Mar 2018 |
| 872 | satellitesimulators.co.uk | Reserved | 1 Jan 2010 | 31 Dec 2017 | 1 Jan 2020 |
| 873 | satellitesteve.co.uk | - | 4 Apr 2011 | 5 Apr 2017 | 4 Apr 2018 |
| 874 | satellitesuperstore.org.uk | - | 18 Aug 2000 | 11 Aug 2016 | 18 Aug 2018 |
| 875 | satellitesocialmedia.co.uk | - | 28 Mar 2014 | 24 Apr 2024 | 28 Mar 2026 |
| 876 | satellitesecurity.co.uk | - | 6 Nov 2023 | 5 Nov 2024 | 6 Nov 2025 |
| 877 | satellitesuperstore.uk | - | 17 Jun 2014 | 10 Jun 2017 | 17 Jun 2018 |
| 878 | satelliteschoolofenglish.co.uk | - | 22 Feb 2018 | 23 Feb 2018 | 22 Feb 2020 |
| 879 | satellitesolutionsknox.com | Google, Inc. | 25 Feb 2018 | 25 Feb 2018 | 25 Feb 2019 |
| 880 | satellitescowork.com | Tucows Domains Inc. | 4 Mar 2018 | 17 Feb 2025 | 4 Mar 2026 |
| 881 | satelliteslimes.com | Google, Inc. | 10 Mar 2018 | 11 Mar 2018 | 10 Mar 2019 |
| 882 | satellites101.com | Google, Inc. | 1 Jan 2023 | 23 Dec 2024 | 1 Jan 2026 |
| 883 | satellitestudios.org.uk | - | 9 Mar 2018 | 9 Mar 2018 | 9 Mar 2019 |
| 884 | satelliteschain.com | HiChina Zhicheng Technology Limited | 13 Mar 2018 | 13 Mar 2018 | 13 Mar 2019 |
| 885 | satelliteserviceca.com | Name.com, Inc. | 28 Mar 2018 | 28 Mar 2018 | 28 Mar 2019 |
| 886 | satellitestudios.org | GoDaddy.com, LLC | 9 Mar 2018 | 9 Mar 2018 | 9 Mar 2019 |
| 887 | satellitesonsaturn.com | Domain.com, LLC | 16 Apr 2018 | 16 Apr 2018 | 16 Apr 2019 |
| 888 | satellitespying.com | TPP Wholesale Pty Ltd. | 20 Apr 2018 | 20 Apr 2018 | 20 Apr 2019 |
| 889 | satellitespys.com | TPP Wholesale Pty Ltd. | 27 Apr 2018 | 27 Apr 2018 | 27 Apr 2019 |
| 890 | satellitesroom.science | NameCheap, Inc. | 4 Apr 2018 | 9 Apr 2018 | 4 Apr 2019 |
| 891 | satellitesex.com | TPP Wholesale Pty Ltd. | 29 Apr 2018 | 29 Apr 2018 | 29 Apr 2019 |
| 892 | satellitespares.com | TPP Wholesale Pty Ltd. | 29 Apr 2018 | 29 Apr 2018 | 29 Apr 2019 |
| 893 | satelliteselling.com | TPP Wholesale Pty Ltd. | 29 Apr 2018 | 29 Apr 2018 | 29 Apr 2019 |
| 894 | satellitesolutions.online | GoDaddy.com, LLC | 2 May 2018 | 30 Jul 2024 | 2 May 2025 |
| 895 | satellitesrecords.online | Network Solutions, LLC | 2 May 2018 | 2 May 2018 | 2 May 2019 |
| 896 | satelliteshaw.com | One.com A/S | 6 May 2018 | 6 May 2018 | 6 May 2019 |
| 897 | satellitessurrey.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 9 May 2018 | 9 May 2018 | 9 May 2019 |
| 898 | satellitesystems.tv | GoDaddy.com, LLC | 26 Aug 2017 | 26 Aug 2017 | 26 Aug 2018 |
| 899 | satellitestyle.com | GoDaddy.com, LLC | 1 Jun 2018 | 2 Jun 2024 | 1 Jun 2025 |
| 900 | satelliteservicesdr.com | NameCheap, Inc. | 5 Jun 2018 | 5 Jun 2018 | 5 Jun 2021 |
| 901 | satellitestoragetech.com | Tucows Domains Inc. | 12 Jun 2018 | 16 Jun 2020 | 12 Jun 2020 |
| 902 | satellitestance.com | Moniker Online Services LLC | 13 Jun 2018 | 16 Mar 2019 | 13 Jun 2019 |
| 903 | satellitescorpions.com | Amazon Registrar, Inc. | 26 Jun 2024 | 26 Jun 2024 | 26 Jun 2025 |
| 904 | satellitesciences.com | GoDaddy.com, LLC | 25 Jun 2018 | 25 Jun 2018 | 25 Jun 2019 |
| 905 | satellitesolutions.mobi | eNom, Inc. | 18 Dec 2017 | 16 Feb 2018 | 18 Dec 2018 |
| 906 | satelliteslimesco.com | Google, Inc. | 2 Jul 2018 | 2 Jul 2018 | 2 Jul 2019 |
| 907 | satelliteslimesshop.com | Google, Inc. | 6 Jul 2018 | 6 Jul 2018 | 6 Jul 2019 |
| 908 | satellitescooners.com | GoDaddy.com, LLC | 16 Jul 2018 | 16 Jul 2018 | 16 Jul 2019 |
| 909 | satelliteslime.com | Google, Inc. | 19 Jul 2018 | 19 Jul 2018 | 19 Jul 2019 |
| 910 | satelliteschoice.com | GoDaddy.com, LLC | 25 Jul 2018 | 25 Jul 2018 | 25 Jul 2020 |
| 911 | satellitesolution.biz | Network Solutions, LLC | 25 Jul 2018 | 24 Oct 2024 | 25 Jul 2025 |
| 912 | satellitespros.net | Network Solutions, LLC | 15 Aug 2018 | 15 Aug 2018 | 15 Aug 2019 |
| 913 | satellitesalesreps.com | GoDaddy.com, LLC | 17 Aug 2018 | 17 Aug 2018 | 17 Aug 2019 |
| 914 | satellitesystemsandrepairservice.com | 1&1 Internet AG | 23 Aug 2018 | 23 Aug 2018 | 23 Aug 2019 |
| 915 | satellitesoult.com | OVH sas | 24 Aug 2018 | 24 Aug 2018 | 24 Aug 2019 |
| 916 | satellitesthebook.com | GoDaddy.com, LLC | 4 Sep 2018 | 4 Sep 2018 | 4 Sep 2019 |
| 917 | satellitesbook.com | Dynadot, LLC | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 918 | satellitesimports.com | GoDaddy.com, LLC | 10 Sep 2018 | 11 Sep 2024 | 10 Sep 2025 |
| 919 | satellitesobservation.com | NameCheap, Inc. | 10 Sep 2018 | 10 Sep 2018 | 10 Sep 2019 |
| 920 | satellitesobservations.com | enom423, Incorporated | 2 Dec 2019 | 3 Dec 2019 | 2 Dec 2020 |
| 921 | satellites-solutions.com | GoDaddy.com, LLC | 14 Mar 2018 | 14 Mar 2018 | 14 Mar 2019 |
| 922 | satellitestealth.com | Uniregistrar Corp | 24 Sep 2018 | 5 Oct 2024 | 24 Sep 2025 |
| 923 | satellitestealthteam.com | Uniregistrar Corp | - | - | - |
| 924 | satellitestealthassist.com | Uniregistrar Corp | - | - | - |
| 925 | satellitespeedtest.com | GoDaddy.com, LLC | 6 Apr 2022 | 18 Apr 2024 | 6 Apr 2025 |
| 926 | satelliteservice.ltd | NameCheap, Inc. | 8 Oct 2018 | 8 Oct 2018 | 8 Oct 2019 |
| 927 | satelliteservice.online | GoDaddy.com, LLC | 19 Feb 2025 | - | 19 Feb 2026 |
| 928 | satellitesfilm.com | DreamHost, LLC | 18 Oct 2018 | 18 Oct 2018 | 18 Oct 2019 |
| 929 | satellitesmash.com | Google, Inc. | 29 Oct 2018 | 14 Oct 2024 | 29 Oct 2025 |
| 930 | satellitestv.site | NameCheap, Inc. | 30 Oct 2018 | 30 Oct 2018 | 30 Oct 2019 |
| 931 | satellitesworld.com | GoDaddy.com, LLC | 4 Nov 2022 | 16 Jan 2024 | 4 Nov 2023 |
| 932 | satelliteservices.online | NameCheap, Inc. | 10 Nov 2018 | 10 Nov 2018 | 10 Nov 2019 |
| 933 | satellitesathletics.com | Amazon Registrar, Inc. | 13 Nov 2018 | 10 Oct 2024 | 13 Nov 2025 |
| 934 | satellitesolutionsofky.com | GoDaddy.com, LLC | 19 Nov 2018 | 19 Nov 2018 | 19 Nov 2019 |
| 935 | satelliteservicesavings.com | 1&1 Internet AG | 7 Dec 2018 | 7 Dec 2018 | 7 Dec 2019 |
| 936 | satellites-dip.com | GoDaddy.com, LLC | 4 Jan 2019 | 4 Jan 2019 | 4 Jan 2021 |
| 937 | satellitesdip.com | GoDaddy.com, LLC | 22 Jun 2021 | 4 Jul 2024 | 22 Jun 2025 |
| 938 | satellitesrilal.com | GoDaddy.com, LLC | 14 Jan 2019 | 14 Jan 2019 | 14 Jan 2020 |
| 939 | satellitestvbundles.com | GoDaddy.com, LLC | 17 Jan 2019 | 17 Jan 2019 | 17 Jan 2020 |
| 940 | satelliteskw.com | Realtime Register B.V. | 28 Aug 2023 | 4 Aug 2024 | 28 Aug 2025 |
| 941 | satelliteserv.com | Promo People inc. | 9 Feb 2019 | 5 Feb 2025 | 9 Feb 2026 |
| 942 | satellitesale.net | GoDaddy.com, LLC | 29 Sep 2017 | 31 Aug 2023 | 29 Sep 2025 |
| 943 | satellitesfriend.com | Google, Inc. | 17 Feb 2019 | 17 Feb 2019 | 17 Feb 2020 |
| 944 | satellitesoftware.dev | Google, Inc. | 28 Feb 2019 | 18 Apr 2024 | 28 Feb 2025 |
| 945 | satellitesandcities.com | GoDaddy.com, LLC | 30 Mar 2019 | 11 Apr 2024 | 30 Mar 2025 |
| 946 | satellitesurvivor.business | Google, Inc. | 9 Apr 2019 | 9 Apr 2019 | 9 Apr 2020 |
| 947 | satellitesol.com | Go Australia Domains, LLC | 13 Apr 2019 | 14 Apr 2019 | 13 Apr 2020 |
| 948 | satellitestrange.com | GoDaddy.com, LLC | 19 Apr 2019 | 19 Apr 2024 | 19 Apr 2025 |
| 949 | satellitesimple.com | GoDaddy.com, LLC | 25 Apr 2019 | 25 Apr 2024 | 25 Apr 2025 |
| 950 | satellitesafe.com | GoDaddy.com, LLC | 25 Apr 2019 | 25 Apr 2024 | 25 Apr 2025 |
| 951 | satellitesa.com | - | 17 Jul 2023 | 18 Aug 2024 | 17 Jul 2024 |
| 952 | satellitesactivatedbynolan.com | Tucows Domains Inc. | 14 May 2019 | 29 Apr 2024 | 14 May 2025 |
| 953 | satellitesinternetsales.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 May 2019 | 15 May 2019 | 15 May 2020 |
| 954 | satellitestoreonline.com | GoDaddy.com, LLC | 17 May 2019 | 17 May 2019 | 17 May 2020 |
| 955 | satellitestarlink.com | GoDaddy.com, LLC | 14 Nov 2020 | 14 Nov 2020 | 14 Nov 2021 |
| 956 | satellites-unlimited.com | GoDaddy.com, LLC | 8 Mar 2018 | 9 Mar 2024 | 8 Mar 2026 |
| 957 | satellitestateclothing.com | Tucows Domains Inc. | 21 Jun 2019 | 21 Jun 2019 | 21 Jun 2020 |
| 958 | satellitesystemssolutions.com | 1&1 Internet AG | 22 Jun 2019 | 22 Jun 2019 | 22 Jun 2020 |
| 959 | satellitescasualty.com | Google, Inc. | 22 Jun 2019 | 22 Jun 2019 | 22 Jun 2020 |
| 960 | satellitesasaservice.com | GoDaddy.com, LLC | 23 Jun 2019 | 4 Sep 2024 | 23 Jun 2024 |
| 961 | satellitestreamingservice.com | GoDaddy.com, LLC | 27 Jun 2019 | 7 Aug 2024 | 27 Jun 2024 |
| 962 | satellitesinorbit.com | Launchpad, Inc. | 2 Jul 2019 | 2 Jul 2019 | 2 Jul 2020 |
| 963 | satelliteskincare.com | Tucows Domains Inc. | 19 Jul 2019 | 23 Jul 2022 | 19 Jul 2022 |
| 964 | satellitescorpionsbaseball.com | Wild West Domains, LLC | 19 Jul 2019 | 19 Jul 2019 | 19 Jul 2020 |
| 965 | satellitesmartphones.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Sep 2023 | 12 Sep 2024 | 10 Sep 2025 |
| 966 | satellitesim.com | Crazy Domains FZ-LLC | 4 Oct 2023 | 14 Feb 2024 | 4 Oct 2025 |
| 967 | satellitesim.cloud | Tucows Domains Inc. | 12 Aug 2019 | 16 Aug 2020 | 12 Aug 2020 |
| 968 | satellitesco.com | Google, Inc. | 12 Aug 2019 | 26 Jul 2020 | 12 Aug 2020 |
| 969 | satellitesounddesign.com | Google, Inc. | 22 Aug 2019 | 22 Aug 2019 | 22 Aug 2020 |
| 970 | satelliteseopages.com | GoDaddy.com, LLC | 29 Aug 2019 | 29 Aug 2019 | 29 Aug 2020 |
| 971 | satelliteseoautomation.com | GoDaddy.com, LLC | 29 Aug 2019 | 29 Aug 2019 | 29 Aug 2020 |
| 972 | satellitesofia.com | eNom, Inc. | 2 Sep 2019 | 2 Sep 2019 | 2 Sep 2020 |
| 973 | satelliteserviceproviderstockbridgemi.com | GoDaddy.com, LLC | 9 Sep 2019 | 9 Sep 2019 | 9 Sep 2020 |
| 974 | satellitesmarter.com | Uniregistrar Corp | - | - | - |
| 975 | satelliteservicedeal.com | NameCheap, Inc. | 27 Sep 2019 | - | 27 Sep 2020 |
| 976 | satellitestack.com | Uniregistrar Corp | 27 Sep 2019 | 1 Jan 2025 | 27 Sep 2025 |
| 977 | satellitesnetwork.com | GoDaddy.com, LLC | 26 Oct 2019 | 25 Oct 2024 | 26 Oct 2025 |
| 978 | satellitesgifts.com | Network Solutions, LLC | 8 Dec 2019 | 8 Dec 2019 | 8 Dec 2020 |
| 979 | satellitesmd.com | GoDaddy.com, LLC | 19 Dec 2019 | 19 Dec 2019 | 19 Dec 2020 |
| 980 | satelliteshouldsometimes.com | GoDaddy.com, LLC | 23 Dec 2019 | 23 Dec 2019 | 23 Dec 2020 |
| 981 | satelliteshouldshould.com | GoDaddy.com, LLC | 23 Dec 2019 | 23 Dec 2019 | 23 Dec 2020 |
| 982 | satellitesecuriteservices.com | Gandi SAS | 24 Dec 2019 | 23 Dec 2024 | 24 Dec 2025 |
| 983 | satellitespecial.co | GoDaddy.com, LLC | 10 Apr 2019 | 15 Apr 2019 | 10 Apr 2020 |
| 984 | satelliteshakespeare.com | NameCheap, Inc. | 6 Feb 2020 | - | 6 Feb 2021 |
| 985 | satellitesyd.com | NameCheap, Inc. | 5 Feb 2020 | - | 5 Feb 2021 |
| 986 | satelliteshakes.com | NameCheap, Inc. | 6 Feb 2020 | - | 6 Feb 2021 |
| 987 | satellitespirits.com | GoDaddy.com, LLC | 2 Mar 2018 | 3 Mar 2024 | 2 Mar 2025 |
| 988 | satellitespotter.com | Amazon Registrar, Inc. | 16 Feb 2020 | 12 Jan 2025 | 16 Feb 2026 |
| 989 | satellitesprovidesglobalwarming.cloud | Namesilo, LLC | 17 Feb 2020 | 3 Apr 2021 | 17 Feb 2022 |
| 990 | satellitesoundsystems.com | Wild West Domains, LLC | 1 Mar 2020 | 12 Apr 2023 | 1 Mar 2023 |
| 991 | satellitesmedical.com | GoDaddy.com, LLC | 8 Mar 2020 | 16 Nov 2022 | 8 Mar 2025 |
| 992 | satellitesportsug.com | LiquidNet Ltd. | 8 Mar 2020 | 8 Mar 2020 | 8 Mar 2021 |
| 993 | satelliteshogun.com | GoDaddy.com, LLC | 13 Mar 2020 | 13 Mar 2020 | 13 Mar 2021 |
| 994 | satellitesar.com | GoDaddy.com, LLC | 20 Mar 2020 | 21 Mar 2024 | 20 Mar 2025 |
| 995 | satellitestoke.com | GoDaddy.com, LLC | 20 Mar 2020 | 21 Mar 2024 | 20 Mar 2025 |
| 996 | satellitesd.com | Google, Inc. | 22 Aug 2023 | 21 Sep 2024 | 22 Aug 2024 |
| 997 | satellitesensing.com | Dynadot, LLC | 24 Nov 2023 | 22 Dec 2024 | 24 Nov 2025 |
| 998 | satellitesurveillancesecurity.com | register.com, Inc. | 23 Apr 2020 | 23 Apr 2020 | 23 Apr 2021 |
| 999 | satellites5g.com | FastDomain Inc. | 30 Apr 2020 | 15 Apr 2024 | 30 Apr 2025 |
| 1000 | satelliteswing.com | GoDaddy.com, LLC | 9 May 2020 | 10 May 2024 | 9 May 2025 |
Displaying 1,000 out of 1,376 domains starting with the keyword "SATELLITES". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=satellites
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |