Our database now contains whois records of 605 Million (605,612,477) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [605 Million Domains] $10,000 Details

Keyword: SRID

Reverse Whois » KEYWORD [srid ]  { 3,184 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1srid.infoGoDaddy.com, LLC28 Nov 202128 Nov 202128 Nov 2022
2srid.comGandi SAS21 Nov 199819 Aug 202420 Nov 2025
3srid.orgGoDaddy.com, LLC14 Feb 201615 Feb 202514 Feb 2026
4srid.topChengdu West Dimension Digital Technology Co., Ltd…16 Feb 2016-16 Feb 2017
5srid.xyzChengdu West Dimension Digital Technology Co., Ltd…9 Nov 202415 Dec 20249 Nov 2025
6srid.redAlpnames Limited2 Mar 20162 Mar 20162 Mar 2017
7srid.kimAlpnames Limited31 Mar 201631 Mar 201631 Mar 2017
8srid.proAlpnames Limited23 Apr 201623 Apr 201623 Apr 2017
9srid.mobiGoDaddy.com, LLC19 Jun 201617 Jul 202419 Jun 2026
10srid.bizGoDaddy.com, LLC19 Jun 201629 Jun 202418 Jun 2026
11srid.usGoDaddy.com, LLC19 Jun 201619 Jun 201618 Jun 2021
12srid.wangeName Technology Co., Ltd.1 Mar 20169 Jul 20161 Mar 2017
13srid.netDropCatch.com 346 LLC30 Mar 201812 Feb 202530 Mar 2025
14srid.winAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…10 Nov 201612 Jun 20179 Nov 2017
15srid.ltdAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…12 Sep 201712 Sep 201712 Sep 2018
16srid.co.uk-29 Dec 20206 Mar 202329 Dec 2025
17srid.linkPDR Ltd. d/b/a PublicDomainRegistry.com9 May 20189 May 20189 May 2019
18srid.ca-25 Jan 201526 Dec 202425 Jan 2026
19srid.clubHangzhou AiMing Network Co., LTD29 Oct 202129 Nov 202229 Oct 2022
20srid.nameAmazon Registrar, Inc.---
21srid.devGoogle, Inc.27 May 20211 Jul 202427 May 2026
22srid.ineNom, Inc.9 Mar 201316 Apr 20209 Mar 2028
23srid.nl-18 Nov 200927 May 2024-
24srid.websiteNameCheap, Inc.3 Apr 201816 May 20243 Apr 2024
25srid.ru-8 May 2020-8 May 2025
26srid.de--30 Mar 2023-
27srid.techAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 May 20241 Jun 202422 May 2027
28srid.asiaAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Jun 20247 Jun 20242 Jun 2025
29sridharkatakam.comCloudFlare, Inc.27 Nov 20092 Dec 202427 Nov 2025
30sridianti.comCloudFlare, Inc.10 Feb 201310 Jul 202410 Feb 2026
31sridurgajewellers.inGoDaddy.com, LLC17 Nov 202229 Dec 202417 Nov 2024
32sridigital.comTurnCommerce, Inc. DBA NameBright.com22 Oct 201416 Oct 202022 Oct 2025
33sridevsuman.comGoDaddy.com, LLC3 May 202315 Jul 20243 May 2024
34sridaivayogachicago.comGoDaddy.com, LLC23 Oct 201423 Oct 201423 Oct 2015
35sridairy.comGood Domain Registry Pvt Ltd.23 Oct 201416 Sep 202423 Oct 2025
36sriderana.comGoDaddy.com, LLC2 Jan 20085 Jan 20252 Jan 2026
37sridivyadecorator.comDropCatch.com 678 LLC27 Apr 20238 Jul 202427 Apr 2024
38sridevi.orgregister.com, Inc.31 May 201715 Jul 202431 May 2025
39sridate.comAutomattic Inc.1 Mar 202114 May 20241 Mar 2024
40sridigest.comGoDaddy.com, LLC30 May 201131 May 201530 May 2016
41sridurgaconsultancy.comGoDaddy.com, LLC31 May 20141 Jun 201531 May 2016
42sridheerendramutt.orgGoDaddy.com, LLC6 Jun 201318 Jun 20156 Jun 2016
43sridevijewelers.comHostinger, UAB19 Jan 202519 Jan 202519 Jan 2027
44sridba.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
45sridivyaonline.comGoDaddy.com, LLC31 Mar 20141 Apr 202431 Mar 2025
46srido.comPSI-USA, Inc. dba Domain Robot12 Apr 20101 Jun 202412 Apr 2025
47sridonchai.comeNom, Inc.10 Aug 201315 Jul 201710 Aug 2017
48sridharupvc.com----
49sridevisex.comWild West Domains, LLC5 Feb 201316 Jan 20255 Feb 2026
50sridharms.comGoDaddy.com, LLC25 Jul 201925 Jul 202425 Jul 2025
51sridigvijayaenterprises.comDomain.com, LLC17 Aug 201417 Aug 201417 Aug 2015
52sridurgaenterprise.comGoDaddy.com, LLC13 Aug 202413 Aug 202413 Aug 2025
53sridattasaiashramam.comGoDaddy.com, LLC17 Jun 201418 Jun 201517 Jun 2016
54sridasanjaneyajewellers.comGoDaddy.com, LLC18 Aug 201418 Aug 201418 Aug 2015
55srideviclasses.comBigRock Solutions Ltd.19 Aug 201419 Aug 202419 Aug 2025
56sridreams.comregister.com, Inc.16 Jun 201817 Jun 202416 Jun 2025
57sridurgabhavani.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Feb 202517 Feb 202516 Feb 2026
58sridhagroup.comTucows Domains Inc.23 Aug 201427 Aug 201523 Aug 2016
59sridasyam.comNameCheap, Inc.14 Apr 201512 Sep 202314 Apr 2025
60sridurgagranites.comGoDaddy.com, LLC10 Nov 201410 Nov 201510 Nov 2017
61sridhara.comGoDaddy.com, LLC11 Jul 199616 Dec 202410 Jul 2025
62sridhar-seva-ashram.orgGoDaddy.com, LLC25 Aug 201425 Aug 201425 Aug 2015
63sridurgatravelsandonlineservices.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 201427 Aug 201427 Aug 2015
64sridhammarama.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Aug 201427 Aug 201427 Aug 2015
65sridevicards.comBigRock Solutions Ltd.15 Aug 201415 Aug 201415 Aug 2015
66sridewiutama.com-5 Mar 20225 Mar 20225 Mar 2023
67sridurgaidrivingschool.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Aug 201415 Aug 201415 Aug 2015
68sridhar.infoHostinger, UAB9 Sep 202319 Aug 20249 Sep 2025
69sridharkondakalla.comGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
70sridurgagranites.netGoDaddy.com, LLC10 Nov 201410 Nov 201410 Nov 2015
71sridharuniversity.orgGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
72srideranaadz.infoGoDaddy.com, LLC29 Aug 201429 Aug 201429 Aug 2015
73sridoutgardendesign.comTucows Domains Inc.9 Sep 201313 Sep 20149 Sep 2015
74sridharyerramilli.infoWild West Domains, LLC12 Sep 201412 Sep 201412 Sep 2015
75sridurgatextiles.orgPDR Ltd. d/b/a PublicDomainRegistry.com30 Aug 201430 Aug 201430 Aug 2015
76sridivyaevents.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
77srideviglasshouse.comBigRock Solutions Ltd.15 Nov 201417 Oct 201715 Nov 2018
78sridurgaacademy.comGoDaddy.com, LLC9 Apr 202221 May 20239 Apr 2023
79sridathaicuisine.netNameCheap, Inc.14 Nov 201415 Oct 202414 Nov 2025
80sridivyacci.comGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2015
81sridoctor.orgNetEarth One Inc. d/b/a NetEarth4 Sep 20144 Sep 20144 Sep 2015
82sridurgaagencies.infoTucows Domains Inc.1 Sep 20095 Sep 20141 Sep 2015
83sridayaatrust.orgGoDaddy.com, LLC22 Jul 202225 Aug 202422 Jul 2027
84sridx.biz-18 Sep 2014-17 Sep 2015
85sridiinfotech.comTucows Domains Inc.6 Dec 202423 Dec 20246 Dec 2025
86sridhar43.com1&1 Internet AG3 Oct 201411 Jun 20173 Oct 2017
87sriduth.comGoDaddy.com, LLC2 Oct 20142 Oct 20142 Oct 2015
88sridharmasasthaexports.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Nov 201419 Nov 201419 Nov 2015
89sridarbarsahib.comCloudFlare, Inc.11 Aug 202311 Sep 202411 Aug 2025
90sridewa.orgPDR Ltd. d/b/a PublicDomainRegistry.com8 Jun 201418 Nov 20148 Jun 2015
91sridharnarasimhan.comTucows Domains Inc.20 Nov 201424 Nov 201820 Nov 2018
92srideas.comTurnCommerce, Inc. DBA NameBright.com11 Mar 202127 Aug 202111 Mar 2025
93sridigitalmedia.comNameCheap, Inc.10 Aug 202221 Sep 202310 Aug 2023
94sridas.comTurnCommerce, Inc. DBA NameBright.com20 Apr 201914 Apr 202120 Apr 2025
95sridurgaphysiotherapy.comGoDaddy.com, LLC6 Oct 20146 Oct 20146 Oct 2015
96sridurgaagranites.comGoDaddy.com, LLC7 Oct 20147 Sep 20157 Oct 2017
97sridurgaconstructions.comWild West Domains, LLC12 Aug 202111 Aug 202112 Aug 2022
98sridaiva.usGoDaddy.com, LLC29 Sep 20148 Oct 201728 Sep 2018
99sriduropathexim.comBigRock Solutions Ltd.29 Sep 201429 Sep 201429 Sep 2015
100sridaiva.netGoDaddy.com, LLC29 Sep 201430 Sep 201629 Sep 2017
101sridurgaengg.comGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2017
102sridondlakrishna.infoGoDaddy.com, LLC11 Oct 201411 Oct 201411 Oct 2015
103srideepamsteelfurnitec.comGoDaddy.com, LLC16 Oct 201417 Oct 202416 Oct 2025
104sridomllc.comNetwork Solutions, LLC24 Nov 20145 Mar 201724 Nov 2017
105srider.netGabia, Inc.10 Oct 201126 Sep 202210 Oct 2025
106sridevikanyaafineart.comTucows Domains Inc.14 Oct 201018 Oct 201414 Oct 2015
107srid7.comeNom, Inc.13 Oct 201413 Oct 201413 Oct 2015
108sridurgaonlineads.comGoDaddy.com, LLC13 Oct 201413 Oct 201413 Oct 2015
109sridattapyragnivastu.com----
110sriderindiaimports.comGMO Internet Inc.17 Jan 201817 Jan 201817 Jan 2019
111sridevihydraulics.comGoDaddy.com, LLC1 Jul 202130 Jun 20241 Jul 2026
112sridevitextiles.comGoDaddy.com, LLC21 Mar 202322 Mar 202321 Mar 2026
113srideviportfolio.comTucows Domains Inc.24 Nov 201228 Nov 201424 Nov 2015
114sridatp.comGoDaddy.com, LLC4 Dec 20144 Dec 20144 Dec 2015
115sridcpowerservices.netTucows Domains Inc.1 Dec 20115 Dec 20141 Dec 2015
116sridcpower.netTucows Domains Inc.1 Dec 20115 Dec 20141 Dec 2015
117sridcpowerservices.orgTucows Domains Inc.1 Dec 20115 Dec 20141 Dec 2015
118sridcpower.orgTucows Domains Inc.1 Dec 20115 Dec 20141 Dec 2015
119sriduttconstruction.comGoDaddy.com, LLC8 Dec 20148 Dec 20148 Dec 2015
120srideviya.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Dec 20149 Dec 20149 Dec 2015
121sridarshanpackaging.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Mar 20203 Mar 20252 Mar 2026
122sridurgasbco.comGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2015
123sridurgavalli.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
124sridadi.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Dec 201416 Dec 201416 Dec 2015
125srideviitsolutions.netDomainshype.com, Inc.15 Dec 201415 Dec 201415 Dec 2015
126sridevipalace.comGoDaddy.com, LLC16 Dec 201417 Dec 202416 Dec 2029
127sridattasb.comGoDaddy.com, LLC17 Dec 201417 Dec 201417 Dec 2015
128srideviengineering.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Dec 201411 Dec 202419 Dec 2025
129sridharphotography.comGoDaddy.com, LLC6 May 20156 May 20156 May 2017
130sridurgatraders.comGoDaddy.com, LLC15 Nov 202327 Jan 202515 Nov 2024
131sridharan-m.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 201422 Dec 201422 Dec 2015
132sridhanganga.comPDR Ltd. d/b/a PublicDomainRegistry.com31 Mar 202312 May 202431 Mar 2024
133sridathaicuisineupland.comGoDaddy.com, LLC26 Dec 20141 Nov 201626 Dec 2017
134sridevirestaurant.netBigRock Solutions Ltd.25 Dec 201425 Dec 201425 Dec 2015
135sridevipress.comNameCheap, Inc.27 Dec 201426 Dec 202427 Dec 2025
136srideve.comTucows Domains Inc.25 Dec 201129 Dec 201425 Dec 2015
137sridurgahandicrafts.comGoDaddy.com, LLC25 Nov 201627 Nov 202425 Nov 2025
138sridhavagurusirpakkalaikoodam.comGoDaddy.com, LLC30 Dec 201430 Dec 201430 Dec 2015
139sridhar2015.comGoDaddy.com, LLC1 Jan 20151 Jan 20151 Jan 2016
140srideva.comHostinger, UAB28 Sep 202229 Sep 202428 Sep 2025
141srideva.org1API GmbH31 Dec 201431 Dec 201431 Dec 2015
142srideva.net1API GmbH31 Dec 201431 Dec 201431 Dec 2015
143sridattasaisolarsystems.netDomainshype.com, Inc.1 Jan 20151 Jan 20151 Jan 2016
144srideviyoga.comGoDaddy.com, LLC2 Jan 20152 Jan 20152 Jan 2017
145sridurgaresidency.netGood Domain Registry Pvt Ltd.3 Jan 20153 Jan 20153 Jan 2016
146sridharma.xyzNetwork Solutions, LLC7 Jul 20148 Jul 20147 Jul 2015
147sridee.xyzNetwork Solutions, LLC11 Jun 201412 Jun 201411 Jun 2015
148sridhar.surgeryGoDaddy.com, LLC14 Aug 201428 Sep 202414 Aug 2025
149sridivya.actorGoDaddy.com, LLC15 Sep 201415 Sep 201415 Sep 2015
150srider.yokohamaGMO Internet Inc.9 Sep 20149 Sep 20149 Sep 2015
151sridar.guruPDR Ltd. d/b/a PublicDomainRegistry.com9 Oct 20149 Oct 20149 Oct 2015
152sridhar.xyzChengdu West Dimension Digital Technology Co., Ltd…9 Nov 202415 Dec 20249 Nov 2025
153sridharmagurubedcollege.comWild West Domains, LLC12 Aug 201512 Aug 201512 Aug 2016
154sridhar.websitePDR Ltd. d/b/a PublicDomainRegistry.com19 Feb 201519 Feb 201519 Feb 2016
155sridarwanto.xyzPDR Ltd. d/b/a PublicDomainRegistry.com13 Feb 201513 Feb 201513 Feb 2016
156sridevitrade.comGoDaddy.com, LLC6 Jan 20156 Jan 20156 Jan 2016
157sridurgaachemicals.comTucows Domains Inc.8 Jan 201512 Jan 20188 Jan 2018
158sridharconstruction.orgGoDaddy.com, LLC14 Aug 201528 Sep 202414 Aug 2026
159sridharconstruction.netGoDaddy.com, LLC14 Aug 201515 Aug 202414 Aug 2026
160sridharconstruction.comGoDaddy.com, LLC14 Aug 201515 Aug 202414 Aug 2026
161sridevithagranaite.comWild West Domains, LLC14 Aug 201514 Aug 201514 Aug 2016
162srideviminerals.comSiliconHouse.Net Pvt. Ltd.14 Aug 201514 Aug 201514 Aug 2016
163sridattaanjaneya.comDynadot11 LLC3 Apr 20224 Apr 20233 Apr 2024
164sridharanravi.comDynadot, LLC14 Jan 201523 Feb 202514 Jan 2026
165sridurgamalleshwararealestates.comNet 4 India Limited15 Jan 201515 Jan 201515 Jan 2016
166sridharmasas.xyzAlpnames Limited13 Jun 201513 Jun 201513 Jun 2016
167sridny.clubXin Net Technology Corporation2 Jul 20152 Jul 20151 Jul 2016
168sridungargarhhotels.reviewAlpnames Limited3 Jul 2015-2 Jul 2016
169sridz.faithAlpnames Limited2 Aug 2015-1 Aug 2016
170sridharamchandjainschool.comGoogle, Inc.19 Jan 20155 Jun 202419 Jan 2027
171sridharpappu.comTucows Domains Inc.20 Jan 20156 Jan 202520 Jan 2026
172sridurgaparameshwarikodibengre.comGoDaddy.com, LLC15 Sep 202211 Dec 202415 Sep 2025
173sridurgaopticians.comGoDaddy.com, LLC21 Jan 201522 Jan 202521 Jan 2026
174sridurgaiammanindustries.comSiliconHouse.Net Pvt. Ltd.21 Jan 201521 Jan 201521 Jan 2016
175sridiabetes.comDropCatch.com 1420 LLC11 Jul 201811 Jul 201811 Jul 2019
176sridhru.comGoDaddy.com, LLC21 Jan 20154 Jan 202321 Jan 2026
177sridesignzinc.comregister.com, Inc.21 Jan 201521 Jan 201521 Jan 2016
178sridiabetes.netDomain.com, LLC22 Jan 20157 Jan 201722 Jan 2018
179sridharmarimuthuphotography.comregister.com, Inc.23 Jan 201523 Jan 201523 Jan 2016
180sridaivayoga.orgWild West Domains, LLC22 Jan 201522 Jan 201522 Jan 2016
181sridanaghantaclub.orgGoDaddy.com, LLC25 Jan 201525 Jan 201525 Jan 2016
182sridevicateringservices.comGood Domain Registry Pvt Ltd.27 Jan 201527 Jan 201527 Jan 2016
183sridharsevashram.comInternet Domain Services BS Corp6 Apr 20216 Apr 20216 Apr 2022
184srideviconstruction.comGoDaddy.com, LLC21 Aug 202430 Aug 202421 Aug 2025
185sridattapadukamandir.orgGoDaddy.com, LLC28 Jan 201528 Jan 201528 Jan 2016
186sridhanwanthari.comInternet Domain Services BS Corp28 Sep 201928 Sep 201928 Sep 2020
187sridhanapal.comGoDaddy.com, LLC29 Jan 201529 Jan 201529 Jan 2016
188srideconsulting.comOVH sas1 Feb 201525 Jan 20171 Feb 2018
189sridigitals.comGoogle, Inc.2 Sep 20227 Sep 20232 Sep 2023
190sridial.comGoDaddy.com, LLC7 Dec 20197 Dec 20197 Dec 2020
191sridhareaturu.comGoDaddy.com, LLC19 Aug 201519 Aug 201519 Aug 2016
192sridhardesigns.comWild West Domains, LLC3 Jan 20223 Jan 20223 Jan 2023
193sridevicoffeeworks.netDomainshype.com, Inc.1 Feb 20151 Feb 20151 Feb 2016
194sridharyadav.comGoDaddy.com, LLC3 Feb 20153 Feb 20153 Feb 2016
195sridhartatavarti.asiaBigRock Solutions Ltd.3 Feb 20153 Feb 20153 Feb 2016
196sridurgaopticians.orgGoDaddy.com, LLC21 Apr 201621 Apr 201621 Apr 2017
197sridurgaopticians.netGoDaddy.com, LLC22 Jan 20224 Apr 202422 Jan 2024
198sridharsanapala.comGoDaddy.com, LLC4 Feb 20154 Feb 20154 Feb 2016
199sridevifertility.comBeijing Lanhai Jiye Technology Co., Ltd24 Apr 202315 Feb 202524 Apr 2025
200sridurgaengineering.netDomainshype.com, Inc.4 Feb 20154 Feb 20154 Feb 2016
201sridurgainteriors.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Sep 201919 Sep 201919 Sep 2020
202srid3cdmsr94.netGMO Internet Inc.6 Feb 20156 Feb 20156 Feb 2016
203sridhargopa.infoCrazy Domains FZ-LLC9 Feb 2015-9 Feb 2016
204sridaiva-berlin.comunited-domains AG12 Feb 201513 Feb 201712 Feb 2018
205sridharanivoluntary.orgGoDaddy.com, LLC12 Feb 201512 Feb 201512 Feb 2016
206sridevicars.comGoDaddy.com, LLC13 Feb 201513 Feb 201513 Feb 2016
207sridharseshadri.comGoDaddy.com, LLC21 Nov 202022 Nov 202421 Nov 2025
208sridcd.comTucows Domains Inc.14 Feb 201418 Feb 201514 Feb 2016
209sridurgapublicities.comGoDaddy.com, LLC18 Feb 201518 Feb 201518 Feb 2016
210sriderkorea.comGabia, Inc.13 Feb 201418 Feb 201613 Feb 2017
211sridaivawellness.comWild West Domains, LLC30 Jul 201830 Jul 201830 Jul 2019
212sriderkorea.netGabia, Inc.13 Feb 201418 Feb 201613 Feb 2017
213sridgereceivables.comTucows Domains Inc.18 Feb 201422 Feb 201518 Feb 2016
214sridgereceivables.bizTucows Domains Inc.18 Feb 201421 Feb 201517 Feb 2015
215sridharshini.comGoDaddy.com, LLC23 Feb 201523 Feb 201523 Feb 2016
216sridhanyaadevelopers.comPDR Ltd. d/b/a PublicDomainRegistry.com18 May 201711 Jun 202418 May 2025
217sridevichithracatering.comWild West Domains, LLC23 Feb 201523 Feb 201523 Feb 2016
218sridaivachicago.comGoDaddy.com, LLC24 Feb 201524 Feb 201524 Feb 2017
219sridude.orgTucows Domains Inc.18 Aug 201122 Aug 201518 Aug 2016
220sridagamitsolutions.comTucows Domains Inc.22 Aug 201524 Jul 202422 Aug 2025
221sridaivachicago.netGoDaddy.com, LLC24 Feb 201524 Feb 201524 Feb 2017
222sridevihospital.comGoDaddy.com, LLC27 Feb 201512 Feb 202527 Feb 2026
223sridurgaindustries.comMetaregistrar BV Applications29 Nov 20244 Dec 202429 Nov 2025
224sridaminerals.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Mar 20153 Mar 20153 Mar 2016
225sridhammapalaviwekasenasanaya.comGoDaddy.com, LLC4 Mar 20154 Mar 20154 Mar 2016
226sridesigns.bizPDR Ltd. d/b/a PublicDomainRegistry.com5 Mar 20159 Mar 20254 Mar 2026
227sridevarajagro.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Mar 20157 Mar 20157 Mar 2016
228sridinavahi.comGoDaddy.com, LLC8 Mar 20158 Mar 20158 Mar 2017
229sridharch.comGoDaddy.com, LLC24 Aug 201524 Aug 201524 Aug 2020
230sridathasaitemple.comGoDaddy.com, LLC25 Aug 201525 Aug 201525 Aug 2016
231sridevi.usGoDaddy.com, LLC9 Mar 20159 Mar 20158 Mar 2025
232sridherasm.comBeijing Lanhai Jiye Technology Co., Ltd3 Jun 202328 Jan 20253 Jun 2025
233sridesain.comCV. Rumahweb Indonesia24 Feb 202226 Feb 202523 Feb 2026
234sridharithri.comBigRock Solutions Ltd.18 Mar 201518 Mar 201518 Mar 2016
235sridamailodge.orgTucows Domains Inc.20 Dec 201825 Dec 202420 Dec 2025
236sridharta.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Mar 201521 Mar 202421 Mar 2025
237sridharmasasthabuilders.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Mar 201521 Mar 201521 Mar 2016
238sridosaplace.com-14 Nov 202414 Mar 202514 Nov 2025
239sridawedding.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Mar 20152 Mar 201730 Mar 2018
240sridurgaconstructionspares.comTucows Domains Inc.31 Mar 20154 Apr 201831 Mar 2018
241sriders.netBigRock Solutions Ltd.11 Oct 201623 Nov 201711 Oct 2017
242sridheeraconstructions.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
243sridheera.comGoDaddy.com, LLC28 Aug 201528 Aug 201528 Aug 2016
244sridhardonthiri.comGoDaddy.com, LLC6 Apr 20156 Apr 20156 Apr 2017
245sridesignstudio.comGoDaddy.com, LLC5 Oct 202216 Oct 20245 Oct 2025
246sridharenterprises.comeNom, Inc.31 Aug 201518 Jul 201731 Aug 2017
247sridevelop.neteNom, Inc.1 Sep 20151 Sep 20151 Sep 2016
248sridusun.comNetEarth One Inc. d/b/a NetEarth30 Aug 201530 Oct 201530 Aug 2018
249sridevihospital.orgGoDaddy.com, LLC2 Sep 20152 Sep 20152 Sep 2016
250sridattagiri.orgPDR Ltd. d/b/a PublicDomainRegistry.com2 Sep 20153 Sep 20162 Sep 2017
251sridharpisupati.comGoDaddy.com, LLC8 Apr 20159 Apr 20248 Apr 2025
252sridevadecors.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Apr 20156 Apr 20179 Apr 2018
253sridley.comDreamHost, LLC3 Sep 20152 Aug 20163 Sep 2017
254sridhanshikawomenshostel.comGoDaddy.com, LLC4 Sep 20154 Sep 20154 Sep 2016
255sridhardrivingschool.comKey-Systems GmbH17 Aug 202330 Sep 202417 Aug 2024
256sridevijewelry.comGoDaddy.com, LLC11 Apr 201511 Apr 201511 Apr 2016
257sridakshantraders.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Apr 201511 Apr 201511 Apr 2016
258sridealtheatreproductions.comGoDaddy.com, LLC13 Apr 201513 Apr 201513 Apr 2016
259sridattamarketing.comeNom, Inc.14 Apr 20154 Apr 201714 Apr 2018
260sride.netGMO Internet Inc.28 May 20241 Jul 202428 May 2025
261sridaivawellnessstudio.comGoDaddy.com, LLC4 Sep 20154 Sep 20154 Sep 2017
262sridevijewellery.comGoDaddy.com, LLC2 Apr 20192 Apr 20192 Apr 2020
263sridcloud.comFastDomain Inc.18 Apr 20153 Apr 202418 Apr 2025
264sridurgaparameshwarifunds.comGoDaddy.com, LLC20 Apr 201520 Apr 201520 Apr 2016
265sridevaconsultancy.comTucows Domains Inc.3 Oct 20243 Oct 20243 Oct 2025
266sridatthajyothi.comGoDaddy.com, LLC21 Apr 201521 Apr 201521 Apr 2017
267sridharmamittra.comGoDaddy.com, LLC22 Apr 201518 Sep 202222 Apr 2025
268sridevitravels.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Apr 20242 Aug 202425 Apr 2025
269sridevtrade.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Apr 201525 Apr 201525 Apr 2016
270sridurgaiamman.comTucows Domains Inc.30 Apr 201830 Apr 201830 Apr 2019
271sridurgaads.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Apr 201528 Apr 201728 Apr 2018
272sridasam.comGoDaddy.com, LLC24 Oct 20238 Nov 202424 Oct 2025
273sridharuniversity.netBigRock Solutions Ltd.27 Apr 201527 Apr 201527 Apr 2016
274sridharreddy.infoGoDaddy.com, LLC2 May 20159 Jul 20242 May 2025
275sridharreddy.netGoDaddy.com, LLC2 May 201518 Sep 20222 May 2025
276sridharreddy.orgGoDaddy.com, LLC2 May 20159 Jul 20242 May 2025
277sridhanvantarisiddha.comWild West Domains, LLC9 Sep 20159 Sep 20159 Sep 2016
278sridharuniversityonline.comWild West Domains, LLC6 May 20156 May 20156 May 2016
279sridevividyaniketan.comPDR Ltd. d/b/a PublicDomainRegistry.com6 May 20156 May 20156 May 2016
280sridattamatrimony.comDNC Holdings, Inc.28 Jul 201928 Jul 201928 Jul 2020
281sridhardoraphotography.comGoDaddy.com, LLC8 May 20158 May 20158 May 2017
282sridhardora.comGoDaddy.com, LLC8 May 20158 May 20158 May 2016
283sridhardentalclinic.comHostinger, UAB30 Oct 202430 Dec 202430 Oct 2025
284sridesignersarees.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jan 201717 Feb 20186 Jan 2018
285sridhatech.comGoDaddy.com, LLC30 Apr 202030 Apr 202030 Apr 2021
286sridharguntaka.comGoDaddy.com, LLC13 May 201518 Sep 202213 May 2025
287sridesigner.comGoDaddy.com, LLC19 May 202119 May 202119 May 2022
288sridevimatric.comGoDaddy.com, LLC17 May 201517 May 201517 May 2016
289sridhanalakshmisolarpowersystemsindpvtltd.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Sep 201512 Sep 201512 Sep 2016
290sridiva.comCV. Jogjacamp21 May 201522 May 201721 May 2018
291sridevigoldcoveringworks.comGoDaddy.com, LLC22 May 201522 May 201522 May 2018
292sridesignlab.comPDR Ltd. d/b/a PublicDomainRegistry.com23 May 201522 May 201723 May 2018
293sridharfurniture.com----
294sridharphotovideo.comGMO Internet Inc.14 Sep 20153 Sep 201614 Sep 2017
295sridevifashions.comGoDaddy.com, LLC1 Feb 20171 Feb 20171 Feb 2019
296sridiesels.comGoDaddy.com, LLC29 May 201529 May 201529 May 2016
297sridhanalakshmistore.net----
298sridharsri.orgGoDaddy.com, LLC30 May 201530 May 201530 May 2016
299sridhars.orgGoDaddy.com, LLC30 May 201530 May 201530 May 2016
300sridigitalphotography.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Sep 20152 Jan 201815 Sep 2018
301sridhanalakshmitimbers.comGoDaddy.com, LLC15 Sep 201515 Sep 201515 Sep 2016
302sridhar-m.comGoogle, Inc.4 Jun 201515 Jun 20244 Jun 2025
303sridhariyam.comGoDaddy.com, LLC4 Jun 20154 Jun 20154 Jun 2016
304sridharwedssuneels.comGoDaddy.com, LLC16 Sep 201516 Sep 201516 Sep 2016
305sridharwedssuneela.comGoDaddy.com, LLC16 Sep 201516 Sep 201516 Sep 2016
306sridharmashastamotors.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Sep 201516 Sep 201516 Sep 2016
307sridharbookshop.comGoDaddy.com, LLC16 Sep 201516 Sep 201516 Sep 2016
308sridharanonline.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Sep 201517 Sep 201517 Sep 2016
309sridattaherbals.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Sep 201516 Sep 201516 Sep 2016
310sridevbhavanandam.comNetwork Solutions, LLC6 Jun 20156 Jun 20156 Jun 2016
311sridhivya.comGoDaddy.com, LLC8 Jun 20158 Jun 20158 Jun 2016
312sridurgatechsoft.comDynadot, LLC16 Nov 202416 Nov 202416 Nov 2025
313sridevigroups.comGoDaddy.com, LLC15 Feb 201715 Feb 201715 Feb 2018
314sridaivamallorca.com1&1 Internet AG11 Jun 201511 Jun 201511 Jun 2016
315sridharraj.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Jun 201514 Jun 201514 Jun 2016
316sridurgaedu.orgPDR Ltd. d/b/a PublicDomainRegistry.com13 Jun 201528 Jun 201713 Jun 2018
317sridharmadala.comNameCheap, Inc.5 Nov 20186 Oct 20245 Nov 2025
318sridhenu.orgGoDaddy.com, LLC19 Sep 20153 Nov 202419 Sep 2025
319sridurgarealestates.comCrazy Domains FZ-LLC18 Jun 201519 Jun 202418 Jun 2025
320srideviinteriorwork.comWild West Domains, LLC20 Jun 201520 Jun 201520 Jun 2016
321sridhargs.comGoDaddy.com, LLC20 Sep 20153 Sep 202420 Sep 2025
322sridurgasaioldagehome.comGoDaddy.com, LLC23 Jun 201523 Jun 201523 Jun 2016
323sridstudio.comGoDaddy.com, LLC21 Sep 201522 Sep 202321 Sep 2025
324sridungargarhprawasi.comGoDaddy.com, LLC25 Jun 201525 Jun 201525 Jun 2016
325srideepthipackaging.comTucows Domains Inc.3 Oct 202425 Oct 20243 Oct 2028
326sridharonline.comGoDaddy.com, LLC23 Sep 201523 Sep 201523 Sep 2017
327sridecks.netNetwork Solutions, LLC23 Dec 201723 Dec 201723 Dec 2018
328sridurgabhavaniparishad.comGoDaddy.com, LLC27 Jun 201527 Jun 201527 Jun 2016
329sridhartech.comGoDaddy.com, LLC23 Sep 201523 Sep 201523 Sep 2016
330sridurgadecorinc.comGoDaddy.com, LLC2 Jul 20152 Jul 20152 Jul 2017
331sridevilabel.comGood Domain Registry Pvt Ltd.19 Jun 201819 Jun 201819 Jun 2019
332srideviarts.com-26 Sep 201626 Sep 201626 Sep 2017
333srideviramesh.comGoDaddy.com, LLC24 Sep 201521 Sep 202324 Sep 2025
334sridevimovies.comNamesilo, LLC6 Dec 20215 Feb 20246 Dec 2023
335sridattasaiengineers.comBigRock Solutions Ltd.6 Jul 20156 Jul 20156 Jul 2016
336sridmr.comGoDaddy.com, LLC7 Jul 20158 Jul 20247 Jul 2025
337sridevicraneservices.com----
338sridharansivan.comGoDaddy.com, LLC9 Jul 201518 Sep 20229 Jul 2025
339sridevalam.comHostinger, UAB26 Jul 202425 Sep 202426 Jul 2025
340sridevaconstruction.comGoDaddy.com, LLC10 Jul 201510 Jul 201510 Jul 2016
341sridevaassociates.com----
342sridevaa.comGoDaddy.com, LLC10 Jul 201510 Jul 201510 Jul 2016
343sridivyanewluxurypgforladies.comBigRock Solutions Ltd.10 Jul 201510 Jul 201510 Jul 2016
344sridesa.comTucows Domains Inc.10 Jul 201514 Jul 202110 Jul 2021
345sridivyaimages.comGoDaddy.com, LLC14 Dec 201514 Dec 201514 Dec 2016
346sridentalgroups.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Sep 20154 Oct 201627 Sep 2017
347sridevchayaa.comWild West Domains, LLC17 Jul 201517 Jul 201517 Jul 2016
348sridharb.comNameCheap, Inc.21 Feb 202521 Feb 202521 Feb 2026
349sridevimeenakshihospital.comGoDaddy.com, LLC20 Jul 201521 Jul 201520 Jul 2016
350sridharswellness.comGoDaddy.com, LLC22 Jul 201519 Sep 202222 Jul 2025
351sridharswellness.bizGoDaddy.com, LLC22 Jul 201527 Jul 202421 Jul 2025
352sridharraotrs.comGoDaddy.com, LLC21 Jul 201521 Jul 201521 Jul 2016
353sridharswellness.orgGoDaddy.com, LLC22 Jul 201520 Sep 201522 Jul 2020
354sridharswellness.netGoDaddy.com, LLC22 Jul 201522 Jul 201522 Jul 2017
355sridharswellness.mobiGoDaddy.com, LLC22 Jul 201520 Sep 201522 Jul 2020
356sridharswellness.infoGoDaddy.com, LLC22 Jul 201529 Jan 202022 Jul 2020
357sridurgaelectronics.comGoDaddy.com, LLC23 Jul 201523 Jul 201523 Jul 2016
358sridharswellness.usGoDaddy.com, LLC22 Jul 201522 Jul 201521 Jul 2025
359sridurgaethnicwares.comGoDaddy.com, LLC31 Jul 201731 Jul 201731 Jul 2018
360sridharp.comDomain.com, LLC24 Jul 201524 Jul 201524 Jul 2016
361sridevikaaquarium.comGoDaddy.com, LLC30 Sep 201530 Sep 201530 Sep 2016
362sridurgatravels.comTurnCommerce, Inc. DBA NameBright.com11 Feb 20205 Feb 202111 Feb 2025
363srideviprojects.comGoDaddy.com, LLC7 Dec 20165 Dec 20247 Dec 2025
364srideeparadana.comGoDaddy.com, LLC29 Jul 201529 Jul 201529 Jul 2016
365sridolphinhomeappliance.comWild West Domains, LLC30 Sep 201530 Sep 201530 Sep 2016
366sridesignerboutique.comBigRock Solutions Ltd.30 Sep 201530 Sep 201530 Sep 2016
367sridya.infoWild West Domains, LLC1 Oct 20152 Oct 20151 Oct 2016
368sridhanshinfotech.comGoDaddy.com, LLC31 Jul 201530 Jul 202331 Jul 2025
369sridattaradio.comGoDaddy.com, LLC31 Jul 201531 Jul 201531 Jul 2016
370sridattaradio.orgGoDaddy.com, LLC31 Jul 20151 Aug 201631 Jul 2017
371sridattaradio.netGoDaddy.com, LLC31 Jul 201531 Jul 201531 Jul 2016
372sridivyaretreat.comWild West Domains, LLC1 Aug 20151 Aug 20151 Aug 2016
373sridurgaastrocenter.comGoogle, Inc.2 Aug 20152 Aug 20242 Aug 2025
374sridersreflect.comEuroDNS S.A.2 Oct 201521 Sep 20161 Oct 2017
375sridhanalakshmi.netPDR Ltd. d/b/a PublicDomainRegistry.com4 Dec 20184 Dec 20184 Dec 2019
376sridhariyamspa.comGoDaddy.com, LLC5 Aug 20155 Aug 20155 Aug 2016
377sridurgamataastrologer.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Aug 20155 Aug 20166 Aug 2017
378sridiwanartjewellers.comGoDaddy.com, LLC6 Aug 20156 Aug 20156 Aug 2016
379sridattasaitemple.comGoDaddy.com, LLC3 Oct 20153 Oct 20153 Oct 2016
380sridagamit.comGoogle, Inc.10 Aug 201510 Aug 201510 Aug 2016
381sridvarikadhishmandal.netPDR Ltd. d/b/a PublicDomainRegistry.com10 Aug 201510 Aug 201510 Aug 2016
382sridivyaedu.orgName.com, Inc.5 Oct 20155 Oct 20155 Oct 2016
383sridoctor.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Oct 20158 Aug 20246 Oct 2025
384sridevimath.orgGoDaddy.com, LLC9 Oct 20159 Oct 20159 Oct 2016
385sridharan.infoNameCheap, Inc.11 Oct 201511 Oct 201511 Oct 2016
386sridharyenuganti.comGood Domain Registry Pvt Ltd.15 Oct 201527 Nov 201615 Oct 2018
387sridevelopers.comDomainshype.com, Inc.14 Oct 201518 Oct 202414 Oct 2025
388sridaksha.comBigRock Solutions Ltd.14 Oct 201514 Oct 201514 Oct 2016
389sridiyengar.netGoDaddy.com, LLC16 Oct 201519 Sep 202216 Oct 2025
390sridiyengar.infoGoDaddy.com, LLC16 Oct 201512 Jul 202416 Oct 2025
391sridiyengar.comGoDaddy.com, LLC16 Oct 201519 Sep 202216 Oct 2025
392sridhariyengar.netGoDaddy.com, LLC16 Oct 201519 Sep 202216 Oct 2025
393sridhariyengar.infoGoDaddy.com, LLC16 Oct 201512 Jul 202416 Oct 2025
394sridiyengar.orgGoDaddy.com, LLC16 Oct 201511 Jul 202416 Oct 2025
395sridhariyengar.orgGoDaddy.com, LLC16 Oct 201511 Jul 202416 Oct 2025
396sridharmasasthakkl.comGoDaddy.com, LLC18 Oct 201518 Oct 201518 Oct 2016
397srideal.comTurnCommerce, Inc. DBA NameBright.com5 Jan 201715 Feb 20255 Jan 2025
398srideviphotography.comGMO Internet Inc.18 Jan 202018 Jan 202018 Jan 2021
399srideviproducts.comGoDaddy.com, LLC21 Oct 201521 Oct 201521 Oct 2016
400sridarsairam.comFastDomain Inc.8 Dec 202023 Nov 20248 Dec 2025
401sridhanunjayentertainments.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Oct 201514 Feb 201725 Oct 2017
402sridhanunjay.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Oct 201514 Feb 201725 Oct 2017
403sridecors.comGoDaddy.com, LLC30 Jun 202212 Aug 202330 Jun 2028
404sridattafoods.comGoDaddy.com, LLC26 Oct 201526 Oct 201526 Oct 2016
405sridharcheekatla.xyzHostinger, UAB27 Oct 201527 Oct 201527 Oct 2016
406sridenour.comGoDaddy.com, LLC28 Oct 201528 Oct 201528 Oct 2016
407sridurgasurgicalclinic.comWild West Domains, LLC30 Oct 201530 Oct 201530 Oct 2016
408sridharscce.com-31 Oct 201531 Oct 201531 Oct 2017
409sridarphotography.comGoDaddy.com, LLC31 Oct 20151 Nov 202431 Oct 2025
410sridharstudio.comGood Domain Registry Pvt Ltd.26 Jul 202426 Jul 202426 Jul 2025
411sridu.winChengdu West Dimension Digital Technology Co., Ltd…25 Oct 2015-24 Oct 2016
412sridevitohai.comMat Bao Trading & Service Company Limited d/b/a Ma…5 Nov 201524 Oct 20165 Nov 2017
413sridelp.comGoDaddy.com, LLC4 Nov 20154 Nov 20154 Nov 2016
414sridurgaagro.comTucows Domains Inc.6 Nov 20151 Nov 20246 Nov 2025
415sridevikarumariammatemple.orgPDR Ltd. d/b/a PublicDomainRegistry.com7 Nov 20157 Nov 20157 Nov 2016
416sridharrms.netTucows Domains Inc.5 Nov 20099 Nov 20155 Nov 2016
417sridaya.comTurnCommerce, Inc. DBA NameBright.com6 Mar 202223 Aug 20226 Mar 2025
418sridy.comNamesilo, LLC11 Nov 201513 Oct 202411 Nov 2027
419sridurgadrivingschool.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Mar 201710 May 201710 Mar 2018
420sridhargraphics.comGoDaddy.com, LLC13 Nov 201513 Nov 201513 Nov 2017
421sridanti.comCV. Rumahweb Indonesia31 Mar 202311 May 202431 Mar 2024
422sridhanyafoundation.comGoDaddy.com, LLC3 Jan 20186 Jan 20253 Jan 2026
423sridhanya.comGoDaddy.com, LLC27 Apr 202323 Apr 202427 Apr 2025
424sridc.comHiChina Zhicheng Technology Limited17 Nov 201517 Dec 202417 Nov 2025
425sridesignz.comGoogle, Inc.29 Dec 202129 Dec 202129 Dec 2022
426sridharshilpi.comWild West Domains, LLC21 Nov 201521 Nov 201521 Nov 2016
427sridharaabstractphotoslides.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Nov 201521 Nov 202422 Nov 2025
428sriddle.comGoDaddy.com, LLC17 Jun 201717 Jun 202417 Jun 2027
429sridevitoursandtravels.comBigRock Solutions Ltd.23 Nov 201524 Nov 201523 Nov 2016
430sridevidrivingschool.comGoDaddy.com, LLC23 Nov 201523 Nov 201523 Nov 2016
431sridevifashionstudio.comGoDaddy.com, LLC24 Nov 201524 Nov 201524 Nov 2016
432sridasolutions.comGoDaddy.com, LLC24 Nov 201524 Nov 201524 Nov 2017
433sridaivayogatoronto.comeNom, Inc.25 Nov 201525 Nov 201525 Nov 2016
434sridharchadalavada.comeNom, Inc.28 Nov 201528 Nov 201628 Nov 2017
435sridharc.comGoDaddy.com, LLC2 Feb 20242 Feb 20242 Feb 2027
436sridhrushyamtechnologies.comGoDaddy.com, LLC30 Nov 201530 Nov 201530 Nov 2016
437sridasamgranthsahibji.comGoDaddy.com, LLC5 Jun 20245 Jun 20245 Jun 2025
438srid95595.comGoDaddy.com, LLC30 Nov 201530 Nov 201530 Nov 2016
439sridollar.comeNom, Inc.1 Dec 20151 Dec 20151 Dec 2016
440sridhaatri.comNetEarth One Inc. d/b/a NetEarth1 Dec 201530 Nov 20241 Dec 2025
441srideviclasses.netBigRock Solutions Ltd.6 Dec 201517 Jan 20166 Dec 2025
442sridhyanabudhatours.comGoDaddy.com, LLC7 Dec 20157 Dec 20157 Dec 2017
443sridevixxx.comGoDaddy.com, LLC7 Dec 20157 Dec 20157 Dec 2016
444sridaviganesan.xyzNameCheap, Inc.8 Dec 20158 Dec 20158 Dec 2016
445sridevikrishnaexports.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Dec 20158 Dec 20158 Dec 2016
446sridusit.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Dec 20159 Dec 20159 Dec 2016
447sridb.comDomainplace LLC17 Dec 202118 Dec 202117 Dec 2022
448sridharshininatyalaya.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Sep 201927 Sep 201927 Sep 2020
449srideviretreat.comGoDaddy.com, LLC14 Dec 201515 Dec 202414 Dec 2025
450sridhanalakshmitrust.orgPDR Ltd. d/b/a PublicDomainRegistry.com15 Dec 201515 Nov 201615 Dec 2017
451sridurghapackaging.comeNom, Inc.17 Dec 201517 Dec 201517 Dec 2016
452sridhar.workGoDaddy.com, LLC18 Dec 201518 Dec 201518 Dec 2017
453sridecks.infoNetwork Solutions, LLC19 Dec 201512 Dec 201619 Dec 2017
454sridevisons.comNetwork Solutions, LLC20 Dec 201520 Dec 201520 Dec 2018
455sridatriconsumerindia.comGoDaddy.com, LLC20 Aug 202411 Jan 202520 Aug 2025
456sridurgabattery.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Mar 201818 Mar 202416 Mar 2025
457sridigitalstudio.comBeijing Lanhai Jiye Technology Co., Ltd13 Mar 20241 Mar 202513 Mar 2026
458sridharinsurancebroker.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Mar 20124 Mar 20255 Mar 2026
459sridharjagan.unoDomainia Inc.28 Dec 201528 Dec 201527 Dec 2016
460sridharacharaya.comGoDaddy.com, LLC28 Dec 201528 Dec 201528 Dec 2016
461sriders.clubGoDaddy.com, LLC28 Dec 201528 Dec 201527 Dec 2017
462sridharmodaya.orgGoDaddy.com, LLC29 Dec 201529 Dec 201529 Dec 2016
463sridevigarments.comGoDaddy.com, LLC5 Sep 20224 Sep 20235 Sep 2025
464sridevaiasacademy.comDropCatch.com 1099 LLC20 Mar 202418 Feb 202520 Mar 2025
465sridivyaimage.comGoDaddy.com, LLC4 Jan 20164 Jan 20164 Jan 2017
466sridisaibaba.comKey-Systems GmbH6 Jan 20166 Jan 20166 Jan 2017
467sridharspeaks.com1&1 Internet AG6 Jan 201621 Mar 20186 Jan 2026
468sridharag.comGoDaddy.com, LLC7 Jan 20161 Jan 20247 Jan 2027
469sridave.comDomainPeople, Inc.8 Nov 20249 Nov 20248 Nov 2025
470sridistri.com1&1 Internet AG11 Jan 201612 Jan 201711 Jan 2018
471sridebi.comGoDaddy.com, LLC11 Jan 201611 Jan 201611 Jan 2017
472sridevifoods.comGoDaddy.com, LLC21 Mar 202421 Mar 202421 Mar 2029
473sridevifarms.comGoDaddy.com, LLC12 Jan 201612 Jan 201612 Jan 2017
474sridinkan.comBigRock Solutions Ltd.14 Jan 201614 Jan 201614 Jan 2017
475sridarwanto.comCV. Rumahweb Indonesia15 Mar 202114 Mar 202415 Mar 2025
476sridesikasabha.orgPDR Ltd. d/b/a PublicDomainRegistry.com17 Jan 201617 Jan 201617 Jan 2017
477sridarma.comCV. Jogjacamp18 Jan 201618 Jan 201618 Jan 2017
478sridf.comHosting Concepts B.V. dba Openprovider8 Apr 20218 Apr 20218 Apr 2022
479srideviclasses.orgPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 201631 May 202119 Jan 2026
480sridhareena.com-4 Mar 20245 Mar 20254 Mar 2026
481sridurgaconvention.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jan 20166 Jan 201720 Jan 2018
482sridhanalakshmipublication.comGoDaddy.com, LLC22 Jan 201622 Jan 201622 Jan 2017
483srideviclasses.bizTucows Domains Inc.25 Jan 201628 Jan 201724 Jan 2017
484sridasmeshhospital.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Feb 201913 Feb 201913 Feb 2020
485sridharbolleddu.comBigRock Solutions Ltd.28 Jan 201612 Oct 201628 Jan 2018
486sridevidecorator.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 201819 Jan 201819 Jan 2019
487sridivyasex.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2017
488sridiviya.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2017
489sridhirendranathduttajeweller.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2017
490srideepdey.comGoDaddy.com, LLC1 Feb 20161 Feb 20161 Feb 2018
491srideme.comGoDaddy.com, LLC3 Feb 20163 Feb 20163 Feb 2021
492sridhanya.xyzNameCheap, Inc.4 Feb 201612 Jan 20174 Feb 2018
493sridevitools.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Sep 199713 Aug 20241 Sep 2025
494sridata.comCSL Computer Service Langenbach GmbH d/b/a joker.c…7 Feb 20089 Feb 20247 Feb 2026
495sridharphysics.comGoDaddy.com, LLC11 Feb 201611 Feb 201611 Feb 2017
496sridurgasilks.comGoDaddy.com, LLC12 Feb 201612 Feb 201612 Feb 2017
497sridurgagraphics.comGoDaddy.com, LLC30 Jun 201730 Jun 201730 Jun 2018
498sridhaconsultancy.comGoDaddy.com, LLC12 Feb 201612 Feb 201612 Feb 2017
499sridhardayal.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Feb 201614 Feb 201614 Feb 2017
500sridattasaibabadevasthanam.comGoDaddy.com, LLC14 Feb 201614 Feb 201614 Feb 2017
501srideviseaexports.comGoDaddy.com, LLC15 Feb 201615 Feb 201615 Feb 2017
502sridevis.comGoogle, Inc.17 Feb 201617 Feb 201617 Feb 2017
503sridigitalservices.comGoDaddy.com, LLC17 Feb 201617 Feb 201617 Feb 2017
504sridivyasilks.comGoDaddy.com, LLC19 Feb 201619 Feb 201619 Feb 2017
505sridharcartoons.comGoDaddy.com, LLC19 Feb 201619 Feb 201619 Feb 2017
506sridattatreyayogacentrett.comGoDaddy.com, LLC21 Feb 20167 Mar 202521 Feb 2026
507sridwarkadish.orgGoDaddy.com, LLC22 Feb 201622 Feb 201622 Feb 2017
508sridhanalakshmijewellers.comGoDaddy.com, LLC24 Feb 201624 Feb 201624 Feb 2017
509sridharnurserygardens.comGoDaddy.com, LLC25 Feb 201626 Feb 201625 Feb 2017
510sridurgaopticals.comGoDaddy.com, LLC4 Mar 20164 Mar 20164 Mar 2017
511sridharmuthanna.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Mar 201630 Mar 20174 Mar 2018
512sridhardp.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Mar 20169 Mar 20178 Mar 2018
513sridhanwantari.orgPDR Ltd. d/b/a PublicDomainRegistry.com9 Aug 202320 Oct 20249 Aug 2024
514sridurgadeviastrology.comHostinger, UAB23 Jan 202523 Jan 202523 Jan 2027
515sridevvikaa.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Mar 201611 Mar 201611 Mar 2017
516srideviinteriors.comGoogle, Inc.11 Jun 202426 Jun 202411 Jun 2025
517sridevicashews.comHostinger, UAB10 Mar 201630 Apr 202410 Mar 2025
518sridevijafraskincareshopbdg.comHostinger, UAB16 Mar 201616 Mar 201616 Mar 2017
519sridurgabhavan.comGoDaddy.com, LLC17 Mar 201617 Mar 201617 Mar 2017
520sridharchandrabagari.comGoDaddy.com, LLC18 Mar 201618 Mar 201618 Mar 2018
521sridhar.comGoDaddy.com, LLC12 Oct 19985 Nov 20234 Nov 2032
522sridace.xyz-18 Mar 201618 Mar 201618 Mar 2017
523sridude.comChengdu West Dimension Digital Technology Co., Ltd…6 Jun 20186 Jun 20186 Jun 2019
524sridurgaapparels.comGoDaddy.com, LLC20 Mar 201620 Mar 201620 Mar 2017
525sridhariyer.comGoogle, Inc.22 Mar 20164 Jun 202422 Mar 2025
526sridayas.comGoDaddy.com, LLC23 Mar 201623 Mar 201623 Mar 2019
527sridevitrendz.comGoDaddy.com, LLC12 Dec 201912 Dec 201912 Dec 2020
528sridevistore.comHostinger, UAB7 Apr 202321 Mar 20247 Apr 2026
529sridahama.comCV. Jogjacamp24 Mar 201624 Mar 201624 Mar 2017
530sridhar.ceo101domain, Inc.28 Mar 20144 Feb 202427 Mar 2025
531sriddf.xyzGMO Internet Inc.30 Mar 20164 Apr 201630 Mar 2017
532sridharchari.comGoDaddy.com, LLC30 Mar 201626 Mar 202430 Mar 2025
533sridewisalmasari.comCV. Jogjacamp30 Mar 201630 Mar 201630 Mar 2017
534sridevinatyakalalayam.comGoDaddy.com, LLC28 Dec 201928 Dec 201928 Dec 2020
535sridatta.guruGoDaddy.com, LLC3 Apr 201618 May 20203 Apr 2021
536sridharans.comGoDaddy.com, LLC4 Apr 201621 Sep 20224 Apr 2026
537sridatta.netGoDaddy.com, LLC3 Apr 20163 Apr 20163 Apr 2017
538srideviamith.comWild West Domains, LLC4 Apr 20164 Apr 20164 Apr 2017
539sridurgamandir8.comregister.com, Inc.5 Apr 20165 Apr 20165 Apr 2018
540sridharproperties.comregister.com, Inc.5 Apr 20166 Mar 20245 Apr 2025
541sridharanvembu.comGoDaddy.com, LLC6 Apr 20166 Apr 20166 Apr 2017
542sridharsshakenstir.comGoDaddy.com, LLC13 Apr 201613 Apr 201613 Apr 2017
543sridharans.usGoDaddy.com, LLC13 Apr 201613 Apr 201612 Apr 2021
544sridama.comGoDaddy.com, LLC25 Oct 201231 Oct 202325 Oct 2025
545sridhatulogistic.comGoDaddy.com, LLC14 Apr 201614 Apr 201614 Apr 2017
546srid-icloud.com1API GmbH18 Apr 201618 Apr 201618 Apr 2017
547sridharravi.comGoDaddy.com, LLC19 Apr 201619 Apr 201619 Apr 2017
548sridharb-med.comGoDaddy.com, LLC22 Apr 201622 Apr 201622 Apr 2021
549sridharahasbuilders.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Aug 20207 Oct 202326 Aug 2023
550sridevinrithyalaya.orgGoDaddy.com, LLC7 May 202217 Aug 20247 May 2025
551sridee.netNetwork Solutions, LLC20 Feb 200220 Feb 202420 Feb 2034
552sridix.comCloudFlare, Inc.27 Apr 20166 Apr 202427 Apr 2025
553sridr.comHiChina Zhicheng Technology Limited30 Apr 201630 Apr 201630 Apr 2017
554sridavisex.comGoDaddy.com, LLC30 Apr 201630 Apr 201630 Apr 2017
555sridattatek.comGoDaddy.com, LLC29 Apr 201629 Apr 201629 Apr 2017
556sridivam.comBigRock Solutions Ltd.2 May 20161 May 20242 May 2025
557sridheerahotels.comGoDaddy.com, LLC2 May 20162 May 20162 May 2018
558sridhariyamayurveda.comGoDaddy.com, LLC29 Dec 202029 Dec 202029 Dec 2021
559sridakshinamookambika.comGoDaddy.com, LLC2 May 20162 May 20162 May 2017
560sridevisilver.comGoDaddy.com, LLC21 Aug 202421 Aug 202421 Aug 2025
561sridharagurudasa.comGoogle, Inc.9 May 20164 Jun 20249 May 2025
562sridharmalokamahapirivena.comeNom, Inc.12 May 201612 May 201612 May 2017
563sridharism.comGoDaddy.com, LLC10 Sep 201910 Sep 202410 Sep 2025
564sridattasai.comGoDaddy.com, LLC19 Oct 201923 Aug 202419 Oct 2025
565sridashmeshschool.comPDR Ltd. d/b/a PublicDomainRegistry.com14 May 201625 May 201714 May 2018
566sridesigners.comNordreg AB7 Nov 20247 Nov 20247 Nov 2025
567sridevp.comGoogle, Inc.17 May 201613 Jun 202417 May 2025
568sridan.comCloudFlare, Inc.9 Nov 202417 Nov 20249 Nov 2025
569srideals.comGoDaddy.com, LLC20 May 201629 Jan 202520 May 2025
570sridevfoundation.comGoDaddy.com, LLC24 May 201624 May 201624 May 2017
571sridj.comFastDomain Inc.25 May 20167 Jul 202425 May 2024
572sridurgatmt.comGoDaddy.com, LLC27 May 201611 May 202427 May 2025
573sridamoua.comTucows Domains Inc.26 May 201630 May 201726 May 2017
574sridharini.comAmazon Registrar, Inc.28 May 201624 Apr 201728 May 2018
575sridivyaphoto.comGoDaddy.com, LLC6 Jun 20166 Jun 20166 Jun 2017
576sridharanidevelopers.comGoDaddy.com, LLC14 Jan 202114 Jan 202114 Jan 2022
577sridharvenkataraman.comGoDaddy.com, LLC10 Jun 201610 Jun 201610 Jun 2017
578sridharma.comTurnCommerce, Inc. DBA NameBright.com9 Jun 20163 Jun 20209 Jun 2025
579sridurga16.comGoDaddy.com, LLC10 Jun 201610 Jun 201610 Jun 2017
580sridaindustries.comGoDaddy.com, LLC14 Jun 201614 Jun 201614 Jun 2017
581sridinateypu.infoGoDaddy.com, LLC17 Jun 201617 Jun 201617 Jun 2017
582sridurgaholidays.comGoDaddy.com, LLC20 Oct 20221 Dec 202320 Oct 2023
583sridharazhagan.orgGoDaddy.com, LLC23 Jun 201623 Jun 201623 Jun 2017
584sridwarakamayeehospital.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jun 201623 Jun 201623 Jun 2017
585sridharvarmar.comGoDaddy.com, LLC27 Jun 201627 Jun 201627 Jun 2018
586sridurgaamruthalodge.comWild West Domains, LLC1 Jul 20161 Jul 20161 Jul 2017
587sridicad.comGabia, Inc.5 Nov 20196 Nov 20195 Nov 2022
588sriderdemo.comeNom, Inc.1 Jul 20161 Jul 20161 Jul 2017
589sridurgaalliedandsecurityservices.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Jul 20164 Jul 20164 Jul 2017
590sridevistores.comDropCatch.com 1481 LLC7 Feb 20248 Feb 20257 Feb 2025
591sridhardwbi.comName.com, Inc.4 Jul 20164 Jul 20164 Jul 2017
592srideviimpex.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Jun 20167 Jun 20167 Jun 2017
593sridharbandaru.comCNOBIN INFORMATION TECHNOLOGY LIMITED7 Dec 20217 Dec 20217 Dec 2022
594srideclaraciones.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Jun 202027 Jun 202027 Jun 2021
595sridevicoveringworks.comGoDaddy.com, LLC10 Jul 201610 Jul 201610 Jul 2017
596sridhanalakshmiexports.comGoDaddy.com, LLC4 Jul 202014 Nov 20224 Jul 2027
597sridurgapowersolutions.comWild West Domains, LLC6 Oct 20206 Oct 20206 Oct 2021
598sriduraisamyminihall.comBigRock Solutions Ltd.1 Oct 20181 Oct 20181 Oct 2019
599sridayaamfg.comWeb Commerce Communications Limited dba WebNic.cc31 Aug 20137 Mar 202431 Aug 2025
600sridurgapujamahotsav.orgPDR Ltd. d/b/a PublicDomainRegistry.com12 Jul 201623 Aug 201712 Jul 2018
601sridurgaproperties.in-18 Jan 201118 Jan 201718 Jan 2018
602sridhar.guruGoDaddy.com, LLC13 Sep 202313 Sep 202413 Sep 2025
603sridhar.academyGoDaddy.com, LLC10 Jun 20146 Jan 201710 Jun 2018
604sridivya.inGoDaddy.com, LLC12 Jun 201817 Jun 202412 Jun 2025
605sridar.photographyGoDaddy.com, LLC12 Feb 201428 Mar 201612 Feb 2017
606sridhar.photographyPDR Ltd. d/b/a PublicDomainRegistry.com7 Jun 20147 Jun 20207 Jun 2021
607sridevi.infoGoDaddy.com, LLC19 Mar 202018 May 202019 Mar 2021
608sridishainteriors.com-15 Jul 201615 Jul 201615 Jul 2017
609sridhartechnologies.com-15 Jul 201615 Jul 201615 Jul 2017
610sridhararchitects.comenom469, Incorporated3 Apr 20244 Apr 20243 Apr 2025
611sridk.bidAlpnames Limited19 May 2016-18 May 2017
612sridhart.com-16 Jul 201616 Jul 201616 Jul 2017
613sridevi.bizGMO Internet Inc.16 Aug 202421 Aug 202416 Aug 2025
614sriders.bizGoDaddy.com, LLC14 Apr 201213 Aug 201613 Apr 2022
615sridhar.bizNameCheap, Inc.15 Apr 201429 Apr 201714 Apr 2018
616sridait.comGoDaddy.com, LLC18 Jul 20165 Feb 202518 Jul 2025
617sridurgabhavanijyothishalayam.comGoDaddy.com, LLC14 Jul 201814 Jul 201814 Jul 2019
618sridharvelmajala.comGoDaddy.com, LLC18 Jul 201618 Jul 201618 Jul 2017
619sridharsilberfein.comGoDaddy.com, LLC18 Jul 201618 Jul 202418 Jul 2025
620sriduragsecurityservices.comeNom, Inc.18 Jul 20168 Jul 201718 Jul 2018
621sridyuthikarthi.orgGoDaddy.com, LLC18 Jul 201629 Aug 201718 Jul 2018
622sridharjain.com-19 Jul 201619 Jul 201619 Jul 2017
623sridha.comTurnCommerce, Inc. DBA NameBright.com7 Oct 20171 Oct 20207 Oct 2025
624sridathaicuisine.comGoDaddy.com, LLC4 Aug 202215 Sep 20244 Aug 2024
625sridurgalakshmiindustries.com-27 Jul 201627 Jul 201627 Jul 2017
626sridiscoveryregister.comKey-Systems GmbH1 Aug 201617 Jan 20251 Aug 2025
627sridanabali.com-2 Aug 20162 Aug 20162 Aug 2017
628sridevigoldcoveringwork.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Aug 201612 Sep 20171 Aug 2017
629sridiscovery4schools.comKey-Systems GmbH1 Aug 201617 Jan 20251 Aug 2025
630sridivyanude.com-19 Oct 201619 Oct 201619 Oct 2017
631sridharcce.comTucows Domains Inc.31 Jul 20164 Aug 201731 Jul 2017
632sridharsuresh.comNameCheap, Inc.3 Aug 20162 Aug 20243 Aug 2025
633sridarshantrust.orgPDR Ltd. d/b/a PublicDomainRegistry.com3 Aug 201614 Sep 20173 Aug 2018
634srideviphysiotherapy.comGood Domain Registry Pvt Ltd.4 Aug 201613 Sep 20174 Aug 2017
635sridwarikadheeshgroup.comNetwork Solutions, LLC4 Aug 20165 Aug 20244 Aug 2025
636sridwarikadheeshpolymers.comNetwork Solutions, LLC4 Aug 20165 Aug 20244 Aug 2025
637sridecorators.com-11 Aug 201611 Aug 201611 Aug 2019
638sridurgis.com-12 Aug 201612 Aug 201612 Aug 2017
639sridurgatelecom.com-16 Aug 201616 Aug 201616 Aug 2017
640sridattatraining.comBigRock Solutions Ltd.17 Aug 201628 Sep 201717 Aug 2017
641sridhardasani.com-17 Aug 201617 Aug 201617 Aug 2017
642sridharmasasta.comGoDaddy.com, LLC15 Jan 202115 Jan 202115 Jan 2022
643sridevichemicals.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Aug 201610 Jul 202423 Aug 2025
644srideviclasses.asiaBigRock Solutions Ltd.25 Aug 201617 Jan 202425 Aug 2026
645sridhamotors.comGoDaddy.com, LLC24 Aug 201617 Aug 202424 Aug 2025
646sridomain.comGoDaddy.com, LLC24 Aug 201624 Aug 201624 Aug 2017
647sridress.comGoDaddy.com, LLC25 Aug 201625 Aug 201625 Aug 2018
648sridharnathani.comName.com, Inc.25 Nov 201925 Nov 201925 Nov 2020
649sridevidevelopers.com-28 Aug 201628 Aug 201628 Aug 2017
650sridana.comGoDaddy.com, LLC29 Aug 20169 Oct 202429 Aug 2024
651sridevigearz.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Aug 201611 Oct 201730 Aug 2017
652sridata.netCV. Rumahweb Indonesia1 Sep 201623 May 20231 Sep 2025
653sridalan.com-1 Sep 20161 Sep 20161 Sep 2017
654sridarshinikalaikoodam.com-1 Sep 20161 Sep 20161 Sep 2017
655sridivyaeducation.orgPDR Ltd. d/b/a PublicDomainRegistry.com2 Sep 201627 Jul 20242 Sep 2025
656sridurgamedical.comGoDaddy.com, LLC2 Sep 20168 Sep 20242 Sep 2026
657sridurgamalleswaritravels.comGoDaddy.com, LLC21 Jan 201931 Dec 202421 Jan 2026
658sridhatrihousingandestates.comDomainshype.com, Inc.7 Sep 201619 Oct 20177 Sep 2017
659sridharreddynr.com-9 Sep 20169 Sep 20169 Sep 2017
660sridanvantritemple.orgPDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 201622 Oct 201710 Sep 2018
661sridattagirimahayogi.com-11 Sep 201611 Sep 201611 Sep 2017
662sridurga.netPDR Ltd. d/b/a PublicDomainRegistry.com11 Sep 201623 Oct 201711 Sep 2017
663sridevya.com-12 Sep 201612 Sep 201612 Sep 2017
664sridwarkamaishubhyatra.com-14 Sep 201614 Sep 201614 Sep 2017
665sridhardrawingbook.com-15 Sep 201615 Sep 201615 Sep 2017
666sridevii.comGoDaddy.com, LLC15 Sep 201617 Sep 202415 Sep 2025
667sridurgaschool.comGoDaddy.com, LLC23 Sep 201627 Sep 202423 Sep 2025
668sridurgaent.com-23 Sep 201623 Sep 201623 Sep 2018
669srideclaracionesaldia.com-24 Sep 201624 Sep 201624 Sep 2018
670sridharmuttumu.comGoDaddy.com, LLC25 Sep 201629 Sep 202225 Sep 2026
671sridanya.com-26 Sep 201626 Sep 201626 Sep 2017
672sridattatech.com-26 Sep 201626 Sep 201626 Sep 2017
673sridastudios.com-27 Sep 201627 Sep 201627 Sep 2017
674sridewi.comTucows Domains Inc.31 Jul 20131 Aug 202431 Jul 2025
675sridharaoffsets.comNamesilo, LLC23 Oct 201824 Oct 201823 Oct 2019
676sridharresidency.comGoDaddy.com, LLC26 Feb 201626 Feb 201626 Feb 2017
677srideviladieshostel.comGoDaddy.com, LLC10 Apr 201418 Apr 201610 Apr 2017
678sridevigoldcovering.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Jan 201213 Jan 20179 Jan 2018
679sridagreen.comMAFF Inc.27 May 201827 May 201827 May 2019
680sridout.comGoDaddy.com, LLC13 Jun 200625 Aug 202413 Jun 2024
681sridkpenterprises.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Jun 200610 Jul 202423 Jun 2025
682srideviexports.comBeijing Lanhai Jiye Technology Co., Ltd4 Feb 20227 Mar 20244 Feb 2024
683sridhanada.comNetwork Solutions, LLC26 Jan 201027 Jan 202526 Jan 2027
684sriderite.comKey-Systems GmbH31 Jan 201917 Jan 202531 Jan 2026
685sridecks.comNetwork Solutions, LLC29 Jan 200330 Nov 202129 Jan 2027
686sridhars.comTurnCommerce, Inc. DBA NameBright.com20 Oct 20111 May 202027 Feb 2025
687sridel.comGoDaddy.com, LLC21 Apr 201121 Apr 202321 Apr 2025
688sridevigroup.comGoDaddy.com, LLC13 Jan 20125 Apr 202413 Jan 2026
689srider.comGoDaddy.com, LLC10 May 200512 Oct 202310 May 2026
690sridham.comTurnCommerce, Inc. DBA NameBright.com1 Jan 201510 Feb 20251 Jan 2025
691sridiversified.comTucows Domains Inc.30 Dec 202410 Feb 202530 Dec 2025
692sridom.comGoogle, Inc.18 Oct 202421 Oct 202418 Oct 2025
693sridcpowerservices.comTucows Domains Inc.1 Dec 201116 Nov 20241 Dec 2025
694sridigitek.comFastDomain Inc.26 Jul 20089 Aug 202426 Jul 2025
695sridevikapoor.com-3 Oct 20225 Dec 20233 Oct 2023
696sridharkoneru.comGoDaddy.com, LLC2 Mar 20092 Mar 20252 Mar 2026
697sridattalogistics.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Oct 200530 Sep 20241 Oct 2025
698sridharandsivarama.comMAFF Inc.5 Jul 202113 Aug 20235 Jul 2023
699sridurgasweets.comZone of Domains LLC26 Jun 20239 Sep 202426 Jun 2024
700sridharababu.comGoDaddy.com, LLC20 Jan 201313 Jan 201520 Jan 2017
701sridevi-krishnaswamy-mylife.comGoDaddy.com, LLC28 Jun 20126 Feb 20146 Feb 2019
702sriders.comGoDaddy.com, LLC20 Feb 20124 Mar 202520 Feb 2026
703sridevihospitals.comGoDaddy.com, LLC16 Apr 202016 Apr 202016 Apr 2022
704sridevilibrary.comGoDaddy.com, LLC19 Nov 202018 Nov 202419 Nov 2025
705sridevitech.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Apr 202412 Jun 202412 Apr 2025
706sridesignconsulting.comeNom, Inc.24 Sep 200927 Sep 201624 Sep 2016
707sriddell.comGoDaddy.com, LLC25 Aug 200128 Aug 202425 Aug 2026
708sridaladamaligawa.comGoDaddy.com, LLC2 Jan 20109 Jan 20252 Jan 2030
709sridentalclinic.comWild West Domains, LLC21 Feb 201713 Feb 202521 Feb 2026
710sridurgatrust.comAmazon Registrar, Inc.20 Mar 202413 Feb 202520 Mar 2026
711sridasmesh.comDropCatch.com 907 LLC23 Aug 201823 Aug 201823 Aug 2019
712sridevarajaagro.comCrazy Domains FZ-LLC15 Oct 201015 Oct 202415 Oct 2025
713sridharbachalli.comeNom, Inc.30 Mar 201428 Mar 201730 Mar 2018
714sride.comGMO Internet Inc.28 Jan 200317 Jan 202528 Jan 2026
715sridevicovering.comKey-Systems GmbH12 Jul 202112 Jul 202112 Jul 2022
716sriderclothing.comGoDaddy.com, LLC14 Apr 201316 Mar 201514 Apr 2018
717sridasmeshschool.comGoDaddy.com, LLC9 Mar 202120 Mar 20249 Mar 2026
718sridatech.comKey-Systems GmbH14 May 202327 Jun 202414 May 2024
719sridutt.comGoDaddy.com, LLC7 Jun 20247 Jun 20247 Jun 2025
720sridigitalpress.comWild West Domains, LLC17 Aug 201228 Sep 202417 Aug 2024
721sridharequities.comregister.com, Inc.15 Sep 200816 Aug 202415 Sep 2025
722sridhariyengar.comNetwork Solutions, LLC25 Sep 20118 Jan 202525 Sep 2026
723sridharvanka.comGoDaddy.com, LLC15 Sep 200726 Aug 202415 Sep 2025
724sridharmasastha.comGoDaddy.com, LLC28 Jun 20144 Jul 201628 Jun 2017
725srida-info.comHiChina Zhicheng Technology Limited3 Sep 201319 Aug 20243 Sep 2025
726sridurgatemple.comCrazy Domains FZ-LLC29 Jan 200728 Jan 202429 Jan 2026
727sridiscover.comGoDaddy.com, LLC24 Sep 200729 Sep 201624 Sep 2016
728sridaivayoga.comGoDaddy.com, LLC15 Jan 201325 Oct 201515 Jan 2017
729sridurgaautomobiles.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Nov 200325 Nov 202411 Nov 2025
730sridharsh.comMAFF Inc.12 Jul 202219 Sep 202312 Jul 2023
731sridharsa.comGoogle, Inc.17 May 20024 Apr 202417 May 2025
732sridharshinikalaikoodam.comPDR Ltd. d/b/a PublicDomainRegistry.com6 Jul 20116 Jul 20246 Jul 2025
733sridharpotaraju.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Feb 201114 Feb 202514 Feb 2026
734sridayu1.comWeb Commerce Communications Limited dba WebNic.cc1 Oct 20131 Oct 20131 Oct 2018
735sridevitechnology.comeNom, Inc.14 Jan 201014 Mar 201714 Jan 2018
736sridivya.comPDR Ltd. d/b/a PublicDomainRegistry.com8 May 200815 Jun 20248 May 2025
737sridhary.comWix.com Ltd.22 Jan 202318 Jun 202422 Jan 2026
738sridurgatravelshyd.comGoDaddy.com, LLC26 Mar 202428 Nov 202426 Mar 2025
739sridatri.comGoDaddy.com, LLC29 Dec 201128 Apr 201529 Dec 2016
740sridharganesan.comTucows Domains Inc.4 Jun 20046 May 20244 Jun 2025
741sridharhealthcare.comTucows Domains Inc.6 May 20246 May 20246 May 2025
742sridharduddilla.comeNom, Inc.30 Jun 20001 Jun 201630 Jun 2017
743srida.comDynadot, LLC28 Aug 19988 Jan 202527 Aug 2025
744sridattalabs.comNameCheap, Inc.15 May 201015 Apr 202415 May 2025
745sridharmachani.comAutomattic Inc.7 Nov 20229 Oct 20247 Nov 2025
746sridleythomas.comGoDaddy.com, LLC19 Sep 201320 Sep 201619 Sep 2017
747srideviengg.comNameCheap, Inc.18 Feb 200628 Apr 202418 Feb 2026
748sridharbabu.comPorkbun, LLC9 Dec 20235 Dec 20249 Dec 2025
749sridevimarriagebureau.comGoDaddy.com, LLC5 Sep 200910 Nov 20095 Sep 2019
750sridaivatv.comDropCatch.com 1036 LLC23 Oct 201624 Oct 201723 Oct 2018
751sridharraju.comGoDaddy.com, LLC8 Feb 20139 Feb 20258 Feb 2026
752sridharv.comGoogle, Inc.14 Nov 201026 Apr 202414 Nov 2028
753sridharvuyyuru.comGoDaddy.com, LLC14 Feb 20145 May 201514 Feb 2017
754sridelijaya.comCV. Rumahweb Indonesia26 Jun 200115 Jul 202426 Jun 2027
755srideiva.comBeijing Lanhai Jiye Technology Co., Ltd10 Apr 202111 Apr 202310 Apr 2024
756sridocmgmt.comGoDaddy.com, LLC24 Feb 201424 Feb 201424 Feb 2019
757srideviconstructions.comGoDaddy.com, LLC23 Apr 201018 Apr 202423 Apr 2025
758sridungargarh.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Aug 201329 Aug 202413 Aug 2025
759sridevielectricals.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Jan 201422 Feb 202511 Jan 2025
760sridhanalakshmilathe.com-9 Mar 202311 May 20249 Mar 2024
761srideviboutique.comGoDaddy.com, LLC15 May 202315 May 202315 May 2024
762sridalada.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Jan 201327 Feb 202516 Jan 2025
763sriduttbhalachandra.comGoDaddy.com, LLC1 Jan 20122 Jan 20251 Jan 2026
764sridaivamedia.comFastDomain Inc.9 Apr 201317 Mar 20169 Apr 2017
765sridarshanhomes.comSiliconHouse.Net Pvt. Ltd.13 Aug 201223 Sep 201613 Aug 2016
766srideviassociates.comGoDaddy.com, LLC15 Nov 201315 Nov 201315 Nov 2018
767sridharsrigiriraju.comHostinger, UAB14 Jun 202324 Jul 202414 Jun 2024
768sridattaelectronics.comGoDaddy.com, LLC26 Aug 201119 Aug 202426 Aug 2025
769sridharandsuri.com-8 Mar 200629 Mar 20248 Mar 2026
770sridharexim.comGoDaddy.com, LLC10 May 202312 May 202310 May 2024
771sridhurgaiindustries.comSiliconHouse.Net Pvt. Ltd.19 Apr 200522 Apr 201619 Apr 2017
772sridhama.comGoogle, Inc.8 Nov 200825 Oct 20248 Nov 2025
773sridattatemple.comNetwork Solutions, LLC15 Nov 20135 Mar 201715 Nov 2017
774sridharreddy.comNameKing.com Inc.23 Sep 202131 Aug 202423 Sep 2025
775srididie.comWeb Commerce Communications Limited dba WebNic.cc26 Jun 201226 Jun 201226 Jun 2025
776sridonklang.comGoDaddy.com, LLC24 Apr 20126 Jun 202424 Apr 2025
777sridgley.comFastDomain Inc.27 Oct 201127 Oct 201727 Oct 2018
778sridharshwealthcreation.comGoDaddy.com, LLC27 Apr 201417 Mar 201527 Apr 2020
779sridevelopments.comGoDaddy.com, LLC10 Dec 201112 Dec 202410 Dec 2025
780sridhardevgroup.comGoDaddy.com, LLC19 Dec 200719 Dec 200720 Dec 2017
781sridhartravels.comeName Technology Co., Ltd.27 Aug 202027 Aug 202027 Aug 2021
782sridevifinearts.comGoDaddy.com, LLC6 Jun 202218 Jul 20236 Jun 2023
783sridharmamella.comWild West Domains, LLC27 Dec 20131 Jan 202527 Dec 2026
784sridurgabuilders.comeNom, Inc.23 Nov 200917 Nov 201423 Nov 2019
785sridharinfo.comNetwork Solutions, LLC7 Jun 20135 May 20167 Jun 2017
786sridevi-industries.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Nov 200619 Nov 201620 Nov 2017
787sridharr.comGoogle, Inc.30 Aug 202214 Nov 202430 Aug 2025
788sridelima.comWeb Commerce Communications Limited dba WebNic.cc7 Sep 201115 Aug 20158 Sep 2025
789sridurgahydraulics.comGoDaddy.com, LLC5 Dec 20136 Dec 20155 Dec 2016
790sridialog.comCSC Corporate Domains, Inc.9 Aug 20005 Aug 20239 Aug 2025
791sridevitv.comName.com, Inc.18 Sep 201026 Aug 202418 Sep 2025
792sridev.comCloudFlare, Inc.23 Feb 201124 Jan 202523 Feb 2026
793sridharvembu.com-28 Jun 202428 Jun 202428 Jun 2025
794srides.comGoDaddy.com, LLC12 Dec 201213 Dec 202412 Dec 2025
795sridharnursinghome.comGoDaddy.com, LLC29 Oct 201025 Oct 201529 Oct 2016
796sridevieyehospital.comBeijing Lanhai Jiye Technology Co., Ltd2 Apr 202324 Jan 20252 Apr 2025
797sridemolition.comeNom, Inc.8 Feb 201010 Jan 20258 Feb 2026
798sridaran.comGoDaddy.com, LLC14 Nov 202220 Nov 202414 Nov 2025
799sridarshan.comeNom, Inc.24 Nov 201323 Nov 202424 Nov 2025
800sridhar-dasani.comeNom, Inc.8 Dec 201128 Nov 20158 Dec 2016
801sridhanalakshmistores.comGoDaddy.com, LLC22 Jun 20233 Aug 202422 Jun 2024
802sridevisteelcraft.comPDR Ltd. d/b/a PublicDomainRegistry.com21 May 201224 May 202421 May 2025
803sridatta.comGoogle, Inc.22 Oct 200721 Oct 202422 Oct 2025
804sridestart.comGoDaddy.com, LLC14 Feb 202414 Feb 202414 Feb 2025
805sridevikrishnaswamy.comGoDaddy.com, LLC28 Jun 20126 Feb 20146 Feb 2019
806sridurgamandir.comWix.com Ltd.5 May 202115 Jun 20235 May 2023
807sridarandcompany.comPDR Ltd. d/b/a PublicDomainRegistry.com25 Jan 201427 Jan 201625 Jan 2017
808sridharkchari.comGoDaddy.com, LLC10 Aug 201213 Aug 201510 Aug 2017
809sridevibalacolourgalaxy.comPocketDomain.com Inc.3 Aug 202310 Sep 20243 Aug 2024
810sridurggaexports.comTucows Domains Inc.28 Sep 201030 Aug 202428 Sep 2025
811sridharj.comGoogle, Inc.12 May 201930 May 202412 May 2029
812sridgames.comGoDaddy.com, LLC29 Jan 201228 Apr 201529 Jan 2017
813sridaiva.com-15 Jan 201330 Jan 202515 Jan 2026
814sridemo.comGoDaddy.com, LLC5 Oct 20126 Oct 20245 Oct 2025
815sridentist.comDropCatch.com 498 LLC9 Oct 20189 Oct 20189 Oct 2019
816sridurgai.comGoDaddy.com, LLC14 Nov 201326 Jan 202514 Nov 2024
817sridharconstructions.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Oct 200820 Oct 202420 Oct 2025
818sridaiva-media.comFastDomain Inc.9 Apr 201317 Mar 20169 Apr 2017
819sridar.comGoDaddy.com, LLC20 Jul 200821 Jul 202420 Jul 2025
820srideepamkitchenequipments.comBigRock Solutions Ltd.12 Nov 201314 Dec 202412 Nov 2025
821sridomains.comPorkbun, LLC18 Nov 20029 Sep 202318 Nov 2025
822sridharlaxman.comGoDaddy.com, LLC11 Aug 20095 Aug 202311 Aug 2026
823sridcpower.comTucows Domains Inc.1 Dec 201116 Nov 20241 Dec 2025
824sridhu.comGoogle, Inc.24 Sep 201123 Sep 202424 Sep 2025
825sridharsqa.comBeijing Lanhai Jiye Technology Co., Ltd17 Mar 202219 May 202417 Mar 2024
826sridharcpa.comGoDaddy.com, LLC7 Apr 20137 Oct 20246 Oct 2025
827srideviretreats.comCronon AG7 Sep 20127 Sep 20127 Sep 2018
828srideviart.comWest263 International Limited20 Feb 202226 Apr 202320 Feb 2023
829sridharaanisteel.comGMO Internet Inc.18 Oct 202418 Oct 202418 Oct 2025
830sridevitheatre.comBeijing Lanhai Jiye Technology Co., Ltd24 Sep 202225 Sep 202324 Sep 2024
831sridasmeshacademy.comHostinger, UAB23 Aug 200924 Sep 202423 Aug 2025
832sridharkarnam.comGoogle, Inc.15 Jan 201331 Dec 202415 Jan 2026
833sridurgaexports.comGoDaddy.com, LLC8 Apr 20111 Nov 20228 Apr 2026
834sridosapalace.comGoDaddy.com, LLC30 Apr 201330 Apr 201330 Apr 2018
835sridharfoundation.comMAFF Inc.21 Aug 202229 Sep 202421 Aug 2024
836sridivyaphotos.comTucows Domains Inc.31 Jul 201931 Jul 201931 Jul 2020
837sriduttconstructions.comPDR Ltd. d/b/a PublicDomainRegistry.com27 May 201327 May 201727 May 2018
838sridher.comDeluxe Small Business Sales, Inc. d/b/a Aplus.net11 Aug 20056 Aug 202411 Aug 2033
839sridwarkadhish.comGoDaddy.com, LLC24 Mar 20045 Apr 202424 Mar 2027
840sridhar-rangaswamy.comGoDaddy.com, LLC21 Jun 201420 Feb 202519 Feb 2026
841sridaiva-press.comFastDomain Inc.9 Apr 201317 Mar 20169 Apr 2017
842srideep.comGoDaddy.com, LLC1 Mar 200724 Feb 20251 Mar 2026
843sridatai.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Oct 19974 Oct 20246 Oct 2025
844sridam.comPDR Ltd. d/b/a PublicDomainRegistry.com16 May 202416 Jul 202416 May 2025
845sridealhome.comMelbourne IT, Ltd7 Apr 20091 Dec 20247 Apr 2025
846sridharrangayan.comGoDaddy.com, LLC17 Sep 20112 Sep 201517 Sep 2017
847sridesi.comGoDaddy.com, LLC25 Oct 201312 Oct 201525 Oct 2016
848sridesahardware.comWeb Commerce Communications Limited dba WebNic.cc29 Aug 201329 Aug 201329 Aug 2017
849sridhanamcomputers.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Jul 20177 Jul 20177 Jul 2018
850sridevihomes.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Jan 201428 Jan 20163 Jan 2017
851sridharnandula.com1&1 Internet AG24 Mar 200825 Mar 201724 Mar 2018
852sridzn.comGoDaddy.com, LLC27 Mar 20095 Sep 202227 Mar 2025
853sridurgacoatings.comXin Net Technology Corporation27 Oct 20211 Aug 202227 Oct 2022
854sridanammadevi.comPDR Ltd. d/b/a PublicDomainRegistry.com17 Apr 201218 Apr 202417 Apr 2025
855sridevidigital.comWild West Domains, LLC27 Aug 202027 Aug 202027 Aug 2021
856sridevigranites.comGoDaddy.com, LLC19 Jul 201330 Sep 202319 Jul 2023
857sridelimawhse.comTucows Domains Inc.3 Apr 20147 Apr 20183 Apr 2018
858sridharan.comNetwork Solutions, LLC5 Oct 19995 Oct 20245 Oct 2034
859sridurgaleadershipacademy.comeNom, Inc.12 Nov 201411 Oct 201512 Nov 2016
860sridevi.comDynadot, LLC25 Mar 19998 Dec 202225 Mar 2025
861sridebnb.comOVH sas28 Jan 20092 Jan 202428 Jan 2025
862sridhari.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Sep 20144 Oct 201730 Sep 2018
863sridhatri.comPDR Ltd. d/b/a PublicDomainRegistry.com7 Sep 20116 Sep 20237 Sep 2025
864sridevibelton.comGoDaddy.com, LLC20 Feb 201320 Feb 201320 Feb 2018
865sridharadusumilli.comeNom, Inc.4 Dec 20085 Nov 20144 Dec 2018
866sridavaprakasha.comDynadot, LLC4 Oct 200419 Jul 20244 Oct 2026
867sridharblogs.comeNom, Inc.10 Jul 20083 Jul 202410 Jul 2025
868sridonmoon.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Aug 20075 Aug 20242 Aug 2025
869sridirect.comDomainAdministration.com, LLC21 Jul 20205 Sep 202421 Jul 2025
870sridesignworks.comAtak Domain Hosting Internet d/b/a Atak Teknoloji8 Aug 202213 Aug 20228 Aug 2023
871sridevidentalclinic.comGoogle, Inc.10 Aug 200826 Jul 202410 Aug 2025
872sridesign.comGoDaddy.com, LLC22 May 200026 Sep 202422 May 2025
873sridharkrish.comGoDaddy.com, LLC20 Jul 201325 Jul 202320 Jul 2025
874sridhanalakshmi.comGoDaddy.com, LLC21 Jan 200426 Jun 202421 Jan 2027
875sridgemanagement.comNetwork Solutions, LLC27 Mar 200712 Mar 202427 Mar 2025
876srideviads.comDropCatch.com 879 LLC25 Oct 20164 Dec 201725 Oct 2017
877sridx.comNetistrar Limited25 Aug 20146 Nov 202425 Aug 2024
878sridi.comMegazone Corp., dba HOSTING.KR15 Dec 200519 Aug 202415 Dec 2025
879sridrona.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Aug 20121 Oct 201620 Aug 2016
880sriddledesign.comeNom, Inc.5 Jun 20147 May 20165 Jun 2017
881sridharg.comTurnCommerce, Inc. DBA NameBright.com30 Dec 201224 Dec 202030 Dec 2025
882sridevinrithyalaya.comNetwork Solutions, LLC14 May 201218 Jun 202414 May 2025
883sridevioil.comNetwork Solutions, LLC1 Oct 202416 Oct 20241 Oct 2025
884sridesigngroup.comNetwork Solutions, LLC14 Nov 202327 Jan 202514 Nov 2024
885sridentalcare.comGoDaddy.com, LLC7 Dec 20048 Dec 20247 Dec 2025
886sridhargroup.comTurnCommerce, Inc. DBA NameBright.com8 Mar 20182 Mar 20218 Mar 2025
887sridea.comBeijing Lanhai Jiye Technology Co., Ltd13 Mar 201018 Jan 202513 Mar 2025
888sridachina.comHiChina Zhicheng Technology Limited13 Mar 201411 Jul 202313 Mar 2029
889sridurgamba.comAutomattic Inc.26 Jan 20226 Jan 202526 Jan 2026
890sridiculous.comeNom, Inc.26 Feb 201328 Jan 201726 Feb 2018
891sridharindia.comGoDaddy.com, LLC4 Oct 201319 Oct 20244 Oct 2025
892sridersclothingcom.comGoDaddy.com, LLC14 Apr 201317 Mar 201514 Apr 2020
893sridharmachinery.comGoogle, Inc.9 Sep 20219 Sep 20219 Sep 2022
894sridorefinearts.comKey-Systems GmbH19 Feb 200918 Feb 201719 Feb 2018
895sridharsdiacare.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Mar 20061 Apr 20248 Mar 2025
896sridistribution.comNetwork Solutions, LLC29 Aug 200030 Jun 202429 Aug 2025
897sridamansaraoutdoor.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jul 20094 Jun 20248 Jul 2025
898sridharpoduri.comGoogle, Inc.25 Jan 200720 Apr 202425 Jan 2026
899sridvr.comWest263 International Limited29 Jun 20226 Sep 202329 Jun 2023
900srid-dz.comTucows Domains Inc.6 May 200825 Apr 20246 May 2025
901sridharrubber.comGoDaddy.com, LLC24 May 20035 Apr 202424 May 2025
902sridurgahomeservices.comGoDaddy.com, LLC10 Jan 201330 Apr 201510 Jan 2017
903sridharcommissionagent.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Dec 201231 Jan 201627 Dec 2016
904sridarail.comHiChina Zhicheng Technology Limited28 Jul 201429 Jul 202428 Jul 2025
905sridevijewellers.comNamePal.com #802624 Mar 202427 Mar 202424 Mar 2025
906sridharam.comGoDaddy.com, LLC29 Sep 202429 Sep 202429 Sep 2025
907sridagreenliving.comTucows Domains Inc.24 Feb 201428 Feb 201824 Feb 2018
908sridurgaresidency.comDropCatch.com 1085 LLC21 Jun 201721 Jun 201721 Jun 2018
909sridharpasham.comeNom, Inc.8 Jan 20147 Jan 20178 Jan 2018
910sridharaspa.comGoDaddy.com, LLC18 Jun 201029 May 202418 Jun 2025
911sridharkumar.comGoDaddy.com, LLC4 Jun 20074 Jun 20234 Jun 2025
912sridharthota.comGoDaddy.com, LLC29 Nov 200730 Dec 202229 Nov 2032
913sridta.com1&1 Internet AG31 Jan 200831 Jan 202531 Jan 2026
914sridanta.comGoDaddy.com, LLC30 Jul 202010 Sep 202330 Jul 2023
915sridharfunctionplaza.comPDR Ltd. d/b/a PublicDomainRegistry.com26 Feb 200327 Feb 202526 Feb 2026
916sridharsunkara.comGoDaddy.com, LLC17 Feb 200818 Feb 202517 Feb 2027
917srideviindustries.comHostinger, UAB29 Oct 202429 Oct 202429 Oct 2025
918sridevipromoters.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Nov 20134 Jan 201629 Nov 2016
919sridamansara.comName.com, Inc.3 Sep 20221 Sep 20243 Sep 2025
920sridaivapress.comFastDomain Inc.9 Apr 201317 Mar 20169 Apr 2017
921sridurgafurnitures.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Aug 201324 Aug 20165 Aug 2017
922sridurgasnacks.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Apr 20135 May 20175 Apr 2018
923sridurgaconstructionequipments.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Oct 201230 Nov 202319 Oct 2023
924sridesigns.comTurnCommerce, Inc. DBA NameBright.com24 Feb 201317 Feb 202124 Feb 2025
925srideepti.comGoDaddy.com, LLC20 Aug 20129 Aug 202320 Aug 2028
926sridharpurcoopbank.comMetaregistrar BV Applications13 Jun 202327 Jul 202413 Jun 2024
927sridex.comGoDaddy.com, LLC13 Dec 201911 Dec 202413 Dec 2025
928sridurkatemple.comOnlineNIC, Inc.26 Jan 201428 Jan 202526 Jan 2026
929sridasmeshdarbar.comCrazy Domains FZ-LLC25 Apr 201726 Jan 201825 Apr 2018
930sridharrangaswamy.comGoDaddy.com, LLC21 Jun 201420 Feb 202519 Feb 2026
931sridevices.comGoDaddy.com, LLC12 Feb 201412 Feb 201612 Feb 2018
932sridurgamanikantanursery.comGoDaddy.com, LLC16 Jun 201229 Jun 201616 Jun 2017
933sridevigali.com1&1 Internet AG1 Dec 20112 Dec 20161 Dec 2017
934sridurgambabus.comGoDaddy.com, LLC15 Jun 20117 Jun 201615 Jun 2017
935sridhar85.comCloudFlare, Inc.6 Jun 20127 May 20246 Jun 2025
936sridpathcpa.comNameCheap, Inc.28 Jun 20229 Aug 202328 Jun 2023
937sridhardental.comGoDaddy.com, LLC25 Jan 201226 Jan 202525 Jan 2026
938sridevigraphics.comBigRock Solutions Ltd.19 Mar 201423 Mar 201719 Mar 2018
939sridevi-krishnaswamy.comGoDaddy.com, LLC28 Jun 20126 Feb 20146 Feb 2019
940srideviganja.comGoDaddy.com, LLC4 Dec 20105 Dec 20244 Dec 2025
941sridevibuilders.comBigRock Solutions Ltd.10 Sep 20105 Sep 202410 Sep 2025
942sridurgashakthi.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jul 201425 Jun 20248 Jul 2025
943sridee.comTurnCommerce, Inc. DBA NameBright.com4 Nov 201714 Jan 20254 Nov 2024
944sridurgalakshmitrading.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Feb 20131 Mar 201720 Feb 2019
945sridge.comTurnCommerce, Inc. DBA NameBright.com11 Jan 199920 Aug 202111 Jan 2026
946sridharcancercare.com-15 May 202316 Jun 202415 May 2024
947sridharyaratha.com1&1 Internet AG3 Dec 201215 May 20173 Dec 2017
948srideascs.comCSC Corporate Domains, Inc.18 Mar 200714 Mar 201718 Mar 2018
949sridersclothing.comGoDaddy.com, LLC14 Apr 201317 Mar 201514 Apr 2020
950sridevigroupofcolleges.comGoDaddy.com, LLC3 Aug 201430 Jul 20163 Aug 2017
951sridwarakashipping.comNameCheap, Inc.11 Mar 202310 Feb 202411 Mar 2025
952sridurgacorp.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Jan 201331 Dec 20245 Jan 2026
953sridact.comGMO Internet Inc.2 Feb 20123 Jan 20242 Feb 2027
954sridharshana.comNameCheap, Inc.1 Apr 20133 Apr 20241 Apr 2025
955sridecor.comWix.com Ltd.10 Oct 201313 Jun 202310 Oct 2027
956sridharlivevideos.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Nov 20124 Oct 201711 Nov 2018
957sridurgaagencies.comGoogle, Inc.17 Jul 202316 Aug 202417 Jul 2024
958sridharisreddy.comTucows Domains Inc.11 May 201326 Apr 202411 May 2025
959sridisha.comBeijing Lanhai Jiye Technology Co., Ltd28 Jul 202129 Aug 202428 Jul 2024
960sridevitraders.comGMO Internet Inc.6 Jun 202312 Aug 20246 Jun 2024
961sridesikanathar.comBigRock Solutions Ltd.25 Apr 201127 Apr 202425 Apr 2027
962sridhanwantari.comHongkong Domain Name Information Management Co., L…2 Nov 202212 Dec 20232 Nov 2023
963sridharkatta.comGoDaddy.com, LLC5 Jan 20136 Jan 20235 Jan 2028
964sridurgaenterprises.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Jul 201213 Sep 20249 Jul 2027
965sridevisupermarket.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Apr 201629 Jun 201629 Apr 2017
966srideviveda.comPDR Ltd. d/b/a PublicDomainRegistry.com24 Nov 202024 Nov 202424 Nov 2025
967sridesikadasan.orgGoDaddy.com, LLC1 Oct 20164 Sep 20171 Oct 2019
968sridesikadasan.com-1 Oct 20161 Oct 20161 Oct 2017
969sridharsrivin.comBigRock Solutions Ltd.3 Oct 201614 Nov 20173 Oct 2017
970sridhanvanthritrust.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 201228 Dec 201623 Nov 2017
971sridharsmusic.comGoogle, Inc.7 Jun 200923 Apr 20247 Jun 2029
972sridasamgranth.comWebfusion Ltd.24 Jan 200826 Oct 202424 Jan 2027
973sridancestudios.com-10 Oct 201610 Oct 201610 Oct 2017
974sriders.infoGoDaddy.com, LLC14 Apr 201215 Jun 201214 Apr 2022
975sridharkumarkannam.infoGoDaddy.com, LLC14 Jan 201213 Jan 201714 Jan 2018
976sridharchityala.infoGoDaddy.com, LLC31 Oct 201312 Nov 201731 Oct 2018
977sridatta.infoGoDaddy.com, LLC30 Jul 201313 Sep 202430 Jul 2025
978sriderana.infoGoDaddy.com, LLC13 Jun 201428 Jun 201713 Jun 2018
979sridharkarnam.info1&1 Internet AG15 Jan 201317 Feb 201615 Jan 2017
980sridhara.info-8 Feb 20249 Feb 20258 Feb 2026
981sriders.mobiGoDaddy.com, LLC14 Apr 201215 Jun 201214 Apr 2022
982sridekor.comTucows Domains Inc.12 Oct 201616 Oct 201712 Oct 2017
983sridurgaaasociates.comBigRock Solutions Ltd.13 Oct 201613 Dec 201613 Oct 2018
984sridharcreativemedia.com-17 Oct 201617 Oct 201617 Oct 2017
985sridhar.netOnlineNIC, Inc.13 Jun 200113 Jun 202413 Jun 2025
986sridge.netGoDaddy.com, LLC8 May 20023 Oct 20228 May 2026
987sridc.net-5 Sep 20245 Sep 20245 Sep 2025
988sridharrubber.netFastDomain Inc.4 Aug 201128 Mar 20164 Aug 2017
989sridhara.netGoogle, Inc.24 Jun 202218 Jun 202424 Jun 2027
990sridhama.netGoDaddy.com, LLC8 Dec 20021 Dec 20148 Dec 2016
991sridialog.netCSC Corporate Domains, Inc.9 Aug 20005 Aug 20239 Aug 2025
992sridaivatv.netFastDomain Inc.3 Aug 201323 Jan 20143 Aug 2016
993srida.netGoDaddy.com, LLC5 Apr 20245 Apr 20245 Apr 2025
994sridev.netGoDaddy.com, LLC26 Jun 201120 Oct 202126 Jun 2022
995sridharan.netName.com, Inc.27 Nov 20115 Nov 202427 Nov 2025
996sridevigroup.netBigRock Solutions Ltd.13 May 201414 May 202413 May 2025
997sridurgaagencies.netDynadot, LLC13 Sep 20244 Dec 202413 Sep 2025
998sridevikrishnakumar.netTucows Domains Inc.2 Apr 20086 Apr 20222 Apr 2022
999sridharv.netGoogle, Inc.1 Feb 200817 Jan 20251 Feb 2026
1000sridhargroup.netNetwork Solutions, LLC24 Jun 201224 Jul 202424 Jun 2025

Displaying 1,000 out of 3,184 domains starting with the keyword "SRID". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=srid

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now