Keyword: SIDDHIVINAYAKDIGITAL
Reverse Whois » KEYWORD [siddhivinayakdigital ] { 2 domain names }
Num | Domain Name | Registrar | Created | Updated | Expiry |
---|---|---|---|---|---|
1 | siddhivinayakdigital.com | GoDaddy.com, LLC | 14 Nov 2023 | 27 Nov 2023 | 14 Nov 2025 |
2 | siddhivinayakdigitalprintinggift.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 May 2024 | 6 May 2024 | 1 May 2025 |
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=siddhivinayakdigital
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
---|---|---|---|---|
200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |