With support for 
Keyword: STEPBYSTEP
Reverse Whois » KEYWORD [stepbystep ] { 3,696 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | stepbystep.com | Tucows Domains Inc. | 24 Apr 1998 | 24 Mar 2024 | 23 Apr 2025 |
| 2 | stepbystep.me | Dynadot, LLC | 22 Jan 2014 | 22 May 2017 | 22 Jan 2018 |
| 3 | stepbystep.marketing | NameCheap, Inc. | 14 May 2024 | 19 May 2024 | 14 May 2025 |
| 4 | stepbystep.nyc | Instra Corporation Pty Ltd. | 3 Oct 2014 | 13 Jan 2018 | 2 Oct 2018 |
| 5 | stepbystep.xyz | GoDaddy.com, LLC | 28 Oct 2014 | 8 Jun 2024 | 28 Oct 2024 |
| 6 | stepbystep.life | - | 11 Aug 2023 | 11 Aug 2024 | 11 Aug 2025 |
| 7 | stepbystep.space | Porkbun, LLC | 25 May 2021 | 25 May 2021 | 25 May 2022 |
| 8 | stepbystep.coach | Uniregistrar Corp | 14 Oct 2021 | 7 Jun 2024 | 14 Oct 2024 |
| 9 | stepbystep.tips | Porkbun, LLC | 17 Oct 2023 | 22 Oct 2023 | 17 Oct 2024 |
| 10 | stepbystep.consulting | Crazy Domains FZ-LLC | 26 Jun 2018 | 12 Oct 2023 | 26 Jun 2025 |
| 11 | stepbystep.site | - | 14 Jul 2023 | 28 Aug 2024 | 14 Jul 2024 |
| 12 | stepbystep.school | GoDaddy.com, LLC | 23 Jul 2015 | 19 Jul 2024 | 23 Jul 2029 |
| 13 | stepbystep.solar | eNom, Inc. | 4 Aug 2015 | 4 Aug 2015 | 4 Aug 2016 |
| 14 | stepbystep.link | GMO Internet Inc. | 7 Aug 2015 | 13 Jul 2024 | 7 Aug 2025 |
| 15 | stepbystep.club | OVH sas | 13 Aug 2021 | 6 Aug 2023 | 13 Aug 2024 |
| 16 | stepbystep.video | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Jan 2018 | 2 Mar 2024 | 17 Jan 2025 |
| 17 | stepbystep.work | GMO Internet Inc. | 24 Aug 2021 | 24 Aug 2024 | 24 Aug 2024 |
| 18 | stepbystep.moda | Tucows Domains Inc. | 18 Sep 2015 | 22 Sep 2017 | 18 Sep 2018 |
| 19 | stepbystep.top | Dynadot, LLC | 2 Apr 2024 | 2 Apr 2024 | 2 Apr 2025 |
| 20 | stepbystep.online | Xiamen ChinaSource Internet Service Co., Ltd. | 1 Oct 2023 | 13 Apr 2024 | 1 Oct 2024 |
| 21 | stepbystep.business | GoDaddy.com, LLC | 2 Mar 2023 | 13 Apr 2024 | 2 Mar 2024 |
| 22 | stepbystep.jewelry | GoDaddy.com, LLC | 5 Nov 2015 | 6 Jan 2017 | 5 Nov 2017 |
| 23 | stepbystep.systems | GoDaddy.com, LLC | 9 Apr 2022 | 24 May 2024 | 9 Apr 2025 |
| 24 | stepbystep.tech | Chengdu West Dimension Digital Technology Co., Ltd… | 24 Nov 2023 | 12 Jan 2024 | 24 Nov 2024 |
| 25 | stepbystep.one | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Jan 2023 | 23 Jan 2024 | 23 Jan 2024 |
| 26 | stepbystep.website | Hostinger, UAB | 9 Jun 2024 | 14 Jun 2024 | 9 Jun 2025 |
| 27 | stepbystep.design | Domain.com, LLC | 12 Jun 2021 | 17 Jun 2021 | 12 Jun 2026 |
| 28 | stepbystep.guru | eNom, Inc. | 22 May 2022 | 27 May 2024 | 22 May 2025 |
| 29 | stepbystep.fit | GoDaddy.com, LLC | 12 Nov 2020 | 11 Jul 2024 | 12 Nov 2024 |
| 30 | stepbystep.city | GoDaddy.com, LLC | 26 Feb 2021 | 26 Feb 2021 | 26 Feb 2022 |
| 31 | stepbystep.name | PDR Ltd. d/b/a PublicDomainRegistry.com | - | - | - |
| 32 | stepbystep.ist | GoDaddy.com, LLC | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 33 | stepbystep.istanbul | - | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 34 | stepbystep.academy | 1&1 Internet AG | 29 May 2016 | 13 Jul 2024 | 29 May 2025 |
| 35 | stepbystep.org.uk | - | 30 Apr 2006 | 7 Aug 2024 | 30 Apr 2025 |
| 36 | stepbystep.click | Hostinger, UAB | 6 Oct 2023 | 3 Nov 2023 | 6 Oct 2024 |
| 37 | stepbystep.shoes | Server Plan Srl | 1 Jul 2016 | 22 Jun 2024 | 1 Jul 2025 |
| 38 | stepbystep.land | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 4 Apr 2014 | 19 May 2017 | 4 Apr 2018 |
| 39 | stepbystep.science | Alpnames Limited | 25 Feb 2015 | 21 May 2016 | 24 Feb 2017 |
| 40 | stepbystep.solutions | NameCheap, Inc. | 22 Apr 2014 | 30 Mar 2024 | 22 Apr 2025 |
| 41 | stepbystep.technology | GoDaddy.com, LLC | 27 Mar 2014 | 1 Jul 2024 | 27 Mar 2025 |
| 42 | stepbystep.center | GoDaddy.com, LLC | 24 Feb 2020 | 9 Apr 2024 | 24 Feb 2025 |
| 43 | stepbystep.training | Crazy Domains FZ-LLC | 1 Dec 2021 | 26 Jul 2024 | 1 Dec 2026 |
| 44 | stepbystep.education | GoDaddy.com, LLC | 18 Apr 2014 | 1 Jul 2024 | 18 Apr 2025 |
| 45 | stepbystep.biz | Regtime Ltd. | 21 Jul 2018 | 14 Jun 2024 | 21 Jul 2025 |
| 46 | stepbystep.expert | Hostinger, UAB | 6 Apr 2023 | 17 May 2024 | 6 Apr 2024 |
| 47 | stepbystep.yoga | Namesilo, LLC | 24 Jul 2016 | 1 Jul 2024 | 24 Jul 2026 |
| 48 | stepbystep.stream | Alpnames Limited | 1 Aug 2016 | 1 Aug 2016 | 31 Jul 2017 |
| 49 | stepbystep.tel | - | 16 Jun 2009 | 16 Jun 2009 | 15 Jun 2017 |
| 50 | stepbystep.scot | Mesh Digital Limited | 23 Aug 2016 | 20 Aug 2017 | 23 Aug 2018 |
| 51 | stepbystep.info | GoDaddy.com, LLC | 22 Sep 2001 | 2 Jul 2024 | 22 Sep 2024 |
| 52 | stepbystep.net | Uniregistrar Corp | 2 Mar 2009 | 24 Jan 2024 | 2 Mar 2025 |
| 53 | stepbystep.org | Dynadot, LLC | 28 Jun 2010 | 11 Aug 2024 | 28 Jun 2025 |
| 54 | stepbystep.ltd | GoDaddy.com, LLC | 11 Nov 2022 | 11 Nov 2023 | 11 Nov 2024 |
| 55 | stepbystep.by | - | 12 Apr 2024 | 12 Apr 2024 | 12 Apr 2026 |
| 56 | stepbystep.ca | - | 22 Dec 2021 | 29 Aug 2023 | 22 Dec 2027 |
| 57 | stepbystep.com.co | HELLO.CO|CENTRAL COMERCIALIZADORA DE INTERNET S.A.… | 20 Apr 2010 | 6 Apr 2024 | 19 Apr 2025 |
| 58 | stepbystep.ch | - | - | - | - |
| 59 | stepbystep.pro | - | 24 Jan 2024 | 27 Feb 2024 | 24 Jan 2025 |
| 60 | stepbystep.tours | GoDaddy.com, LLC | 20 Nov 2016 | 21 Nov 2017 | 20 Nov 2018 |
| 61 | stepbystep.help | Hostinger, UAB | 1 Feb 2023 | 10 Jan 2024 | 1 Feb 2025 |
| 62 | stepbystep.cloud | Porkbun, LLC | 27 Jan 2023 | 7 Apr 2024 | 27 Jan 2024 |
| 63 | stepbystep.watch | - | 21 Dec 2023 | 5 Feb 2024 | 21 Dec 2024 |
| 64 | stepbystep.today | NameCheap, Inc. | 4 Apr 2024 | 9 Apr 2024 | 4 Apr 2025 |
| 65 | stepbystep.fyi | GoDaddy.com, LLC | 27 Nov 2023 | 2 Dec 2023 | 27 Nov 2024 |
| 66 | stepbystep.digital | GoDaddy.com, LLC | 8 Jul 2024 | 13 Jul 2024 | 8 Jul 2025 |
| 67 | stepbystep.run | Google, Inc. | 2 Sep 2017 | 23 Aug 2024 | 2 Sep 2025 |
| 68 | stepbystep.rocks | GoDaddy.com, LLC | 17 Sep 2017 | 17 Sep 2017 | 17 Sep 2018 |
| 69 | stepbystep.study | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Oct 2017 | 9 Oct 2017 | 9 Oct 2018 |
| 70 | stepbystep.guide | Regional Network Information Center, JSC dba RU-CE… | 17 Oct 2021 | 17 Oct 2021 | 17 Oct 2022 |
| 71 | stepbystep.services | GoDaddy.com, LLC | 3 Oct 2021 | 17 Nov 2023 | 3 Oct 2024 |
| 72 | stepbystep.recipes | Uniregistrar Corp | 1 Jan 2018 | 1 Jan 2018 | 1 Jan 2019 |
| 73 | stepbystep.co.uk | eNom, Inc. | 17 Sep 1998 | 19 Aug 2017 | 17 Sep 2018 |
| 74 | stepbystep.me.uk | - | 8 Oct 2014 | 6 Oct 2017 | 8 Oct 2018 |
| 75 | stepbystep.world | - | 13 Jul 2024 | 30 Aug 2024 | 13 Jul 2025 |
| 76 | stepbystep.network | Uniregistrar Corp | 11 Aug 2020 | 24 Aug 2023 | 11 Aug 2024 |
| 77 | stepbystep.social | 1API GmbH | 6 Feb 2018 | 6 Feb 2018 | 6 Feb 2019 |
| 78 | stepbystep.agency | OnlineNIC, Inc. | 7 Dec 2020 | 10 Dec 2023 | 7 Dec 2024 |
| 79 | stepbystep.company | Porkbun, LLC | 23 Jul 2020 | 5 Aug 2023 | 23 Jul 2024 |
| 80 | stepbystep.wiki | NameCheap, Inc. | 31 Mar 2018 | 30 Jul 2023 | 31 Mar 2025 |
| 81 | stepbystep.store | - | 30 Jul 2023 | 31 Jul 2024 | 30 Jul 2025 |
| 82 | stepbystep.institute | GoDaddy.com, LLC | 2 May 2018 | 13 Jul 2020 | 2 May 2020 |
| 83 | stepbystep.courses | Gransy s.r.o. d/b/a subreg.cz | 19 Jul 2018 | 25 Jun 2024 | 19 Jul 2025 |
| 84 | stepbystep.events | GoDaddy.com, LLC | 7 Aug 2018 | 21 Sep 2019 | 7 Aug 2020 |
| 85 | stepbystep.co | HELLO.CO|CENTRAL COMERCIALIZADORA DE INTERNET S.A.… | 28 Apr 2010 | 6 Apr 2024 | 27 Apr 2025 |
| 86 | stepbystep.team | Tucows Domains Inc. | 7 May 2020 | 11 May 2021 | 7 May 2022 |
| 87 | stepbystep.mobi | NameCheap, Inc. | 25 Dec 2018 | 25 Dec 2018 | 25 Dec 2019 |
| 88 | stepbystep.fitness | NameKing.com Inc. | 9 Jun 2023 | 22 Aug 2024 | 9 Jun 2024 |
| 89 | stepbystep.travel | GoDaddy.com, LLC | 29 Oct 2018 | 3 Nov 2018 | 29 Oct 2019 |
| 90 | stepbystep.dating | 10dencehispahard, S.L. | 1 Feb 2019 | 6 Feb 2019 | 1 Feb 2020 |
| 91 | stepbystep.photography | NameCheap, Inc. | 16 Jul 2019 | 21 Jun 2020 | 16 Jul 2021 |
| 92 | stepbystep.media | PSI-USA, Inc. dba Domain Robot | 4 Oct 2019 | 29 Dec 2023 | 4 Oct 2024 |
| 93 | stepbystep.kim | FBS Inc. | 14 Dec 2019 | 13 Feb 2020 | 14 Dec 2020 |
| 94 | stepbystep.coffee | NETIM SARL | 10 Apr 2020 | 15 Apr 2020 | 10 Apr 2021 |
| 95 | stepbystep.global | Gandi SAS | 8 Jul 2022 | 12 Aug 2024 | 8 Jul 2025 |
| 96 | stepbystep.credit | Porkbun, LLC | 23 Jul 2020 | 23 Jul 2022 | 23 Jul 2023 |
| 97 | stepbystep.group | Chengdu West Dimension Digital Technology Co., Ltd… | 27 Oct 2023 | 5 Jan 2024 | 27 Oct 2024 |
| 98 | stepbystep.international | Gransy s.r.o. d/b/a subreg.cz | 22 Sep 2020 | 6 Nov 2023 | 22 Sep 2024 |
| 99 | stepbystep.salon | One.com A/S | 31 Oct 2020 | 31 Oct 2020 | 31 Oct 2021 |
| 100 | stepbystep.soccer | Name.com, Inc. | 5 Apr 2021 | 18 Mar 2024 | 5 Apr 2025 |
| 101 | stepbystep.icu | Metaregistrar BV Applications | 21 Jun 2018 | 22 Jun 2024 | 21 Jun 2025 |
| 102 | stepbystep.sbs | Porkbun, LLC | 17 Jul 2021 | 4 Aug 2024 | 17 Jul 2025 |
| 103 | stepbystep.foundation | GoDaddy.com, LLC | 17 Sep 2021 | 13 Aug 2024 | 17 Sep 2024 |
| 104 | stepbystep.love | GoDaddy.com, LLC | 5 Nov 2021 | 5 Nov 2021 | 5 Nov 2022 |
| 105 | stepbystep.joburg | Tucows Domains Inc. | 17 Jan 2022 | 27 Jan 2024 | 17 Jan 2024 |
| 106 | stepbystep.investments | OVH sas | 5 Mar 2022 | 19 Apr 2024 | 5 Mar 2025 |
| 107 | stepbystep.realestate | Name Share, Inc. | 10 Mar 2022 | 10 Mar 2023 | 10 Mar 2024 |
| 108 | stepbystep.tv | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 May 2016 | 27 May 2022 | 26 May 2023 |
| 109 | stepbystep.ws | register.com, Inc. | 21 Jul 2010 | 9 Jul 2024 | 21 Jul 2025 |
| 110 | stepbystep.support | - | 25 Nov 2023 | 1 Feb 2024 | 25 Nov 2024 |
| 111 | stepbystep.au | - | - | 23 Jun 2024 | - |
| 112 | stepbystep.fund | GoDaddy.com, LLC | 4 Nov 2022 | 16 Dec 2023 | 4 Nov 2023 |
| 113 | stepbystep.finance | GoDaddy.com, LLC | 11 Nov 2022 | 23 Dec 2023 | 11 Nov 2023 |
| 114 | stepbystep.org.pl | - | 27 Jan 2020 | 6 Jan 2024 | 27 Jan 2025 |
| 115 | stepbystep.exchange | GoDaddy.com, LLC | 29 Nov 2022 | 9 Feb 2024 | 29 Nov 2023 |
| 116 | stepbystep.bar | Dynadot, LLC | 26 Aug 2022 | 31 Aug 2023 | 26 Aug 2024 |
| 117 | stepbystep.tokyo | GMO Internet Inc. | 6 Oct 2020 | 1 Dec 2022 | 6 Oct 2025 |
| 118 | stepbystep.org.au | - | - | 7 Jun 2024 | - |
| 119 | stepbystep.info.pl | - | 25 Jan 2006 | 18 Dec 2023 | 25 Jan 2025 |
| 120 | stepbystep.app | GoDaddy.com, LLC | 5 May 2018 | 19 Jun 2024 | 5 May 2025 |
| 121 | stepbystep.berlin | 1&1 Internet AG | 18 Mar 2014 | 27 Apr 2023 | 18 Mar 2024 |
| 122 | stepbystep.baby | - | 21 May 2024 | 24 Jun 2024 | 21 May 2025 |
| 123 | stepbystep.blog | Netowl, Inc. | 14 Jun 2023 | 21 May 2024 | 14 Jun 2025 |
| 124 | stepbystep.vip | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 19 Apr 2018 | 1 Jun 2018 | 19 Apr 2028 |
| 125 | stepbystep.eus | OVH sas | 25 Mar 2022 | 26 Mar 2023 | 25 Mar 2025 |
| 126 | stepbystep.net.pl | - | 18 Jul 2017 | 23 Jun 2024 | 18 Jul 2025 |
| 127 | stepbystep.autos | NameCheap, Inc. | 9 Mar 2023 | 20 May 2024 | 9 Mar 2024 |
| 128 | stepbystep.net.au | - | - | 17 Feb 2024 | - |
| 129 | stepbystep.press | Hostinger, UAB | 5 Apr 2023 | 15 Mar 2024 | 5 Apr 2025 |
| 130 | stepbystep.dance | Cronon AG | 27 Nov 2019 | 11 Jan 2024 | 27 Nov 2024 |
| 131 | stepbystep.dentist | Mesh Digital Limited | 6 May 2020 | 17 Jun 2024 | 6 May 2024 |
| 132 | stepbystep.engineer | GoDaddy.com, LLC | 29 Sep 2020 | 29 Jun 2024 | 29 Sep 2024 |
| 133 | stepbystep.fun | Chengdu West Dimension Digital Technology Co., Ltd… | 12 Jul 2024 | 23 Aug 2024 | 12 Jul 2025 |
| 134 | stepbystep.futbol | GMO Internet Inc. | 19 Mar 2020 | 29 May 2024 | 19 Mar 2024 |
| 135 | stepbystep.ie | Protocol Internet Technology Limited T/A Hosting I… | 3 Nov 2020 | 18 Dec 2023 | 3 Nov 2024 |
| 136 | stepbystep.co.in | GoDaddy.com, LLC | 7 Jul 2022 | 12 Jul 2022 | 7 Jul 2025 |
| 137 | stepbystep.in | GoDaddy.com, LLC | 1 Mar 2019 | 9 Aug 2024 | 1 Mar 2025 |
| 138 | stepbystep.it | - | 23 Jun 2008 | 9 Jul 2024 | 23 Jun 2025 |
| 139 | stepbystep.jp | - | 1 Nov 2022 | 1 Nov 2022 | 30 Nov 2023 |
| 140 | stepbystep.live | GoDaddy.com, LLC | 28 Apr 2024 | 9 Aug 2024 | 28 Apr 2025 |
| 141 | stepbystep.kaufen | Cronon AG | 20 Apr 2023 | 20 May 2024 | 20 Apr 2024 |
| 142 | stepbystep.news | Google, Inc. | 16 Sep 2020 | 16 Sep 2023 | 16 Sep 2024 |
| 143 | stepbystep.co.nz | - | 22 Nov 1998 | 9 Mar 2024 | - |
| 144 | stepbystep.pl | - | 29 Nov 2016 | 29 Nov 2023 | 29 Nov 2024 |
| 145 | stepbystep.com.pl | - | 14 Feb 2021 | 9 Feb 2024 | 14 Feb 2025 |
| 146 | stepbystep.uk | - | 4 Oct 2020 | 13 Jul 2024 | 4 Oct 2024 |
| 147 | stepbystep.ren | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 10 Nov 2019 | - | 10 Nov 2024 |
| 148 | stepbystep.kids | Wild West Domains, LLC | 1 Jun 2023 | 6 Jun 2024 | 1 Jun 2033 |
| 149 | stepbystep.com.hr | - | 21 May 2023 | 6 Aug 2024 | 21 May 2025 |
| 150 | stepbystep.net.in | INTERNETX GMBH|NEULEVELCSR | 26 May 2023 | 10 Jul 2024 | 26 May 2025 |
| 151 | stepbystep.org.nz | - | 26 Aug 2020 | 31 Oct 2022 | - |
| 152 | stepbystep.ng | - | 22 Apr 2022 | 22 Mar 2024 | 22 Apr 2025 |
| 153 | stepbystep.travel.pl | home.pl S.A. | 14 Aug 2023 | 13 Aug 2024 | 14 Aug 2025 |
| 154 | stepbystep.photos | Namesilo, LLC | 16 Sep 2023 | 21 Sep 2023 | 16 Sep 2024 |
| 155 | stepbystep.com.cn | - | 22 Apr 2024 | - | 22 Apr 2025 |
| 156 | stepbystep.tools | NameCheap, Inc. | 5 Feb 2024 | 10 Feb 2024 | 5 Feb 2025 |
| 157 | stepbystep.ro | - | - | - | 23 May 2028 |
| 158 | stepbystep.host | Bizcn.com, Inc. | 16 Feb 2024 | 16 Feb 2024 | 16 Feb 2025 |
| 159 | stepbystep.asia | DNSPod, Inc. | 27 Mar 2024 | 1 Apr 2024 | 27 Mar 2025 |
| 160 | stepbystep.com.br | - | 25 Oct 2009 | 11 Oct 2023 | 25 Oct 2028 |
| 161 | stepbystep.hr | - | 11 Dec 2002 | 7 Jul 2024 | 7 Jul 2025 |
| 162 | stepbystep.ru | - | 14 Nov 2000 | - | 16 Nov 2024 |
| 163 | stepbystep.de | - | - | 16 Oct 2022 | - |
| 164 | stepbystep.sk | - | 25 Jan 2013 | 13 Feb 2024 | 25 Jan 2025 |
| 165 | stepbystep.se | - | 12 Feb 2003 | 2 Dec 2023 | 12 Feb 2025 |
| 166 | stepbystep.vision | TLD Registrar Solutions Ltd. | 24 Jul 2023 | 25 Jul 2024 | 24 Jul 2025 |
| 167 | stepbystep.nz | - | 16 Oct 2019 | 21 Oct 2023 | - |
| 168 | stepbystep.lol | NameCheap, Inc. | 3 Aug 2024 | 12 Aug 2024 | 3 Aug 2025 |
| 169 | stepbystepselfpublishing.net | Key-Systems GmbH | 15 Dec 2017 | 20 Jan 2024 | 15 Dec 2024 |
| 170 | stepbystepcashsystem.com | NameCheap, Inc. | 2 May 2011 | 2 Apr 2024 | 2 May 2025 |
| 171 | stepbystepmarketing.com | DropCatch.com 513 LLC | 12 Sep 2023 | 13 Sep 2023 | 12 Sep 2024 |
| 172 | stepbystepcc.com | Tucows Domains Inc. | 24 Jul 2002 | 28 Jul 2024 | 24 Jul 2025 |
| 173 | stepbystepimages.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Jul 2021 | 28 Jul 2023 | 27 Jul 2024 |
| 174 | stepbysteplistening.com | Webfusion Ltd. | 20 Jul 2010 | 20 Dec 2023 | 20 Jul 2025 |
| 175 | stepbystepwithfred.com | GoDaddy.com, LLC | 20 Mar 2012 | 15 Mar 2017 | 20 Mar 2018 |
| 176 | stepbystepwithben.com | GoDaddy.com, LLC | 29 May 2012 | 29 May 2012 | 29 May 2013 |
| 177 | stepbystep-schulranzen.com | CSC Corporate Domains, Inc. | 8 Jul 2005 | 4 Jul 2024 | 8 Jul 2025 |
| 178 | stepbystepfundraising.com | GoDaddy.com, LLC | 4 Aug 2003 | 4 Aug 2024 | 4 Aug 2025 |
| 179 | stepbysteppresentations.com | Name.com, Inc. | 19 Jun 2024 | 19 Jun 2024 | 19 Jun 2025 |
| 180 | stepbystep-msk.ru | - | 1 Jun 2021 | - | 1 Jun 2025 |
| 181 | stepbystep-load.com | Bizcn.com, Inc. | 16 Oct 2013 | 23 Oct 2014 | 16 Oct 2015 |
| 182 | stepbysteptherapy.org | FastDomain Inc. | 12 Aug 2009 | 1 Aug 2024 | 12 Aug 2025 |
| 183 | stepbystepcs.org | GoDaddy.com, LLC | 22 Oct 2014 | 7 Jul 2024 | 22 Oct 2024 |
| 184 | stepbystep-load.net | Bizcn.com, Inc. | 16 Oct 2013 | 23 Oct 2014 | 16 Oct 2015 |
| 185 | stepbysteproject.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 12 Nov 2019 | 12 Nov 2019 | 12 Nov 2020 |
| 186 | stepbystepwealthsystem.com | GoDaddy.com, LLC | 26 Jul 2022 | 21 Jun 2024 | 26 Jul 2024 |
| 187 | stepbystepministries.org | 1&1 Internet AG | 5 Jun 2021 | 20 Jul 2024 | 5 Jun 2025 |
| 188 | stepbystepcare.com | TurnCommerce, Inc. DBA NameBright.com | 12 Jan 2017 | 6 Jan 2021 | 12 Jan 2026 |
| 189 | stepbystepanswers.com | eNom, Inc. | 23 Sep 2010 | 21 Dec 2016 | 23 Sep 2017 |
| 190 | stepbystepconstruction.com | eNom, Inc. | 29 Aug 2010 | 29 Aug 2024 | 29 Aug 2025 |
| 191 | stepbystepschool.com | eNom, Inc. | 27 Sep 2011 | 25 Sep 2023 | 27 Sep 2024 |
| 192 | stepbystepbooks.com | GoDaddy.com, LLC | 9 Jul 2023 | 20 Aug 2024 | 9 Jul 2024 |
| 193 | stepbystepdesign.com | eNom, Inc. | 6 Aug 2011 | 2 Aug 2024 | 6 Aug 2025 |
| 194 | stepbystephandbook.com | eNom, Inc. | 9 Aug 2011 | 14 Jul 2017 | 9 Aug 2017 |
| 195 | stepbystepmethod.com | eNom, Inc. | 7 Sep 2010 | 21 Dec 2016 | 7 Sep 2017 |
| 196 | stepbystepparenting.com | Namesilo, LLC | 6 Jul 2019 | 9 Sep 2024 | 6 Jul 2024 |
| 197 | stepbystephelp.com | 1&1 Internet AG | 14 Nov 2023 | 14 Nov 2023 | 14 Nov 2024 |
| 198 | stepbystepaffiliatemarketingsystem.com | GoDaddy.com, LLC | 11 Apr 2010 | 11 Apr 2024 | 11 Apr 2025 |
| 199 | stepbystepmakingmoneyonline.com | GoDaddy.com, LLC | 22 Sep 2009 | 23 Sep 2023 | 22 Sep 2024 |
| 200 | stepbystepminisites.com | GoDaddy.com, LLC | 5 Apr 2012 | 15 Apr 2015 | 5 Apr 2016 |
| 201 | stepbysteprental.com | GoDaddy.com, LLC | 29 Jan 2009 | 30 Jan 2015 | 29 Jan 2016 |
| 202 | stepbystepsubtraction.com | GoDaddy.com, LLC | 30 Oct 2014 | 28 Oct 2016 | 30 Oct 2017 |
| 203 | stepbystepmultiplication.com | GoDaddy.com, LLC | 30 Oct 2014 | 28 Oct 2016 | 30 Oct 2017 |
| 204 | stepbystepfractions.com | GoDaddy.com, LLC | 30 Oct 2014 | 28 Oct 2016 | 30 Oct 2017 |
| 205 | stepbystepdivision.com | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2014 | 30 Oct 2015 |
| 206 | stepbystepalgebra.com | GoDaddy.com, LLC | 30 Oct 2014 | 28 Oct 2016 | 30 Oct 2017 |
| 207 | stepbystepaddition.com | GoDaddy.com, LLC | 30 Oct 2014 | 28 Oct 2016 | 30 Oct 2017 |
| 208 | stepbystep-dance.com | Cloud Yuqu LLC | 24 Mar 2021 | 24 Mar 2021 | 24 Mar 2022 |
| 209 | stepbystepapp.com | Google, Inc. | 27 May 2020 | 27 Jul 2024 | 27 May 2024 |
| 210 | stepbystepstair.com | Key-Systems GmbH | 9 Jan 2008 | 30 Aug 2022 | 9 Jan 2028 |
| 211 | stepbystepeducation.com | GoDaddy.com, LLC | 30 Oct 2014 | 2 Jun 2024 | 30 Oct 2024 |
| 212 | stepbysteped.com | GoDaddy.com, LLC | 30 Oct 2014 | 17 Dec 2021 | 30 Oct 2022 |
| 213 | stepbystepvideos.com | GoDaddy.com, LLC | 15 Jul 2002 | 17 Apr 2024 | 15 Jul 2025 |
| 214 | stepbystephomebuying.com | GoDaddy.com, LLC | 17 Aug 2022 | 18 Aug 2024 | 17 Aug 2025 |
| 215 | stepbystephomeselling.com | GoDaddy.com, LLC | 21 Sep 2010 | 11 Jul 2014 | 21 Sep 2015 |
| 216 | stepbystephomebusiness.com | GoDaddy.com, LLC | 31 Dec 2011 | 28 Nov 2014 | 31 Dec 2015 |
| 217 | stepbystepcashsecrets.com | - | 18 Aug 2012 | 18 Aug 2012 | 18 Aug 2017 |
| 218 | stepbystepmakeup.com | GoDaddy.com, LLC | 12 Apr 2006 | 10 Apr 2024 | 12 Apr 2025 |
| 219 | stepbystepsubtraction.org | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2017 | 30 Oct 2018 |
| 220 | stepbystepmultiplication.org | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2017 | 30 Oct 2018 |
| 221 | stepbysteped.org | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2017 | 30 Oct 2018 |
| 222 | stepbysteped.net | GoDaddy.com, LLC | 30 Oct 2014 | 28 Oct 2016 | 30 Oct 2017 |
| 223 | stepbystepdivision.org | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2017 | 30 Oct 2018 |
| 224 | stepbystepaddition.org | GoDaddy.com, LLC | 30 Oct 2014 | 30 Oct 2017 | 30 Oct 2018 |
| 225 | stepbystep-fundraising.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 21 Feb 2007 | 25 Jan 2017 | 21 Feb 2018 |
| 226 | stepbystepliving.org | GoDaddy.com, LLC | 14 Nov 2007 | 13 Sep 2022 | 14 Nov 2025 |
| 227 | stepbystepdeal.com | GoDaddy.com, LLC | 8 Aug 2011 | 27 Apr 2015 | 8 Aug 2015 |
| 228 | stepbystepdeals.com | GoDaddy.com, LLC | 8 Aug 2011 | 27 Apr 2015 | 8 Aug 2015 |
| 229 | stepbystepsafety.com | GoDaddy.com, LLC | 15 Sep 2020 | 15 Sep 2020 | 15 Sep 2021 |
| 230 | stepbystepdancecenter.com | eNom, Inc. | 30 May 2012 | 25 May 2017 | 30 May 2018 |
| 231 | stepbystepwordpresstutorial.com | - | - | - | - |
| 232 | stepbystepbusinesspath.com | eNom, Inc. | 11 Jun 2012 | 12 Jun 2015 | 11 Jun 2016 |
| 233 | stepbystep-uk.com | GMO Internet Inc. | 5 Sep 2015 | 29 Sep 2016 | 4 Sep 2017 |
| 234 | stepbystepwithliz.com | Google, Inc. | 30 Oct 2016 | 29 Nov 2017 | 30 Oct 2017 |
| 235 | stepbystep-photography.com | NameCheap, Inc. | 23 Mar 2022 | 23 Mar 2024 | 23 Mar 2025 |
| 236 | stepbystepusa.com | Network Solutions, LLC | 8 Jun 1999 | 9 Apr 2021 | 8 Jun 2026 |
| 237 | stepbysteppower.com | GoDaddy.com, LLC | 31 Jan 2020 | 31 Jan 2020 | 31 Jan 2021 |
| 238 | stepbysteplove.com | NameCheap, Inc. | 26 Oct 2021 | - | 26 Oct 2022 |
| 239 | stepbystepdivorce.com | GoDaddy.com, LLC | 11 Jun 2020 | 12 Jun 2024 | 11 Jun 2025 |
| 240 | stepbystepcupcakes.com | GoDaddy.com, LLC | 20 Jun 2016 | 20 Jun 2016 | 20 Jun 2017 |
| 241 | stepbysteptoday.com | GoDaddy.com, LLC | 14 Mar 2023 | 26 Mar 2024 | 14 Mar 2025 |
| 242 | stepbystep-programs.com | GoDaddy.com, LLC | 10 Jun 2013 | 11 Jun 2015 | 10 Jun 2016 |
| 243 | stepbystepvoetreflex.com | RegistryGate GmbH | 3 Nov 2014 | 4 Nov 2023 | 3 Nov 2024 |
| 244 | stepbystepvolvo.com | Omnis Network, LLC | 27 Oct 2007 | 1 Nov 2023 | 27 Oct 2024 |
| 245 | stepbystephr.com | NameCheap, Inc. | 26 Nov 2019 | 4 Nov 2023 | 26 Nov 2024 |
| 246 | stepbystepbarprep.net | GoDaddy.com, LLC | 13 Jun 2011 | 13 Jun 2015 | 13 Jun 2016 |
| 247 | stepbystepbarprep.com | GoDaddy.com, LLC | 13 Jun 2011 | 13 Jun 2015 | 13 Jun 2016 |
| 248 | stepbystepwithneil.com | GoDaddy.com, LLC | 12 Jun 2014 | 13 Jun 2015 | 12 Jun 2016 |
| 249 | stepbystepbarprep.org | GoDaddy.com, LLC | 13 Jun 2011 | 25 Jun 2015 | 13 Jun 2016 |
| 250 | stepbystepfitnesscenter.com | Interweb Advertising D.B.A. Profile Builder | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2015 |
| 251 | stepbystepwiththeresa.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 252 | stepbystepwithmel.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 253 | stepbystepwithrick.com | GoDaddy.com, LLC | 19 Jun 2014 | 20 Jun 2015 | 19 Jun 2016 |
| 254 | stepbystepwithmarilyn.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 255 | stepbystepcareer.com | GoDaddy.com, LLC | 13 Oct 2022 | 14 Oct 2023 | 13 Oct 2024 |
| 256 | stepbystepyoga.com | Key-Systems GmbH | 9 Nov 2022 | 23 Jan 2024 | 9 Nov 2023 |
| 257 | stepbystepprep.com | GoDaddy.com, LLC | 27 Sep 2018 | 22 Sep 2023 | 27 Sep 2024 |
| 258 | stepbysteptrademarks.com | TPP Wholesale Pty Ltd. | 19 Aug 2014 | 19 Jul 2017 | 19 Aug 2018 |
| 259 | stepbystepitsolutions.com | Launchpad, Inc. | 25 Jun 2015 | 10 Jun 2024 | 25 Jun 2025 |
| 260 | stepbystepstatistics.com | Key-Systems GmbH | 30 Jun 2019 | 29 Jun 2024 | 30 Jun 2025 |
| 261 | stepbystepfromhome.com | GoDaddy.com, LLC | 20 Aug 2014 | 21 Aug 2016 | 20 Aug 2018 |
| 262 | stepbystephairstyles.com | - | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2017 |
| 263 | stepbystephardwoodfloors.com | FastDomain Inc. | 6 Feb 2015 | 6 Feb 2017 | 6 Feb 2018 |
| 264 | stepbystepmusical.com | Network Solutions, LLC | 7 Nov 2014 | 22 Oct 2017 | 7 Nov 2019 |
| 265 | stepbysteplearningcenters.net | Tucows Domains Inc. | 22 Aug 2014 | 24 Jul 2024 | 22 Aug 2025 |
| 266 | stepbystep-edu.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Apr 2015 | 6 Mar 2024 | 14 Apr 2025 |
| 267 | stepbysteponlinemoneymakingsystem.com | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 9 Nov 2015 |
| 268 | stepbystepbusiness.biz | GoDaddy.com, LLC | 9 Nov 2014 | 9 Nov 2014 | 8 Nov 2015 |
| 269 | stepbysteptherapeutics.com | GoDaddy.com, LLC | 13 Aug 2014 | 12 Jul 2016 | 13 Aug 2018 |
| 270 | stepbystep00.com | register.com, Inc. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 271 | stepbystepconsulting.net | Google, Inc. | 4 Oct 2021 | 4 Oct 2021 | 4 Oct 2022 |
| 272 | stepbysteptours.com | Google, Inc. | 22 Dec 2022 | 30 May 2024 | 22 Dec 2024 |
| 273 | stepbystepwizards.com | GoDaddy.com, LLC | 10 Nov 2014 | 10 Nov 2014 | 10 Nov 2015 |
| 274 | stepbysteplearningllc.com | eNom, Inc. | 15 Aug 2014 | 15 Aug 2014 | 15 Aug 2015 |
| 275 | stepbysteptoursinc.com | Network Solutions, LLC | 15 Apr 2017 | 15 Apr 2017 | 15 Apr 2018 |
| 276 | stepbystepstandards.com | Wild West Domains, LLC | 29 Aug 2014 | 29 Aug 2014 | 29 Aug 2016 |
| 277 | stepbystepcashbuilder.com | Key-Systems GmbH | 12 Sep 2014 | 17 Oct 2016 | 12 Sep 2017 |
| 278 | stepbysteponline.com | TurnCommerce, Inc. DBA NameBright.com | 30 Aug 2014 | 24 Aug 2020 | 30 Aug 2025 |
| 279 | stepbystepfoundationlr.com | Tucows Domains Inc. | 28 Aug 2013 | 1 Sep 2014 | 28 Aug 2015 |
| 280 | stepbystepguides.us | Wild West Domains, LLC | 15 Sep 2014 | 15 Sep 2014 | 14 Sep 2015 |
| 281 | stepbystepweightloss.org | eNom, Inc. | 30 Nov 2016 | 1 Dec 2017 | 30 Nov 2018 |
| 282 | stepbysteploanprocessing.com | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2016 |
| 283 | stepbysteploanprocessing.net | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2016 |
| 284 | stepbystepimarketing.info | NameCheap, Inc. | 11 Dec 2016 | 29 Dec 2017 | 11 Dec 2018 |
| 285 | stepbystepschools.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Sep 2014 | 3 Sep 2019 | 2 Sep 2025 |
| 286 | stepbystepstartupmanual.com | eNom, Inc. | 15 Nov 2014 | 15 Nov 2014 | 15 Nov 2015 |
| 287 | stepbystephomes.com | Google, Inc. | 25 Aug 2023 | 11 Aug 2024 | 25 Aug 2025 |
| 288 | stepbystepmovers.com | Blue Razor Domains, LLC | 14 Oct 2022 | 20 Oct 2023 | 14 Oct 2028 |
| 289 | stepbysteploanprocessing.info | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2016 |
| 290 | stepbysteploanprocessing.org | GoDaddy.com, LLC | 16 Sep 2014 | 16 Sep 2014 | 16 Sep 2016 |
| 291 | stepbystep-k.net | GMO Internet Inc. | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 292 | stepbystepconvey.net | Crazy Domains FZ-LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2015 |
| 293 | stepbysteppc.com | GoDaddy.com, LLC | 3 Sep 2014 | 3 Sep 2014 | 3 Sep 2016 |
| 294 | stepbysteporgasm.com | eNom, Inc. | 16 Nov 2014 | 16 Nov 2014 | 16 Nov 2016 |
| 295 | stepbystepcoachingwithdenise.org | Tucows Domains Inc. | 13 Sep 2011 | 17 Sep 2014 | 13 Sep 2015 |
| 296 | stepbystepgalveston.net | GoDaddy.com, LLC | 17 Sep 2014 | 17 Sep 2014 | 17 Sep 2015 |
| 297 | stepbystepdiy.com | Network Solutions, LLC | 20 Jul 2024 | 20 Jul 2024 | 20 Jul 2025 |
| 298 | stepbystep01.com | register.com, Inc. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 299 | stepbystepux.com | NameCheap, Inc. | 28 Apr 2017 | 28 Apr 2017 | 28 Apr 2018 |
| 300 | stepbystepdinnerinajar.com | GoDaddy.com, LLC | 19 Sep 2014 | 14 Sep 2016 | 19 Sep 2017 |
| 301 | stepbystepplayground.com | LiquidNet Ltd. | 20 Sep 2014 | 13 Sep 2024 | 20 Sep 2025 |
| 302 | stepbystep-linedanse.com | eNom, Inc. | 7 Sep 2014 | 28 Aug 2017 | 7 Sep 2018 |
| 303 | stepbystepvt.com | eNom, Inc. | 19 Nov 2014 | 7 Nov 2023 | 19 Nov 2024 |
| 304 | stepbystepfooties.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 20 Nov 2014 | 20 Nov 2014 | 20 Nov 2015 |
| 305 | stepbystepcollegeadmission.com | DomainPeople, Inc. | 3 Oct 2014 | 28 Sep 2023 | 3 Oct 2024 |
| 306 | stepbystepdating.com | 1API GmbH | 8 Feb 2020 | 9 Jan 2024 | 8 Feb 2025 |
| 307 | stepbystepresults.info | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 308 | stepbystepforeclosure.com | Tucows Domains Inc. | 1 Oct 2009 | 5 Oct 2015 | 1 Oct 2016 |
| 309 | stepbysteplife.com | Domain.com, LLC | 28 Jun 2023 | 13 Jun 2024 | 28 Jun 2025 |
| 310 | stepbystepcc.org | Network Solutions, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 311 | stepbystepresults.org | GoDaddy.com, LLC | 22 Sep 2014 | 22 Sep 2014 | 22 Sep 2015 |
| 312 | stepbystepcash.info | NameCheap, Inc. | 5 Nov 2023 | 10 Nov 2023 | 5 Nov 2024 |
| 313 | stepbysteppro.com | GoDaddy.com, LLC | 3 Aug 2021 | 3 Aug 2024 | 3 Aug 2025 |
| 314 | stepbystephconsulting.com | - | 17 Dec 2022 | 18 Dec 2023 | 17 Dec 2024 |
| 315 | stepbystep2015.com | GMO Internet Inc. | 16 Dec 2019 | 6 Nov 2023 | 15 Dec 2024 |
| 316 | stepbysteplaunch.com | FastDomain Inc. | 10 Oct 2014 | 10 Oct 2014 | 10 Oct 2015 |
| 317 | stepbystepselling.com | Google, Inc. | 19 Feb 2020 | 18 Apr 2024 | 19 Feb 2025 |
| 318 | stepbystepwatercolour.com | Key-Systems GmbH | 27 Mar 2018 | 1 Apr 2024 | 27 Mar 2025 |
| 319 | stepbystepweddingsandevents.com | GoDaddy.com, LLC | 17 Oct 2014 | 17 Oct 2016 | 17 Oct 2018 |
| 320 | stepbystepdaynursery.com | Wix.com Ltd. | 5 Aug 2020 | 15 Oct 2023 | 5 Aug 2023 |
| 321 | stepbystepenglishschool.com | Tucows Domains Inc. | 25 Sep 2023 | 23 Apr 2024 | 25 Sep 2024 |
| 322 | stepbystepgh.com | Wild West Domains, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 323 | stepbystepquickbookstutorial.com | Domain.com, LLC | 15 Sep 2012 | 31 Aug 2023 | 15 Sep 2024 |
| 324 | stepbysteptheseries.com | Tucows Domains Inc. | 13 Oct 2014 | 17 Oct 2015 | 13 Oct 2016 |
| 325 | stepbystepblogging.com | GoDaddy.com, LLC | 6 Feb 2019 | 7 Feb 2024 | 6 Feb 2025 |
| 326 | stepbystepbusinessolutions.com | GoDaddy.com, LLC | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 327 | stepbystephairandbeauty.com | eNom, Inc. | 26 Nov 2014 | 26 Nov 2014 | 26 Nov 2016 |
| 328 | stepbystepacrosstheglobe.com | eNom, Inc. | 15 Oct 2014 | 5 Oct 2023 | 15 Oct 2024 |
| 329 | stepbystepdesigns-llc.com | Tucows Domains Inc. | 27 Nov 2014 | 1 Dec 2015 | 27 Nov 2016 |
| 330 | stepbystepmoda.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 331 | stepbystep-az.com | Domain.com, LLC | 28 Nov 2014 | 28 Nov 2014 | 28 Nov 2015 |
| 332 | stepbystepmontessori0122.com | enom421, Incorporated | 18 Feb 2024 | 30 Jul 2024 | 18 Feb 2025 |
| 333 | stepbystepmarketingplan.com | 1&1 Internet AG | 3 Dec 2014 | 3 Dec 2014 | 3 Dec 2015 |
| 334 | stepbystepcounselling.com | NameCheap, Inc. | 14 May 2015 | 14 Apr 2024 | 14 May 2025 |
| 335 | stepbystepremodel.net | eNom, Inc. | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 336 | stepbystepwithdavid.com | 1&1 Internet AG | 8 Dec 2014 | 9 Dec 2014 | 8 Dec 2015 |
| 337 | stepbystepthemes.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 338 | stepbysteptheme.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 339 | stepbystepsetups.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 340 | stepbystepsetup.com | Cosmotown, Inc. | 4 Aug 2023 | 5 Aug 2024 | 4 Aug 2025 |
| 341 | stepbystepplugin.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 342 | stepbystepnaturalhaircarestyling.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 343 | stepbystepsale.com | Wild West Domains, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 344 | stepbystepexit.com | GoDaddy.com, LLC | 25 Jun 2024 | 25 Jun 2024 | 25 Jun 2025 |
| 345 | stepbystepdaily.com | Tucows Domains Inc. | 15 May 2023 | 25 Jun 2024 | 15 May 2024 |
| 346 | stepbystepforeverything.com | GoDaddy.com, LLC | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 347 | stepbystepforanything.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2023 | 10 Dec 2024 |
| 348 | stepbystepeverything.com | GoDaddy.com, LLC | 10 Dec 2014 | 11 Dec 2023 | 10 Dec 2024 |
| 349 | stepbystepnaturalhairstylling.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 350 | stepbystepnsw.com | Crazy Domains FZ-LLC | 12 Dec 2014 | 12 Nov 2019 | 12 Dec 2024 |
| 351 | stepbystepphotocreations.com | Tucows Domains Inc. | 13 Dec 2014 | 17 Dec 2016 | 13 Dec 2016 |
| 352 | stepbystepwithcharles.com | GoDaddy.com, LLC | 15 Dec 2014 | 16 Dec 2014 | 15 Dec 2015 |
| 353 | stepbystepmarketingforwriters.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 354 | stepbysteptreks.com | GoDaddy.com, LLC | 18 Apr 2017 | 2 May 2024 | 18 Apr 2025 |
| 355 | stepbystepwithdebbie.com | NameJolt.com LLC | 20 Dec 2014 | 20 Dec 2014 | 20 Dec 2015 |
| 356 | stepbystepdigital.com | GoDaddy.com, LLC | 4 Jan 2024 | 4 Jan 2024 | 4 Jan 2025 |
| 357 | stepbystepplr.com | eNom, Inc. | 27 Mar 2016 | 27 Mar 2016 | 27 Mar 2017 |
| 358 | stepbystepauthenticlogodesign.com | GoDaddy.com, LLC | 27 Dec 2014 | 27 Dec 2014 | 27 Dec 2016 |
| 359 | stepbystepsex.com | GoDaddy.com, LLC | 4 Apr 2016 | 4 Apr 2016 | 4 Apr 2017 |
| 360 | stepbystepnaildesigns.com | GoDaddy.com, LLC | 30 Dec 2014 | 30 Dec 2014 | 30 Dec 2015 |
| 361 | stepbystepelc.com | HiChina Zhicheng Technology Limited | 27 Mar 2018 | 27 Mar 2018 | 27 Mar 2019 |
| 362 | stepbystepchrist.com | Launchpad, Inc. | 31 Dec 2014 | 31 Dec 2014 | 31 Dec 2015 |
| 363 | stepbystepwithdave.net | GoDaddy.com, LLC | 3 Jan 2015 | 3 Jan 2015 | 3 Jan 2016 |
| 364 | stepbystepinc.xyz | Network Solutions, LLC | 19 Jul 2014 | 21 Jul 2014 | 19 Jul 2015 |
| 365 | stepbystepnews.xyz | Network Solutions, LLC | 25 Jun 2014 | 26 Jun 2014 | 25 Jun 2015 |
| 366 | stepbystepmontessori.xyz | Network Solutions, LLC | 15 Jun 2014 | 16 Jun 2014 | 15 Jun 2015 |
| 367 | stepbysteph.xyz | Network Solutions, LLC | 22 Jun 2014 | 24 Jun 2014 | 22 Jun 2015 |
| 368 | stepbystepchildren.xyz | Network Solutions, LLC | 24 Jun 2014 | 26 Jun 2014 | 24 Jun 2015 |
| 369 | stepbystep1childatatime.xyz | Network Solutions, LLC | 18 Jun 2014 | 19 Jun 2014 | 18 Jun 2015 |
| 370 | stepbystepformula.net | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2016 |
| 371 | stepbystepcentre.com | Network Solutions, LLC | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2018 |
| 372 | stepbystepdaily.tips | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 9 Dec 2015 |
| 373 | stepbystepdaily.club | GoDaddy.com, LLC | 9 Dec 2014 | 9 Dec 2014 | 8 Dec 2015 |
| 374 | stepbysteppediatricscolorado.com | GoDaddy.com, LLC | 12 Aug 2015 | 12 Aug 2015 | 12 Aug 2017 |
| 375 | stepbystepreflexology.com | Name.com, Inc. | 13 Aug 2015 | 20 Jul 2024 | 13 Aug 2025 |
| 376 | stepbystephsd.com | GoDaddy.com, LLC | 14 Aug 2015 | 14 Aug 2015 | 14 Aug 2016 |
| 377 | stepbystephanie.com | Cronon AG | 7 Jan 2015 | 7 Jan 2015 | 6 Jan 2018 |
| 378 | stepbystepcleft.com | GoDaddy.com, LLC | 6 Jan 2015 | 6 Jan 2015 | 6 Jan 2016 |
| 379 | stepbystepwithcliff.com | GoDaddy.com, LLC | 9 Jan 2015 | 9 Jan 2015 | 9 Jan 2016 |
| 380 | stepbystepmarketer.com | eNom, Inc. | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 381 | stepbystepoutdoorclassroom.com | GoDaddy.com, LLC | 11 Jan 2015 | 11 Jan 2015 | 11 Jan 2016 |
| 382 | stepbystepsqueezepages.com | eNom, Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 383 | stepbystepsoc.com | GoDaddy.com, LLC | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2017 |
| 384 | stepbystepimmigration.com | Domain.com, LLC | 29 Jan 2012 | 14 Jan 2017 | 29 Jan 2018 |
| 385 | stepbysteplifecenter.life | GoDaddy.com, LLC | 1 Jul 2015 | 11 Jul 2017 | 1 Jul 2018 |
| 386 | stepbystepweightloss.science | Alpnames Limited | 6 Jul 2015 | - | 5 Jul 2016 |
| 387 | stepbystepsolution.com | GoDaddy.com, LLC | 15 Aug 2015 | 16 Aug 2024 | 15 Aug 2025 |
| 388 | stepbystepparentingconsultants.com | GoDaddy.com, LLC | 18 Jan 2015 | 12 Jun 2023 | 18 Jan 2025 |
| 389 | stepbystepwatercolor.com | DropCatch.com 1487 LLC | 19 Jul 2019 | 6 Jul 2024 | 19 Jul 2025 |
| 390 | stepbystepguidetomakingmoneyonline.com | eNom, Inc. | 24 Apr 2016 | 24 Apr 2016 | 24 Apr 2017 |
| 391 | stepbystepaplayschool.com | Key-Systems GmbH | 5 May 2023 | 18 Jul 2024 | 5 May 2024 |
| 392 | stepbystepussa.com | - | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2017 |
| 393 | stepbystepproperty.com | NetRegistry Pty Ltd. | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 394 | stepbystepaffiliatemarketingcourse.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2024 | 18 Aug 2025 |
| 395 | stepbystepwoodworking.com | NameCheap, Inc. | 22 Sep 2019 | 23 Aug 2023 | 22 Sep 2024 |
| 396 | stepbystepwoodprojects.com | GoDaddy.com, LLC | 21 Jan 2015 | 21 Jan 2015 | 21 Jan 2016 |
| 397 | stepbystepwriter.com | Namesilo, LLC | 14 May 2021 | 17 Jun 2023 | 14 May 2023 |
| 398 | stepbystepforlife.com | Porkbun, LLC | 27 Nov 2021 | 27 Nov 2021 | 27 Nov 2022 |
| 399 | stepbystepislam.com | GoDaddy.com, LLC | 26 Apr 2020 | 8 May 2024 | 26 Apr 2025 |
| 400 | stepbystephosting.com | Google, Inc. | 25 May 2022 | 26 May 2023 | 25 May 2024 |
| 401 | stepbystepsystems.com | NameCheap, Inc. | 21 Sep 2018 | 22 Aug 2023 | 21 Sep 2024 |
| 402 | stepbystepsoft.com | eNom, Inc. | 28 Jan 2015 | 28 Jan 2015 | 28 Jan 2016 |
| 403 | stepbysteppictures.com | Name.com, Inc. | 28 Jan 2015 | 6 Jan 2024 | 28 Jan 2025 |
| 404 | stepbystepmortgagesolutions.com | Tucows Domains Inc. | 28 Jan 2015 | 29 Dec 2016 | 28 Jan 2018 |
| 405 | stepbysteptochange.com | Uniregistrar Corp | - | - | - |
| 406 | stepbystepmethod.info | NameCheap, Inc. | 19 Aug 2015 | 19 Aug 2015 | 19 Aug 2016 |
| 407 | stepbystepsucess.com | 1&1 Internet AG | 3 Feb 2015 | 3 Feb 2015 | 3 Feb 2016 |
| 408 | stepbystepdetox.com | NameCheap, Inc. | 26 Jun 2018 | 26 Jun 2018 | 26 Jun 2019 |
| 409 | stepbystepdansskola.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 5 Feb 2015 | 3 Jan 2024 | 5 Feb 2025 |
| 410 | stepbystepcourse.com | 1&1 Internet AG | 29 Apr 2021 | 11 Jul 2024 | 29 Apr 2024 |
| 411 | stepbystepeasytech.com | GoDaddy.com, LLC | 13 Feb 2015 | 13 Feb 2015 | 13 Feb 2017 |
| 412 | stepbystephowtocrochet.com | eNom, Inc. | 15 Feb 2015 | 15 Feb 2015 | 15 Feb 2016 |
| 413 | stepbystepcoaching.net | Network Solutions, LLC | 24 Dec 2023 | 5 Jan 2024 | 24 Dec 2024 |
| 414 | stepbystepsalon.com | Dynadot15 LLC | 28 Apr 2024 | 29 Apr 2024 | 28 Apr 2025 |
| 415 | stepbystepcreditfix.com | NameCheap, Inc. | 17 Nov 2017 | 28 Jan 2024 | 17 Nov 2023 |
| 416 | stepbystepreggio.com | Tucows Domains Inc. | 13 Feb 2008 | 17 Feb 2015 | 13 Feb 2016 |
| 417 | stepbystepseniorsolutions.com | GoDaddy.com, LLC | 17 Feb 2015 | 18 Feb 2024 | 17 Feb 2025 |
| 418 | stepbystepaz.com | GoDaddy.com, LLC | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 419 | stepbysteprealestate.org | GoDaddy.com, LLC | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 420 | stepbysteprealestate.net | GoDaddy.com, LLC | 16 Feb 2015 | 16 Feb 2015 | 16 Feb 2016 |
| 421 | stepbystepearning.com | NameCheap, Inc. | 17 Aug 2023 | 18 Jul 2024 | 17 Aug 2025 |
| 422 | stepbystepcourse.org | Tucows Domains Inc. | 18 Feb 2015 | 18 Feb 2015 | 18 Feb 2016 |
| 423 | stepbystepeasywoodworkingprojects.com | Tucows Domains Inc. | 20 Feb 2012 | 24 Feb 2015 | 20 Feb 2016 |
| 424 | stepbystepeprep.com | FastDomain Inc. | 22 Aug 2015 | 22 Aug 2015 | 22 Aug 2016 |
| 425 | stepbysteppreschool.com | GoDaddy.com, LLC | 19 Jun 2016 | 20 Jun 2023 | 19 Jun 2025 |
| 426 | stepbysteplifecoach.com | Tucows Domains Inc. | 21 Jan 2020 | 25 Jan 2022 | 21 Jan 2022 |
| 427 | stepbysteph.info | Network Solutions, LLC | 23 Feb 2015 | 21 Feb 2017 | 23 Feb 2018 |
| 428 | stepbysteplifecoach.org | GoDaddy.com, LLC | 25 Feb 2015 | 2 Mar 2017 | 25 Feb 2018 |
| 429 | stepbystepcenter.org | GoDaddy.com, LLC | 25 Feb 2015 | 2 Mar 2017 | 25 Feb 2018 |
| 430 | stepbystepwealthplan.com | GoDaddy.com, LLC | 2 Mar 2015 | 2 Mar 2015 | 2 Mar 2016 |
| 431 | stepbystepmarketingplans.com | GoDaddy.com, LLC | 23 Aug 2015 | 23 Aug 2015 | 23 Aug 2020 |
| 432 | stepbystepdates.com | eNom, Inc. | 3 Mar 2015 | 31 Jan 2016 | 3 Mar 2018 |
| 433 | stepbystephousebuilding.com | eNom, Inc. | 6 Mar 2015 | 12 Mar 2017 | 6 Mar 2018 |
| 434 | stepbystepfood.com | GoDaddy.com, LLC | 10 Mar 2015 | 11 Mar 2024 | 10 Mar 2025 |
| 435 | stepbystepfbads.com | GoDaddy.com, LLC | 10 Mar 2015 | 10 Mar 2015 | 10 Mar 2016 |
| 436 | stepbysteptx.com | GoDaddy.com, LLC | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 437 | stepbysteporganicfarm.com | Domain.com, LLC | 11 Mar 2015 | 24 Feb 2024 | 11 Mar 2025 |
| 438 | stepbysteponlineincome.com | GoDaddy.com, LLC | 12 Mar 2015 | 12 Mar 2015 | 12 Mar 2016 |
| 439 | stepbysteparabic.com | Automattic Inc. | 16 May 2023 | 26 Apr 2024 | 16 May 2025 |
| 440 | stepbystepwithmike.com | Wild West Domains, LLC | 25 Aug 2015 | 25 Aug 2015 | 25 Aug 2016 |
| 441 | stepbystepbuildingltd.com | Mesh Digital Limited | 21 Jul 2014 | 26 Jul 2015 | 21 Jul 2016 |
| 442 | stepbysteptofreedom.com | GoDaddy.com, LLC | 3 Jul 2024 | 3 Jul 2024 | 3 Jul 2025 |
| 443 | stepbystepwellness.com | Hostinger, UAB | 21 Oct 2023 | 21 Dec 2023 | 21 Oct 2024 |
| 444 | stepbystepstrawbalehome.com | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 445 | stepbysteprelocations.com | TPP Wholesale Pty Ltd. | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 446 | stepbystephairvideos.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 16 Mar 2012 | 25 Mar 2015 | 16 Mar 2016 |
| 447 | stepbystephairdvds.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 16 Mar 2012 | 25 Mar 2015 | 16 Mar 2016 |
| 448 | stepbystepstrawbalehome.org | GoDaddy.com, LLC | 24 Mar 2015 | 1 Feb 2017 | 24 Mar 2018 |
| 449 | stepbystepstrawbalehome.net | GoDaddy.com, LLC | 24 Mar 2015 | 24 Mar 2015 | 24 Mar 2016 |
| 450 | stepbystepstrawbalehome.info | GoDaddy.com, LLC | 24 Mar 2015 | 1 Feb 2017 | 24 Mar 2018 |
| 451 | stepbystepwanderer.com | FastDomain Inc. | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2016 |
| 452 | stepbystepoestc.com | Network Solutions, LLC | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 453 | stepbystep-success.com | Cronon AG | 16 Oct 2023 | 5 Dec 2023 | 16 Oct 2024 |
| 454 | stepbystepcrew.org | - | 23 Mar 2012 | 23 Mar 2012 | 23 Mar 2017 |
| 455 | stepbysteptestprep.com | Tucows Domains Inc. | 26 Mar 2012 | 30 Mar 2015 | 26 Mar 2016 |
| 456 | stepbystepinternetmarketing.com | CloudFlare, Inc. | 29 Mar 2015 | 16 Mar 2024 | 29 Mar 2025 |
| 457 | stepbystepguru.com | GoDaddy.com, LLC | 19 Apr 2019 | 19 Apr 2019 | 19 Apr 2021 |
| 458 | stepbystep-linedance.com | Trunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c… | 24 Feb 2023 | 3 Mar 2024 | 24 Feb 2024 |
| 459 | stepbystep2u.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 Mar 2015 | 5 Mar 2017 | 31 Mar 2018 |
| 460 | stepbystepconsult.com | GoDaddy.com, LLC | 11 Aug 2024 | 11 Aug 2024 | 11 Aug 2025 |
| 461 | stepbystepsuccesssystem.com | Beijing Lanhai Jiye Technology Co., Ltd | 14 Oct 2023 | 25 Mar 2024 | 14 Oct 2024 |
| 462 | stepbystepenglish.org | Network Solutions, LLC | 2 Apr 2015 | 2 Apr 2015 | 2 Apr 2016 |
| 463 | stepbystepnj.net | Tucows Domains Inc. | 31 Mar 2014 | 4 Apr 2015 | 31 Mar 2016 |
| 464 | stepbystepinvestor.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 465 | stepbystepgalveston.com | GoDaddy.com, LLC | 31 Aug 2015 | 31 Aug 2015 | 31 Aug 2016 |
| 466 | stepbystepdropshipping.com | Tucows Domains Inc. | 25 Jun 2024 | 25 Jun 2024 | 25 Jun 2025 |
| 467 | stepbystepbuilding.com | GoDaddy.com, LLC | 8 May 2019 | 8 May 2019 | 8 May 2020 |
| 468 | stepbystepitaly.com | - | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2017 |
| 469 | stepbystephope.org | GoDaddy.com, LLC | 6 Mar 2017 | 6 May 2017 | 6 Mar 2020 |
| 470 | stepbystepcoder.com | DropCatch.com 966 LLC | 19 Nov 2019 | 19 Nov 2019 | 19 Nov 2020 |
| 471 | stepbysteponlineguide.com | - | - | - | - |
| 472 | stepbysteptech.net | Tucows Domains Inc. | 15 Sep 2023 | 15 Sep 2023 | 15 Sep 2024 |
| 473 | stepbystepstudios.net | eNom, Inc. | 11 Apr 2015 | 11 Apr 2015 | 11 Apr 2016 |
| 474 | stepbysteptonursing.com | GoDaddy.com, LLC | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 475 | stepbystepfargo.com | GoDaddy.com, LLC | 17 Apr 2015 | 17 Apr 2015 | 17 Apr 2017 |
| 476 | stepbystepchildcarecenter.com | Google, Inc. | 28 Nov 2022 | 29 Nov 2023 | 28 Nov 2024 |
| 477 | stepbystepradio.com | GoDaddy.com, LLC | 20 Apr 2015 | 1 May 2024 | 20 Apr 2025 |
| 478 | stepbystepidea.com | Register.it SPA | 24 Sep 2019 | 31 Jul 2024 | 8 Apr 2026 |
| 479 | stepbystepfinancial.com | GoDaddy.com, LLC | 6 Sep 2015 | 7 Sep 2023 | 6 Sep 2025 |
| 480 | stepbystepchoinja.com | Gabia, Inc. | 24 Apr 2015 | 24 Apr 2017 | 24 Apr 2018 |
| 481 | stepbystepca.com | Tucows Domains Inc. | 4 Sep 2009 | 15 Nov 2023 | 4 Sep 2023 |
| 482 | stepbystepdecals.com | eNom, Inc. | 26 Apr 2015 | 26 Apr 2015 | 26 Apr 2018 |
| 483 | stepbystepinvesting.com | Dynadot, LLC | 21 Sep 2022 | 10 Mar 2024 | 21 Sep 2024 |
| 484 | stepbystepproject.com | Domain.com, LLC | 6 Nov 2021 | 22 Oct 2023 | 6 Nov 2024 |
| 485 | stepbystepedpartners.com | GoDaddy.com, LLC | 8 Sep 2015 | 9 Sep 2023 | 8 Sep 2025 |
| 486 | stepbystepfm.com | GoDaddy.com, LLC | 1 May 2015 | 1 May 2015 | 1 May 2017 |
| 487 | stepbystephomeimprovement.com | GoDaddy.com, LLC | 5 Jun 2024 | 6 Jun 2024 | 5 Jun 2025 |
| 488 | stepbystephens.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 May 2015 | 5 May 2015 | 5 May 2016 |
| 489 | stepbystepdaycare.biz | Key-Systems GmbH | 26 Jul 2016 | 9 Sep 2024 | 25 Jul 2025 |
| 490 | stepbystepwpwebsites.com | eNom, Inc. | 7 May 2015 | 19 Jun 2017 | 7 May 2017 |
| 491 | stepbystepreport.com | register.com, Inc. | 10 Jan 2023 | 24 Mar 2024 | 10 Jan 2024 |
| 492 | stepbystepbg.net | register.com, Inc. | 10 Sep 2015 | 24 Aug 2017 | 10 Sep 2018 |
| 493 | stepbysteppty.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 494 | stepbystepinternethelp.com | GMO Internet Inc. | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 495 | stepbystep-consulting.com | 1&1 Internet AG | 30 Jun 2021 | 10 Jul 2023 | 30 Jun 2024 |
| 496 | stepbystepscience.com | Wild West Domains, LLC | 18 May 2015 | 18 Apr 2024 | 18 May 2025 |
| 497 | stepbysteptips.com | NameCheap, Inc. | 29 Jun 2023 | 30 Jun 2024 | 29 Jun 2025 |
| 498 | stepbystepwithvalerie.com | 1&1 Internet AG | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 499 | stepbystepwithlinda.com | 1&1 Internet AG | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 500 | stepbystepintoconsulting.com | united-domains AG | 21 May 2015 | 17 Aug 2024 | 21 May 2025 |
| 501 | stepbysteptech.org | Wild West Domains, LLC | 29 Aug 2022 | 30 Aug 2024 | 29 Aug 2025 |
| 502 | stepbysteppers.com | register.com, Inc. | 23 May 2015 | 23 May 2015 | 23 May 2016 |
| 503 | stepbystepper.com | register.com, Inc. | 23 May 2015 | 19 Feb 2024 | 23 May 2025 |
| 504 | stepbystepdownsizing.com | FastDomain Inc. | 25 May 2015 | 25 May 2024 | 25 May 2027 |
| 505 | stepbystepstore.com | GoDaddy.com, LLC | 18 Dec 2023 | 18 Dec 2023 | 18 Dec 2026 |
| 506 | stepbystepmanuals.com | GoDaddy.com, LLC | 14 Sep 2015 | 14 Sep 2015 | 14 Sep 2016 |
| 507 | stepbysteprecipes.com | Annulet LLC | 31 Dec 2018 | 17 Feb 2024 | 31 Dec 2024 |
| 508 | stepbystepaustralia.com | Tucows Domains Inc. | 28 May 2015 | 17 May 2017 | 28 May 2018 |
| 509 | stepbystepchildrenshouse.com | GoDaddy.com, LLC | 22 Apr 2019 | 22 Apr 2019 | 22 Apr 2020 |
| 510 | stepbystep-encamino.com | GoDaddy.com, LLC | 1 Jun 2015 | 2 Jun 2024 | 1 Jun 2025 |
| 511 | stepbysteptutorial.net | GoDaddy.com, LLC | 31 May 2015 | 31 May 2015 | 31 May 2016 |
| 512 | stepbystepsuccessllc.com | Tucows Domains Inc. | 3 Jun 2015 | 5 May 2017 | 3 Jun 2018 |
| 513 | stepbystepsuccessllc.biz | Tucows Domains Inc. | 3 Jun 2015 | 6 Jun 2018 | 2 Jun 2018 |
| 514 | stepbystepss.biz | GoDaddy.com, LLC | 3 Jun 2015 | 12 Aug 2016 | 2 Jun 2018 |
| 515 | stepbystepseniorsolutions.biz | GoDaddy.com, LLC | 3 Jun 2015 | 12 Aug 2016 | 2 Jun 2018 |
| 516 | stepbystephobby.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 Oct 2022 | 9 Nov 2023 | 31 Oct 2024 |
| 517 | stepbystepcooks.com | DreamHost, LLC | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 518 | stepbystepsuccessllc.info | Tucows Domains Inc. | 3 Jun 2015 | 7 Jun 2018 | 3 Jun 2019 |
| 519 | stepbystepseniorsolutions.info | GoDaddy.com, LLC | 3 Jun 2015 | 19 Jan 2016 | 3 Jun 2018 |
| 520 | stepbystepss.net | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 521 | stepbystepss.mobi | GoDaddy.com, LLC | 3 Jun 2015 | 19 Jan 2016 | 3 Jun 2018 |
| 522 | stepbystepseniorsolutions.org | GoDaddy.com, LLC | 3 Jun 2015 | 19 Jan 2016 | 3 Jun 2018 |
| 523 | stepbystepseniorsolutions.net | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 524 | stepbysteplarning.info | Dinahosting s.l. | 4 Jun 2015 | 4 Jun 2015 | 4 Jun 2016 |
| 525 | stepbystepbookkeeping.com | Google, Inc. | 10 Sep 2020 | 26 Aug 2024 | 10 Sep 2025 |
| 526 | stepbystepservices.us | Tucows Domains Inc. | 3 Jun 2014 | 6 Jun 2015 | 2 Jun 2015 |
| 527 | stepbystepwithjoe.com | eNom, Inc. | 11 Jul 2022 | 11 Jul 2022 | 11 Jul 2023 |
| 528 | stepbystep-unique.com | GMO Internet Inc. | 13 Jun 2015 | 14 May 2017 | 13 Jun 2018 |
| 529 | stepbystepmath.net | GoDaddy.com, LLC | 12 Jun 2015 | 12 Jun 2015 | 12 Jun 2016 |
| 530 | stepbystepreef.com | eNom, Inc. | 18 Sep 2015 | 18 Sep 2015 | 18 Sep 2016 |
| 531 | stepbystepwithjeremy.com | GoDaddy.com, LLC | 16 Jun 2015 | 16 Jun 2015 | 16 Jun 2016 |
| 532 | stepbystepforkids.com | Google, Inc. | 2 Mar 2022 | 3 Mar 2024 | 2 Mar 2025 |
| 533 | stepbysteplakes.com | GoDaddy.com, LLC | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2017 |
| 534 | stepbystepkids.com | TurnCommerce, Inc. DBA NameBright.com | 22 Jun 2015 | 16 Jun 2020 | 22 Jun 2024 |
| 535 | stepbystepcook.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 22 Jun 2015 | 22 Jun 2015 | 22 Jun 2016 |
| 536 | stepbystepwithcher.com | 1&1 Internet AG | 25 Jun 2015 | 26 Jun 2015 | 25 Jun 2016 |
| 537 | stepbystepwithannette.com | 1&1 Internet AG | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 538 | stepbystepbeauty.com | GoDaddy.com, LLC | 13 Mar 2021 | 14 Mar 2024 | 13 Mar 2025 |
| 539 | stepbystepconsulting.org | NameCheap, Inc. | 18 Jan 2017 | 20 Dec 2017 | 18 Jan 2019 |
| 540 | stepbystepreich.com | Wild West Domains, LLC | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2016 |
| 541 | stepbystepnow.com | - | 4 Apr 2024 | 4 Apr 2024 | 4 Apr 2025 |
| 542 | stepbystepaffiliateinfofree.com | Tucows Domains Inc. | 30 Jun 2015 | 30 Jun 2015 | 30 Jun 2017 |
| 543 | stepbysteplearningcenterfern.net | Tucows Domains Inc. | 20 Sep 2010 | 24 Sep 2015 | 20 Sep 2016 |
| 544 | stepbystep5k.com | Tucows Domains Inc. | 23 Sep 2015 | 27 Sep 2018 | 23 Sep 2018 |
| 545 | stepbysteptransitionslifecoach.com | GoDaddy.com, LLC | 3 Jul 2015 | 3 Jul 2023 | 3 Jul 2025 |
| 546 | stepbystepntarinkon.com | Wild West Domains, LLC | 3 Jul 2015 | 3 Jul 2015 | 3 Jul 2016 |
| 547 | stepbystep-bg.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Jul 2015 | 24 Jun 2024 | 2 Jul 2025 |
| 548 | stepbystepmm.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Jul 2015 | 4 Jul 2017 | 3 Jul 2018 |
| 549 | stepbystephousing.com | Webfusion Ltd. | 24 Sep 2015 | 17 Sep 2023 | 24 Sep 2024 |
| 550 | stepbystephomesales.com | GoDaddy.com, LLC | 1 Jun 2018 | 12 Jul 2023 | 1 Jun 2023 |
| 551 | stepbystepnailart.com | GoDaddy.com, LLC | 4 Jul 2015 | 4 Jul 2015 | 4 Jul 2016 |
| 552 | stepbystepmoney.info | GoDaddy.com, LLC | 5 Jul 2015 | - | 5 Jul 2016 |
| 553 | stepbystepjiujitsusystem.com | Tucows Domains Inc. | 7 Jul 2015 | 11 Jul 2017 | 7 Jul 2017 |
| 554 | stepbystepjiujitsu.com | Tucows Domains Inc. | 7 Jul 2015 | 11 Jul 2019 | 7 Jul 2019 |
| 555 | stepbystepbjj.com | Tucows Domains Inc. | 7 Jul 2015 | 11 Jul 2019 | 7 Jul 2019 |
| 556 | stepbystepfranchiseconsulting.biz | GoDaddy.com, LLC | 8 Jul 2015 | 8 Jul 2015 | 7 Jul 2016 |
| 557 | stepbystepfranchisegroup.com | - | - | - | - |
| 558 | stepbystepfranchiseconsulting.com | GoDaddy.com, LLC | 8 Jul 2015 | 11 Jun 2024 | 8 Jul 2027 |
| 559 | stepbystepwithkaren.com | GoDaddy.com, LLC | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 560 | stepbystepmillionaire.com | GoDaddy.com, LLC | 24 Aug 2020 | 24 Aug 2020 | 24 Aug 2022 |
| 561 | stepbystepwithgeorgia.com | GoDaddy.com, LLC | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 562 | stepbystepfranchiseconsulting.us | NameCheap, Inc. | 23 Apr 2018 | 1 Apr 2019 | 23 Apr 2020 |
| 563 | stepbystepfranchiseconsulting.org | GoDaddy.com, LLC | 8 Jul 2015 | 8 Jul 2015 | 8 Jul 2016 |
| 564 | stepbystepfranchiseconsulting.net | GoDaddy.com, LLC | 8 Jul 2015 | 7 Jun 2018 | 8 Jul 2019 |
| 565 | stepbystepfranchiseconsulting.info | GoDaddy.com, LLC | 8 Jul 2015 | - | 8 Jul 2016 |
| 566 | stepbystep-ebooks.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 11 Jul 2015 | 11 Jul 2015 | 11 Jul 2016 |
| 567 | stepbystepgrants.com | GoDaddy.com, LLC | 27 Sep 2015 | 27 Sep 2023 | 27 Sep 2024 |
| 568 | stepbystepcontractsandgrants.com | GoDaddy.com, LLC | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 569 | stepbystepcontracting.com | GoDaddy.com, LLC | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 570 | stepbystepwithtj.com | GoDaddy.com, LLC | 14 Jul 2015 | 14 Jul 2015 | 14 Jul 2016 |
| 571 | stepbystepdallas.com | GoDaddy.com, LLC | 14 Jul 2015 | 14 Jul 2015 | 14 Jul 2016 |
| 572 | stepbystepguideforidiots.com | GoDaddy.com, LLC | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2016 |
| 573 | stepbysteptofitness.com | GoDaddy.com, LLC | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2017 |
| 574 | stepbystepwithhoward.com | GoDaddy.com, LLC | 17 Jul 2015 | 17 Jul 2015 | 17 Jul 2016 |
| 575 | stepbystephen.com | GoDaddy.com, LLC | 17 Jul 2015 | 17 Jul 2015 | 17 Jul 2016 |
| 576 | stepbystepsuccessonline.com | eNom, Inc. | 18 Jul 2015 | 18 Jan 2017 | 18 Jul 2018 |
| 577 | stepbystepvegan.com | 1&1 Internet AG | 20 Jul 2015 | 20 Jul 2015 | 20 Jul 2016 |
| 578 | stepbystephealthyliving.com | GoDaddy.com, LLC | 20 Jul 2015 | 31 Oct 2022 | 20 Jul 2025 |
| 579 | stepbystepwoodworking.info | NameCheap, Inc. | 28 Sep 2015 | 28 Sep 2015 | 28 Sep 2016 |
| 580 | stepbystepbusinessmodels.com | GoDaddy.com, LLC | 23 Jul 2015 | 4 Jun 2024 | 23 Jul 2025 |
| 581 | stepbystepbusinessmodels.info | GoDaddy.com, LLC | 23 Jul 2015 | - | 23 Jul 2016 |
| 582 | stepbystepeducationaldaycare.com | - | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2017 |
| 583 | stepbystepbusinessmodels.org | GoDaddy.com, LLC | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 584 | stepbystepbusinessmodels.net | GoDaddy.com, LLC | 23 Jul 2015 | 23 Jul 2015 | 23 Jul 2016 |
| 585 | stepbystepvisa.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 26 Jul 2015 | 26 Jul 2015 | 26 Jul 2016 |
| 586 | stepbysteptodating.com | Realtime Register B.V. | 26 Jul 2015 | 26 Jul 2017 | 26 Jul 2017 |
| 587 | stepbysteponlinemarketing.com | DropCatch.com 1007 LLC | 14 Oct 2016 | 15 Oct 2017 | 14 Oct 2018 |
| 588 | stepbystepmortgage.com | GoDaddy.com, LLC | 27 Jul 2015 | 28 Jul 2024 | 27 Jul 2025 |
| 589 | stepbystep10k.com | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 590 | stepbysteptv.net | GoDaddy.com, LLC | 27 Jul 2015 | 27 Jul 2015 | 27 Jul 2016 |
| 591 | stepbystepsongwriting.com | GoDaddy.com, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 592 | stepbystepkidsdaycare.com | register.com, Inc. | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2016 |
| 593 | stepbysteplab.com | Wild West Domains, LLC | 1 Oct 2015 | 1 Oct 2015 | 1 Oct 2016 |
| 594 | stepbystepoutreach.org | Domain.com, LLC | 28 Aug 2006 | 31 Aug 2024 | 28 Aug 2025 |
| 595 | stepbystepped.com | eNom, Inc. | 30 Jul 2015 | 4 Jul 2017 | 30 Jul 2018 |
| 596 | stepbystep-sibshop.com | GoDaddy.com, LLC | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2017 |
| 597 | stepbystepwoodworkingplans.com | GoDaddy.com, LLC | 1 Feb 2019 | 1 Feb 2019 | 1 Feb 2020 |
| 598 | stepbystepguy.com | GoDaddy.com, LLC | 1 Aug 2015 | 1 Aug 2015 | 1 Aug 2016 |
| 599 | stepbystepmlmsuccess.com | 1&1 Internet AG | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 600 | stepbystepsudoku.com | GoDaddy.com, LLC | 17 Feb 2016 | 18 Feb 2024 | 17 Feb 2025 |
| 601 | stepbystepweb.net | NameCheap, Inc. | 12 Dec 2018 | 12 Dec 2018 | 12 Dec 2019 |
| 602 | stepbystepeducationservinc.com | Name.com, Inc. | 5 Sep 2019 | 5 Sep 2019 | 5 Sep 2020 |
| 603 | stepbystepwordpress.com | Namesilo, LLC | 26 Aug 2020 | 27 Aug 2020 | 26 Aug 2021 |
| 604 | stepbystepmum.com | 1&1 Internet AG | 9 Jul 2020 | 10 Jul 2024 | 9 Jul 2025 |
| 605 | stepbysteplexington.com | GoDaddy.com, LLC | 6 Aug 2015 | 6 Aug 2015 | 6 Aug 2016 |
| 606 | stepbysteptogrowyourbusiness.com | GoDaddy.com, LLC | 8 Aug 2015 | 8 Aug 2015 | 8 Aug 2016 |
| 607 | stepbystepaffiliatemarketing.com | GoDaddy.com, LLC | 12 Apr 2022 | 24 May 2024 | 12 Apr 2024 |
| 608 | stepbystep-tc.com | GoDaddy.com, LLC | 10 Aug 2015 | 11 Aug 2024 | 10 Aug 2025 |
| 609 | stepbystepspeechwriting.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2017 |
| 610 | stepbystepspeeches.com | GoDaddy.com, LLC | 7 Oct 2015 | 7 Oct 2015 | 7 Oct 2017 |
| 611 | stepbystephomesolutions.com | GoDaddy.com, LLC | 8 Oct 2015 | 8 Oct 2015 | 8 Oct 2016 |
| 612 | stepbysteppainrelief.com | Launchpad, Inc. | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 613 | stepbystepnewsletter.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Oct 2015 | 13 Oct 2015 | 13 Oct 2016 |
| 614 | stepbystepaffiliatemarketingforbeginners.com | eNom, Inc. | 29 Jan 2018 | 29 Jan 2018 | 29 Jan 2019 |
| 615 | stepbystepwaytofindagoodguyandkeephim.com | GoDaddy.com, LLC | 19 Oct 2015 | 19 Oct 2015 | 19 Oct 2016 |
| 616 | stepbystepflow.com | NameCheap, Inc. | 10 Feb 2017 | 18 Feb 2024 | 10 Feb 2025 |
| 617 | stepbystepwealthbuilder.com | GoDaddy.com, LLC | 23 Oct 2015 | 23 Oct 2015 | 23 Oct 2016 |
| 618 | stepbystepts.com | GoDaddy.com, LLC | 23 Oct 2015 | 19 Sep 2022 | 23 Oct 2025 |
| 619 | stepbystepto.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Oct 2015 | 23 Oct 2015 | 23 Oct 2016 |
| 620 | stepbystepsystem.com | GoDaddy.com, LLC | 10 Feb 2024 | 10 Feb 2024 | 10 Feb 2025 |
| 621 | stepbystep1.com | GoDaddy.com, LLC | 25 Oct 2015 | 25 Oct 2015 | 25 Oct 2017 |
| 622 | stepbystepbg.com | TurnCommerce, Inc. DBA NameBright.com | 31 Oct 2015 | 25 Oct 2020 | 31 Oct 2024 |
| 623 | stepbystep-tc.net | GoDaddy.com, LLC | 1 Nov 2015 | 1 Nov 2015 | 1 Nov 2016 |
| 624 | stepbystepeip.info | Network Solutions, LLC | 1 Nov 2015 | 6 Sep 2016 | 1 Nov 2017 |
| 625 | stepbystephomeimprovement.net | Tucows Domains Inc. | 2 Nov 2015 | 6 Nov 2019 | 2 Nov 2019 |
| 626 | stepbystepfamily.com | GoDaddy.com, LLC | 29 Jun 2017 | 5 Jul 2024 | 29 Jun 2025 |
| 627 | stepbystepfamilies.com | GoDaddy.com, LLC | 20 Aug 2020 | 20 Aug 2020 | 20 Aug 2021 |
| 628 | stepbystepsenior.com | GMO Internet Inc. | 23 Jan 2020 | 23 Jan 2020 | 23 Jan 2021 |
| 629 | stepbysteplinedancing.com | GoDaddy.com, LLC | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 630 | stepbystepkungfu.com | Interweb Advertising D.B.A. Profile Builder | 4 Nov 2015 | 4 Nov 2015 | 4 Nov 2016 |
| 631 | stepbysteploans.com | DreamHost, LLC | 22 Sep 2023 | 22 Sep 2023 | 22 Sep 2024 |
| 632 | stepbystepbuild.com | Namesilo, LLC | 26 Jan 2018 | 1 Aug 2024 | 26 Jan 2025 |
| 633 | stepbystepinspections.info | Network Solutions, LLC | 10 Nov 2015 | 16 Sep 2023 | 10 Nov 2024 |
| 634 | stepbystepwoodworks.com | eNom, Inc. | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 635 | stepbystepchina.com | GoDaddy.com, LLC | 11 Nov 2015 | 11 Nov 2015 | 11 Nov 2016 |
| 636 | stepbysteprestore.com | GoDaddy.com, LLC | 5 Jul 2023 | 5 Jul 2023 | 5 Jul 2024 |
| 637 | stepbystepmoms.com | Hongkong Domain Name Information Management Co., L… | 7 Nov 2021 | 11 Nov 2022 | 7 Nov 2022 |
| 638 | stepbystephk.com | Bizcn.com, Inc. | 16 Nov 2015 | 25 May 2023 | 16 Nov 2029 |
| 639 | stepbystepevent.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Sep 2022 | 15 Sep 2023 | 20 Sep 2024 |
| 640 | stepbystepfba.com | Google, Inc. | 30 Jun 2023 | 18 Jun 2024 | 30 Jun 2025 |
| 641 | stepbystepbox.com | eNom, Inc. | 25 Nov 2015 | 25 Nov 2015 | 25 Nov 2017 |
| 642 | stepbystepfranchiseconsulting.online | NameCheap, Inc. | 26 Nov 2015 | 26 Nov 2015 | 26 Nov 2016 |
| 643 | stepbystepup.com | Beijing Lanhai Jiye Technology Co., Ltd | 21 Jul 2022 | 24 Jul 2024 | 21 Jul 2025 |
| 644 | stepbystepworkshops.com | Name.com, Inc. | 29 Nov 2015 | 27 Nov 2023 | 29 Nov 2024 |
| 645 | stepbystepstudios.com | Name.com, Inc. | 29 Nov 2015 | 27 Nov 2023 | 29 Nov 2024 |
| 646 | stepbystepmoms.org | FastDomain Inc. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 647 | stepbystepnotes.com | GoDaddy.com, LLC | 8 Jul 2019 | 8 Jul 2019 | 8 Jul 2020 |
| 648 | stepbysteplanguage.com | Network Solutions, LLC | 26 Nov 2015 | 18 Jun 2024 | 26 Nov 2024 |
| 649 | stepbystep-mma.com | Network Solutions, LLC | 1 Dec 2015 | 25 Nov 2016 | 1 Dec 2017 |
| 650 | stepbystepdayhab.com | GoDaddy.com, LLC | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2016 |
| 651 | stepbystepcashfornewbies.com | GoDaddy.com, LLC | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2016 |
| 652 | stepbystepsolutions.org | Tucows Domains Inc. | 16 Sep 2023 | 6 Sep 2024 | 16 Sep 2025 |
| 653 | stepbystepbreakthrough.com | GoDaddy.com, LLC | 4 Dec 2015 | 28 Nov 2023 | 4 Dec 2028 |
| 654 | stepbystep-cdc.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2020 |
| 655 | stepbystepdental.com | GoDaddy.com, LLC | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2017 |
| 656 | stepbystepwoodworking.net | eNom, Inc. | 9 Dec 2015 | 9 Dec 2015 | 9 Dec 2016 |
| 657 | stepbystepdaysupport.com | Tucows Domains Inc. | 11 Dec 2008 | 15 Dec 2015 | 11 Dec 2016 |
| 658 | stepbysteptraveling.com | GoDaddy.com, LLC | 25 Apr 2023 | 25 Apr 2023 | 25 Apr 2025 |
| 659 | stepbysteponlinebusiness.com | West263 International Limited | 14 Jan 2020 | 14 Jan 2020 | 14 Jan 2021 |
| 660 | stepbysteph0wto.com | eNom, Inc. | 15 Dec 2015 | 15 Dec 2015 | 15 Dec 2016 |
| 661 | stepbystepinternettraining.com | NameCheap, Inc. | 20 Dec 2015 | 20 Nov 2023 | 20 Dec 2024 |
| 662 | stepbystepministry.com | GoDaddy.com, LLC | 12 Feb 2022 | 13 Feb 2024 | 12 Feb 2025 |
| 663 | stepbystepinternetcash.com | GoDaddy.com, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 664 | stepbystep1981.com | GoDaddy.com, LLC | 22 Dec 2015 | 22 Dec 2015 | 22 Dec 2016 |
| 665 | stepbystepstudy.com | GoDaddy.com, LLC | 11 Nov 2022 | 23 Jan 2024 | 11 Nov 2023 |
| 666 | stepbystepforeclosurehelp.com | GoDaddy.com, LLC | 28 Dec 2015 | 28 Dec 2015 | 28 Dec 2016 |
| 667 | stepbystepfranchiseconsulting.xyz | NameCheap, Inc. | 29 Dec 2015 | 30 Nov 2017 | 29 Dec 2018 |
| 668 | stepbystepclc.info | Network Solutions, LLC | 1 Jan 2016 | 7 Nov 2023 | 1 Jan 2025 |
| 669 | stepbystepguidewp.com | GoDaddy.com, LLC | 3 Jan 2016 | 4 Jan 2024 | 3 Jan 2025 |
| 670 | stepbystepdanceinstruction.com | GoDaddy.com, LLC | 2 Jan 2016 | 3 Jan 2024 | 2 Jan 2025 |
| 671 | stepbysteptrafficmastery.com | eNom, Inc. | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 672 | stepbystepbinary.com | GoDaddy.com, LLC | 4 Jan 2016 | 20 Sep 2022 | 4 Jan 2026 |
| 673 | stepbysteppaleo.com | NetRegistry Pty Ltd. | 6 Jan 2016 | 6 Jan 2016 | 6 Jan 2017 |
| 674 | stepbystepmyonlinebusiness.com | FastDomain Inc. | 7 Jan 2016 | 7 Jan 2016 | 7 Jan 2017 |
| 675 | stepbystepwithangela.com | GoDaddy.com, LLC | 9 Jan 2016 | 9 Jan 2016 | 9 Jan 2018 |
| 676 | stepbystepparent.com | GoDaddy.com, LLC | 10 Jan 2016 | 10 Jan 2016 | 10 Jan 2017 |
| 677 | stepbystepdad.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Dec 2022 | 29 Nov 2023 | 4 Dec 2024 |
| 678 | stepbystepmom.com | GoDaddy.com, LLC | 29 Jan 2024 | 29 Jan 2024 | 29 Jan 2025 |
| 679 | stepbystepsustainability.com | Google, Inc. | 20 Apr 2020 | 23 Apr 2024 | 20 Apr 2025 |
| 680 | stepbystepdogtrainingtips.com | eNom, Inc. | 14 Jan 2016 | 14 Jan 2016 | 14 Jan 2017 |
| 681 | stepbysteptowealth.com | NameCheap, Inc. | 17 Jan 2016 | 18 Dec 2023 | 17 Jan 2025 |
| 682 | stepbysteponline.top | Dynadot, LLC | 17 Jan 2016 | 17 Jan 2016 | 17 Jan 2017 |
| 683 | stepbystepguidebooks.com | pair Networks, Inc. d/b/a pairNIC | 17 Jan 2016 | 27 Jan 2022 | 17 Jan 2027 |
| 684 | stepbystepconcepts.com | Netdorm, Inc. dba DnsExit.com | 18 Jan 2016 | 18 Jan 2016 | 18 Jan 2017 |
| 685 | stepbystepmoving.net | GoDaddy.com, LLC | 19 Jan 2016 | 17 Jan 2023 | 19 Jan 2025 |
| 686 | stepbystepvideo.net | GoDaddy.com, LLC | 20 Jan 2016 | 20 Jan 2016 | 20 Jan 2017 |
| 687 | stepbystepwithjohnwilliams.com | eNom, Inc. | 19 Jan 2016 | 11 Feb 2017 | 19 Jan 2018 |
| 688 | stepbystepmagazine.com | 1API GmbH | 17 Jun 2015 | 19 Jan 2016 | 17 Jun 2018 |
| 689 | stepbysteptrafficmonsoon.com | Mesh Digital Limited | 22 Jan 2016 | 17 Jan 2017 | 22 Jan 2019 |
| 690 | stepbysteptech.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jan 2016 | 19 Jan 2021 | 25 Jan 2025 |
| 691 | stepbystepcourses.com | DNC Holdings, Inc. | 28 Jul 2019 | 27 Aug 2024 | 28 Jul 2025 |
| 692 | stepbystepswithcher.com | GoDaddy.com, LLC | 26 Jan 2016 | 26 Jan 2016 | 26 Jan 2017 |
| 693 | stepbystepharf.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Apr 2022 | 27 Mar 2024 | 19 Apr 2025 |
| 694 | stepbystepss.org | GoDaddy.com, LLC | 7 Jun 2013 | 1 Jul 2024 | 7 Jun 2026 |
| 695 | stepbystepbyvideos.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 696 | stepbystepadvt.com | GoDaddy.com, LLC | 31 Jan 2016 | 31 Jan 2016 | 31 Jan 2018 |
| 697 | stepbystepsocial.media | GoDaddy.com, LLC | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2017 |
| 698 | stepbystepsocialmediaacademy.com | GoDaddy.com, LLC | 1 Feb 2016 | 1 Feb 2016 | 1 Feb 2018 |
| 699 | stepbystepfashion.com | Tucows Domains Inc. | 21 Jun 2023 | 1 Aug 2024 | 21 Jun 2024 |
| 700 | stepbysteptowealth.net | NameCheap, Inc. | 12 Jan 2021 | 13 Dec 2023 | 12 Jan 2025 |
| 701 | stepbystepaction.com | GoDaddy.com, LLC | 2 Feb 2016 | 2 Feb 2016 | 2 Feb 2017 |
| 702 | stepbystepbusinesscredit.com | Domain.com, LLC | 3 Feb 2016 | 19 Jan 2017 | 3 Feb 2018 |
| 703 | stepbystepcoaching.org | GoDaddy.com, LLC | 3 Feb 2016 | 4 Apr 2016 | 3 Feb 2021 |
| 704 | stepbystepfamily.org | Tucows Domains Inc. | 4 Feb 2016 | 25 Jan 2024 | 4 Feb 2025 |
| 705 | stepbystepmarketing.online | NameCheap, Inc. | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2017 |
| 706 | stepbystephq.com | Internet Domain Services BS Corp | 5 Feb 2016 | 5 Feb 2016 | 5 Feb 2017 |
| 707 | stepbystepdoityourself.com | NameCheap, Inc. | 8 Feb 2016 | 9 Jan 2024 | 8 Feb 2025 |
| 708 | stepbystepecommercetraining.com | GoDaddy.com, LLC | 8 Feb 2016 | 8 Feb 2016 | 8 Feb 2018 |
| 709 | stepbystepfreedom.net | united-domains AG | 11 Feb 2016 | 12 Feb 2017 | 11 Feb 2018 |
| 710 | stepbystepnutritionch.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 10 Feb 2016 | 10 Feb 2016 | 10 Feb 2017 |
| 711 | stepbystepactivate.com | Tucows Domains Inc. | 11 Feb 2015 | 15 Feb 2016 | 11 Feb 2017 |
| 712 | stepbystepfunnel.com | eNom, Inc. | 30 Dec 2017 | 30 Dec 2017 | 30 Dec 2018 |
| 713 | stepbysteptome.com | register.com, Inc. | 16 Feb 2016 | 16 Feb 2016 | 16 Feb 2017 |
| 714 | stepbystepchildcare.com | Namesilo, LLC | 30 Jan 2005 | 31 Jan 2024 | 30 Jan 2025 |
| 715 | stepbystepbreakthough.com | eNom, Inc. | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 716 | stepbystepinc.org | Network Solutions, LLC | 27 Apr 2004 | 3 Mar 2024 | 27 Apr 2025 |
| 717 | stepbystepentrepreneur.com | GoDaddy.com, LLC | 27 Aug 2016 | 1 Sep 2024 | 27 Aug 2025 |
| 718 | stepbystep2016.com | Mesh Digital Limited | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 719 | stepbystepbreakthrough14days.com | eNom, Inc. | 23 Feb 2016 | 23 Feb 2016 | 23 Feb 2017 |
| 720 | stepbystepvfx.com | Wild West Domains, LLC | 24 Feb 2016 | 24 Feb 2016 | 24 Feb 2017 |
| 721 | stepbystepprogrammingtutorials.com | GoDaddy.com, LLC | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 722 | stepbysteppregnancycareapp.com | register.com, Inc. | 24 Feb 2016 | 31 Mar 2016 | 24 Feb 2018 |
| 723 | stepbystepcreations.com | GoDaddy.com, LLC | 24 Feb 2016 | 25 Feb 2024 | 24 Feb 2026 |
| 724 | stepbysteppreschools.com | Tucows Domains Inc. | 31 Jul 2018 | 31 Jul 2018 | 31 Jul 2019 |
| 725 | stepbysteplearnersguide.com | FastDomain Inc. | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 726 | stepbystepin14days.com | eNom, Inc. | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 727 | stepbystepactnow.xyz | NameCheap, Inc. | 27 Feb 2016 | 23 Mar 2016 | 27 Feb 2017 |
| 728 | stepbystepactnow.com | eNom, Inc. | 27 Feb 2016 | 22 Feb 2017 | 27 Feb 2018 |
| 729 | stepbystepnursery.co.uk | - | 15 May 2000 | 16 May 2024 | 15 May 2025 |
| 730 | stepbystepmontessori.com | CloudFlare, Inc. | 11 Nov 1999 | 7 Nov 2023 | 11 Nov 2024 |
| 731 | stepbystepwithroger.com | GoDaddy.com, LLC | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 732 | stepbysteptraining.net | Launchpad, Inc. | 28 Feb 2016 | 13 Feb 2017 | 28 Feb 2018 |
| 733 | stepbystepgainbygain.com | eNom, Inc. | 28 Feb 2016 | 28 Feb 2016 | 28 Feb 2017 |
| 734 | stepbystepclasses.com | GoDaddy.com, LLC | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 735 | stepbystepstudies.com | GoDaddy.com, LLC | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 736 | stepbystepbaking.com | eNom, Inc. | 29 Feb 2016 | 29 Feb 2016 | 28 Feb 2017 |
| 737 | stepbystepaba.com | GoDaddy.com, LLC | 9 Mar 2020 | 10 Mar 2024 | 9 Mar 2026 |
| 738 | stepbystepcounselingllc.com | In2net Network, Inc. | 25 Nov 2009 | 19 Nov 2023 | 25 Nov 2024 |
| 739 | stepbystepblueprinttothousands.com | GoDaddy.com, LLC | 2 Mar 2016 | 2 Mar 2016 | 2 Mar 2017 |
| 740 | stepbystepsupport.com | TurnCommerce, Inc. DBA NameBright.com | 2 Aug 2017 | 3 Sep 2024 | 2 Aug 2024 |
| 741 | stepbystep-social.com | Tucows Domains Inc. | 2 Mar 2016 | 6 Mar 2017 | 2 Mar 2017 |
| 742 | stepbystepfranchiseconsultant.xyz | NameCheap, Inc. | 10 Feb 2016 | 18 Feb 2017 | 10 Feb 2018 |
| 743 | stepbystepcashbreakthrough.com | eNom, Inc. | 4 Mar 2016 | 3 Feb 2017 | 4 Mar 2018 |
| 744 | stepbysteppasadena.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 745 | stepbystep14daybreakthrough.com | eNom, Inc. | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 746 | stepbystep-socialmedia.com | GoDaddy.com, LLC | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2017 |
| 747 | stepbystepoutsourcing.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 9 Mar 2016 | 9 Mar 2016 | 9 Mar 2017 |
| 748 | stepbystepguidetofinancialfreedom.com | eNom, Inc. | 11 Mar 2016 | 10 Feb 2017 | 11 Mar 2018 |
| 749 | stepbystepsheds.com | Network Solutions, LLC | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 750 | stepbystepfreeproject.com | eNom, Inc. | 11 Mar 2016 | 11 Mar 2016 | 11 Mar 2017 |
| 751 | stepbystepmoney.xyz | NameCheap, Inc. | 13 Mar 2016 | 30 Mar 2016 | 13 Mar 2017 |
| 752 | stepbystepincome.xyz | NameCheap, Inc. | 13 Mar 2016 | 30 Mar 2016 | 13 Mar 2017 |
| 753 | stepbystepcash.xyz | NameCheap, Inc. | 13 Mar 2016 | 30 Mar 2016 | 13 Mar 2017 |
| 754 | stepbystephiking.com | GoDaddy.com, LLC | 13 Mar 2016 | 14 Mar 2024 | 13 Mar 2025 |
| 755 | stepbystepfilms.com | Tucows Domains Inc. | 11 Mar 2013 | 5 Mar 2024 | 11 Mar 2025 |
| 756 | stepbystep4life.org | GoDaddy.com, LLC | 14 Mar 2016 | 13 Jul 2024 | 14 Mar 2026 |
| 757 | stepbystep4life.info | GoDaddy.com, LLC | 14 Mar 2016 | 15 Jul 2024 | 14 Mar 2026 |
| 758 | stepbystepwoodworkingprojects.com | Namesilo, LLC | 19 Oct 2018 | 20 Oct 2018 | 19 Oct 2019 |
| 759 | stepbysteppersonalbreakthrough.com | eNom, Inc. | 19 Mar 2016 | 19 Mar 2016 | 19 Mar 2017 |
| 760 | stepbystepfaith.com | register.com, Inc. | 18 Mar 2016 | 20 Mar 2024 | 18 Mar 2025 |
| 761 | stepbystepcitizen.com | GoDaddy.com, LLC | 18 Mar 2016 | 18 Mar 2016 | 18 Mar 2021 |
| 762 | stepbysteplessons.com | Wild West Domains, LLC | 11 Aug 2020 | 31 Jul 2024 | 11 Aug 2026 |
| 763 | stepbystepfreetraining.com | eNom, Inc. | 19 Mar 2016 | 15 Feb 2017 | 19 Mar 2018 |
| 764 | stepbystep123.net | Tucows Domains Inc. | 20 Mar 2016 | 24 Mar 2017 | 20 Mar 2017 |
| 765 | stepbystepweightloss.com | GoDaddy.com, LLC | 31 Jan 2020 | 31 Jan 2020 | 31 Jan 2021 |
| 766 | stepbystepgps.com | GoDaddy.com, LLC | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 767 | stepbystepbeautytips.com | eNom, Inc. | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2017 |
| 768 | stepbystepaffiliates.com | eNom, Inc. | 9 Aug 2018 | 9 Aug 2018 | 9 Aug 2019 |
| 769 | stepbystepfor14days.com | eNom, Inc. | 23 Mar 2016 | 23 Mar 2016 | 23 Mar 2017 |
| 770 | stepbystepwy.org | Wild West Domains, LLC | 24 Mar 2016 | 24 Mar 2017 | 24 Mar 2018 |
| 771 | stepbysteptofinancialfreedom.com | eNom, Inc. | 25 Mar 2016 | 25 Mar 2016 | 25 Mar 2017 |
| 772 | stepbysteptobreaktrough.com | eNom, Inc. | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 773 | stepbystepsocialmediacourses.com | GoDaddy.com, LLC | 24 Mar 2016 | 24 Mar 2016 | 24 Mar 2017 |
| 774 | stepbystepexback.com | Network Solutions, LLC | 26 Mar 2016 | 26 Mar 2016 | 26 Mar 2017 |
| 775 | stepbystepcouponing.com | Tucows Domains Inc. | 26 Mar 2016 | 30 Mar 2017 | 26 Mar 2017 |
| 776 | stepbysteponlinesystem.com | eNom, Inc. | 27 Mar 2016 | 27 Mar 2016 | 27 Mar 2017 |
| 777 | stepbysteptogether.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 16 Nov 2017 | 16 Jan 2018 | 16 Nov 2018 |
| 778 | stepbystepsecurity.com | GoDaddy.com, LLC | 20 Nov 2017 | 21 Nov 2022 | 20 Nov 2024 |
| 779 | stepbysteppbonline.com | eNom, Inc. | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 780 | stepbystepturkey.com | GoDaddy.com, LLC | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 781 | stepbysteptourism.com | GoDaddy.com, LLC | 31 Mar 2016 | 31 Mar 2016 | 31 Mar 2017 |
| 782 | stepbystepintheworld.com | Tucows Domains Inc. | 31 Mar 2016 | 4 Apr 2018 | 31 Mar 2018 |
| 783 | stepbystep14.com | eNom, Inc. | 30 Jun 2017 | 30 Jun 2017 | 30 Jun 2018 |
| 784 | stepbystepturkeytours.com | GoDaddy.com, LLC | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 785 | stepbystephotels.com | GoDaddy.com, LLC | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 786 | stepbysteptoprofits.com | eNom, Inc. | 4 Apr 2016 | 3 Mar 2017 | 4 Apr 2018 |
| 787 | stepbysteppassiveincome.com | FastDomain Inc. | 2 Jan 2019 | 2 Jan 2019 | 2 Jan 2020 |
| 788 | stepbystepenglishlang.com | GoDaddy.com, LLC | 4 Apr 2016 | 16 Jun 2024 | 4 Apr 2024 |
| 789 | stepbystepclub.org | Tucows Domains Inc. | 4 Apr 2016 | 6 Mar 2017 | 4 Apr 2018 |
| 790 | stepbystepclub.com | TurnCommerce, Inc. DBA NameBright.com | 23 Jun 2017 | 17 Jun 2020 | 23 Jun 2024 |
| 791 | stepbysteplacounty.com | GoDaddy.com, LLC | 5 Apr 2016 | 21 Sep 2022 | 5 Apr 2026 |
| 792 | stepbystepcenter.com | GoDaddy.com, LLC | 4 Aug 2020 | 4 Aug 2020 | 4 Aug 2021 |
| 793 | stepbysteptinder.com | GoDaddy.com, LLC | 7 Apr 2016 | 7 Apr 2016 | 7 Apr 2017 |
| 794 | stepbystepinmoray.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 15 Jul 2011 | 25 Jun 2013 | 15 Jul 2019 |
| 795 | stepbystepelectronics.com | GoDaddy.com, LLC | 10 Apr 2016 | 10 Apr 2016 | 10 Apr 2017 |
| 796 | stepbystepcredit.com | Namesilo, LLC | 16 May 2024 | 16 May 2024 | 16 May 2025 |
| 797 | stepbystepmarket.space | Chengdu West Dimension Digital Technology Co., Ltd… | 15 Apr 2016 | - | 15 Apr 2017 |
| 798 | stepbystepcode.com | GoDaddy.com, LLC | 18 Apr 2023 | 30 Jun 2024 | 18 Apr 2024 |
| 799 | stepbystepabc.com | Tucows Domains Inc. | 16 Apr 2014 | 16 Apr 2014 | 16 Apr 2017 |
| 800 | stepbystephomechildcare.com | GoDaddy.com, LLC | 20 Apr 2016 | 21 Apr 2024 | 20 Apr 2025 |
| 801 | stepbystepguidance.org | eNom, Inc. | 20 Apr 2016 | 20 Apr 2016 | 20 Apr 2017 |
| 802 | stepbystepguidance.net | eNom, Inc. | 20 Apr 2016 | 20 Apr 2016 | 20 Apr 2017 |
| 803 | stepbystepguidance.com | GoDaddy.com, LLC | 14 Nov 2023 | 14 Nov 2023 | 14 Nov 2024 |
| 804 | stepbystepferociously.com | Tucows Domains Inc. | 20 Jul 2021 | 20 Jun 2023 | 20 Jul 2025 |
| 805 | stepbystepkitchenremodeling.com | Tucows Domains Inc. | 21 Apr 2011 | 21 Apr 2011 | 21 Apr 2017 |
| 806 | stepbysteprecruitment.co.uk | - | 18 Apr 2008 | 12 Apr 2024 | 18 Apr 2025 |
| 807 | stepbystepsh.com | GoDaddy.com, LLC | 9 Aug 2023 | 9 Aug 2023 | 9 Aug 2026 |
| 808 | stepbystepcut.com | Wild West Domains, LLC | 26 Apr 2016 | 26 Apr 2016 | 26 Apr 2017 |
| 809 | stepbystepguideformen.com | 1&1 Internet AG | 27 Apr 2016 | 21 Mar 2018 | 27 Apr 2025 |
| 810 | stepbysteppa.com | GoDaddy.com, LLC | 8 Jun 2011 | 8 Jun 2024 | 8 Jun 2026 |
| 811 | stepbystepthreesome.com | GoDaddy.com, LLC | 3 Jul 2003 | 4 Jul 2024 | 3 Jul 2025 |
| 812 | stepbystepwriting.com | GoDaddy.com, LLC | 26 Jan 2023 | 26 Jan 2023 | 26 Jan 2024 |
| 813 | stepbystepinabox.com | GoDaddy.com, LLC | 29 Dec 2011 | 29 Dec 2015 | 29 Dec 2016 |
| 814 | stepbystepreservestudy.com | GoDaddy.com, LLC | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2017 |
| 815 | stepbystepreaccess.com | GoDaddy.com, LLC | 30 Apr 2016 | 30 Apr 2016 | 30 Apr 2017 |
| 816 | stepbystepcs.com | DropCatch.com 1297 LLC | 20 Jul 2017 | 20 Jul 2017 | 20 Jul 2018 |
| 817 | stepbysteptofeelgood.com | register.com, Inc. | 3 May 2016 | 3 May 2016 | 3 May 2019 |
| 818 | stepbystepsite.com | NameCheap, Inc. | 6 May 2016 | 18 Jul 2024 | 6 May 2024 |
| 819 | stepbystepbreakthroughtraining.com | eNom, Inc. | 8 May 2016 | 8 May 2016 | 8 May 2017 |
| 820 | stepbystepchinesereaders.com | NameCheap, Inc. | 13 Mar 2012 | 14 Mar 2024 | 13 Mar 2025 |
| 821 | stepbysteptohealth.org | FastDomain Inc. | 10 May 2016 | 24 May 2017 | 10 May 2018 |
| 822 | stepbystepthaicookingclass.com | eNom, Inc. | 9 May 2016 | 9 May 2016 | 9 May 2018 |
| 823 | stepbystepcourses.net | eNom, Inc. | 10 May 2016 | 26 Apr 2017 | 10 May 2018 |
| 824 | stepbysteplifecoach.net | GoDaddy.com, LLC | 12 May 2016 | 12 May 2016 | 12 May 2017 |
| 825 | stepbysteppuppytraining.com | GoDaddy.com, LLC | 12 May 2016 | 8 Sep 2024 | 7 Sep 2026 |
| 826 | stepbystepnet.com | GoDaddy.com, LLC | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 827 | stepbystepnursery.net | Tucows Domains Inc. | 14 May 2016 | 18 May 2019 | 14 May 2019 |
| 828 | stepbystep-breakthrough.com | eNom, Inc. | 15 May 2016 | 15 May 2016 | 15 May 2017 |
| 829 | stepbystepguidetomakemoneyonline.com | eNom, Inc. | 16 May 2016 | 16 May 2016 | 16 May 2017 |
| 830 | stepbystepphysicaltherapy.net | Wild West Domains, LLC | 18 Apr 2014 | 26 Apr 2016 | 18 Apr 2018 |
| 831 | stepbystepcare.org | FastDomain Inc. | 2 May 2024 | 14 May 2024 | 2 May 2025 |
| 832 | stepbystepguidetoonlinemoney.com | eNom, Inc. | 18 May 2016 | 18 May 2016 | 18 May 2017 |
| 833 | stepbystepacademy.com | TurnCommerce, Inc. DBA NameBright.com | 19 May 2016 | 13 May 2021 | 19 May 2024 |
| 834 | stepbystep196.com | Beijing Lanhai Jiye Technology Co., Ltd | 7 Aug 2022 | 8 Aug 2024 | 7 Aug 2025 |
| 835 | stepbystepevents.fr | - | 7 Aug 2008 | 7 Aug 2017 | 7 Aug 2018 |
| 836 | stepbystepmoves.com | GoDaddy.com, LLC | 23 May 2016 | 23 May 2016 | 23 May 2017 |
| 837 | stepbystep-security.com | Name.com, Inc. | 24 May 2016 | 24 May 2016 | 24 May 2017 |
| 838 | stepbystepsudan.com | Hostinger, UAB | 27 May 2016 | 6 Aug 2017 | 27 May 2018 |
| 839 | stepbystepmortgages.com | Tucows Domains Inc. | 27 May 2016 | 20 May 2024 | 27 May 2025 |
| 840 | stepbystep-countrydance.com | OVH sas | 27 May 2016 | 28 May 2024 | 27 May 2025 |
| 841 | stepbystepvirtualtours.com | FastDomain Inc. | 1 Jun 2016 | 24 Jul 2017 | 1 Jun 2018 |
| 842 | stepbystep3d.com | Google, Inc. | 1 Jun 2016 | 20 Apr 2024 | 1 Jun 2025 |
| 843 | stepbysteph.net | united-domains AG | 2 Jun 2016 | 12 Jun 2024 | 2 Jun 2025 |
| 844 | stepbysteploan.com | GoDaddy.com, LLC | 23 Mar 2022 | 24 Mar 2024 | 23 Mar 2026 |
| 845 | stepbystepinsurance.com | NameCheap, Inc. | 3 Oct 2023 | 4 Oct 2023 | 3 Oct 2024 |
| 846 | stepbystepbootcamp.com | Wild West Domains, LLC | 6 Jun 2016 | 6 Jun 2016 | 6 Jun 2017 |
| 847 | stepbystepwv.org | FastDomain Inc. | 30 Dec 2007 | 20 Dec 2023 | 30 Dec 2024 |
| 848 | stepbysteprangolidesigns.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 849 | stepbystepkolamdesigns.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 850 | stepbystepfromchina.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 851 | stepbystepbooks.xyz | PDR Ltd. d/b/a PublicDomainRegistry.com | 1 Jun 2016 | 1 Aug 2016 | 1 Jun 2017 |
| 852 | stepbystep411.com | - | 9 Jun 2016 | 9 Jun 2016 | 9 Jun 2017 |
| 853 | stepbystepsoftware.com | eNom, Inc. | 9 Jun 2016 | 12 Jun 2024 | 9 Jun 2025 |
| 854 | stepbystephtravels.com | Domain.com, LLC | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 855 | stepbystepinternetcoaching.com | GoDaddy.com, LLC | 13 Jun 2016 | 13 Jun 2016 | 13 Jun 2017 |
| 856 | stepbystepphoto.com | Wix.com Ltd. | 11 Apr 2024 | 18 Jun 2024 | 11 Apr 2025 |
| 857 | stepbystepcourse.info | GoDaddy.com, LLC | 14 Jun 2016 | 14 Jun 2016 | 14 Jun 2017 |
| 858 | stepbysteplocalmarketing.com | GoDaddy.com, LLC | 26 Mar 2013 | 31 Mar 2017 | 26 Mar 2018 |
| 859 | stepbystepenglishcourses.com | Domain.com, LLC | 16 Jun 2016 | 15 Jun 2017 | 16 Jun 2018 |
| 860 | stepbystep-med.com | PSI-USA, Inc. dba Domain Robot | 17 Jun 2016 | 6 Aug 2024 | 17 Jun 2026 |
| 861 | stepbystepwebpresence.com | - | 18 Jun 2016 | 18 Jun 2016 | 18 Jun 2017 |
| 862 | stepbystephealth.org | GoDaddy.com, LLC | 19 Feb 2020 | 3 Aug 2024 | 19 Feb 2025 |
| 863 | stepbystepchef.com | FastDomain Inc. | 19 Jun 2016 | 16 Jun 2024 | 19 Jun 2025 |
| 864 | stepbystep-wellness.com | 1&1 Internet AG | 17 Nov 2011 | 21 Mar 2018 | 17 Nov 2024 |
| 865 | stepbystepstaffing.com | Wild West Domains, LLC | 11 Feb 2019 | 11 Feb 2019 | 11 Feb 2020 |
| 866 | stepbystepstakeholders.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jun 2016 | 12 Jun 2024 | 25 Jun 2025 |
| 867 | stepbystepab.com | TurnCommerce, Inc. DBA NameBright.com | 25 Jun 2016 | 13 Mar 2017 | 25 Jun 2019 |
| 868 | stepbystep2015.net | Gabia, Inc. | 27 Jun 2016 | 27 Jul 2024 | 27 Jun 2024 |
| 869 | stepbystepchildrensacademy.com | GoDaddy.com, LLC | 26 Jun 2009 | 7 Sep 2024 | 26 Jun 2024 |
| 870 | stepbystepbloggingguide.com | GoDaddy.com, LLC | 30 Jun 2016 | 30 Jun 2016 | 30 Jun 2017 |
| 871 | stepbysteptravelandphoto.com | - | 1 Jul 2016 | 1 Jul 2016 | 1 Jul 2017 |
| 872 | stepbystepconsulting.com | GoDaddy.com, LLC | 14 Apr 1999 | 14 Apr 2024 | 14 Apr 2025 |
| 873 | stepbysteplearning.net | Wix.com Ltd. | 10 Nov 2021 | 14 Nov 2023 | 10 Nov 2024 |
| 874 | stepbystepkids.net | GoDaddy.com, LLC | 2 Feb 2023 | 10 Jun 2024 | 2 Feb 2025 |
| 875 | stepbystepdrawing.net | Name.com, Inc. | 6 Jul 2016 | 4 Jul 2017 | 6 Jul 2018 |
| 876 | stepbystepstairbuilder1.com | DomainPeople, Inc. | 6 Jul 2016 | 7 Jun 2017 | 6 Jul 2018 |
| 877 | stepbystep-z.click | URL Solutions, Inc. | 6 Jun 2016 | 16 Jul 2017 | 6 Jun 2017 |
| 878 | stepbystepgames.com | NameCheap, Inc. | 8 Apr 2019 | 8 Apr 2019 | 8 Apr 2020 |
| 879 | stepbystepps.ca | - | 21 Jan 2015 | 6 Mar 2024 | 21 Jan 2025 |
| 880 | stepbystepschools.com | GoDaddy.com, LLC | 1 Feb 2005 | 2 Feb 2023 | 1 Feb 2025 |
| 881 | stepbystepabc.xyz | NameCheap, Inc. | 8 Jun 2016 | 27 Jun 2016 | 8 Jun 2017 |
| 882 | stepbystepinstitute.training | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jun 2016 | 20 Jun 2016 | 15 Jun 2017 |
| 883 | stepbystepshedplans.xyz | NameCheap, Inc. | 18 Jun 2016 | 29 Nov 2016 | 18 Jun 2017 |
| 884 | stepbystepphotography.photos | Network Solutions, LLC | 20 Jun 2016 | 28 Jul 2017 | 20 Jun 2018 |
| 885 | stepbysteptothe.top | Shanghai Meicheng Technology Information Co., Ltd | 17 Feb 2016 | 19 Apr 2016 | 17 Feb 2021 |
| 886 | stepbystepassistance.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jul 2016 | 12 Jul 2017 | 13 Jul 2018 |
| 887 | stepbystepcourier.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 15 Jul 2016 | 26 Aug 2017 | 15 Jul 2017 |
| 888 | stepbystep3dvirtualtours.com | FastDomain Inc. | 15 Jul 2016 | 24 Jul 2017 | 15 Jul 2018 |
| 889 | stepbystepwebsitetrafficsecrets.info | GoDaddy.com, LLC | 15 Jul 2016 | 15 Jul 2016 | 15 Jul 2017 |
| 890 | stepbystepgroup.biz | Gabia, Inc. | 14 May 2014 | 14 May 2014 | 13 May 2017 |
| 891 | stepbystepmusiccareer.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 2 Dec 2010 | 11 Nov 2011 | 1 Dec 2016 |
| 892 | stepbystepattraction.com | Google, Inc. | 11 Jan 2019 | 8 May 2024 | 11 Jan 2025 |
| 893 | stepbystephomeschooling.com | Beijing Lanhai Jiye Technology Co., Ltd | 20 Nov 2023 | 29 Jun 2024 | 20 Nov 2024 |
| 894 | stepbystepmealprep.com | - | 20 Jul 2016 | 20 Jul 2016 | 20 Jul 2017 |
| 895 | stepbystepvirtualtour.com | FastDomain Inc. | 20 Jul 2016 | 24 Jul 2017 | 20 Jul 2018 |
| 896 | stepbystepadulting.com | FastDomain Inc. | 21 Jul 2016 | 23 Aug 2017 | 21 Jul 2017 |
| 897 | stepbysteplifestyle.com | NameCheap, Inc. | 13 Mar 2019 | 12 Feb 2024 | 13 Mar 2025 |
| 898 | stepbystepacademy.org | GoDaddy.com, LLC | 13 Aug 2022 | 14 Aug 2024 | 13 Aug 2025 |
| 899 | stepbysteps.site | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jul 2016 | 31 Aug 2017 | 25 Jul 2018 |
| 900 | stepbystepforchange.com | GoDaddy.com, LLC | 27 Jul 2016 | 20 Jul 2024 | 27 Jul 2025 |
| 901 | stepbystepshedplans.com | - | 27 Jul 2016 | 27 Jul 2016 | 27 Jul 2017 |
| 902 | stepbystepmusic.education | Melbourne IT, Ltd | 28 Jul 2016 | 29 Jul 2023 | 28 Jul 2024 |
| 903 | stepbystepecc.com | Network Solutions, LLC | 1 Aug 2016 | 2 Jul 2024 | 1 Aug 2025 |
| 904 | stepbystep-j.com | - | 1 Aug 2016 | 1 Aug 2016 | 1 Aug 2017 |
| 905 | stepbystepcollege.com | eNom, Inc. | 30 Apr 2019 | 30 Apr 2019 | 30 Apr 2020 |
| 906 | stepbystepcollege.net | Tucows Domains Inc. | 27 Jul 2011 | 31 Jul 2016 | 27 Jul 2016 |
| 907 | stepbystepcollege.org | - | 27 Jul 2011 | 27 Jul 2011 | 27 Jul 2017 |
| 908 | stepbystepjax.com | - | 8 Nov 2006 | 8 Nov 2006 | 8 Nov 2016 |
| 909 | stepbystepprogramming.com | DropCatch.com 1068 LLC | 21 Oct 2017 | 22 Oct 2017 | 21 Oct 2018 |
| 910 | stepbystepchildcarelearninghome.com | - | 4 Aug 2016 | 4 Aug 2016 | 4 Aug 2017 |
| 911 | stepbysteplearningacademy.com | - | 6 Aug 2016 | 6 Aug 2016 | 6 Aug 2017 |
| 912 | stepbysteppregnancyguide.com | NameCheap, Inc. | 8 Jan 2020 | 9 Dec 2023 | 8 Jan 2025 |
| 913 | stepbystepstartups.com | GoDaddy.com, LLC | 6 Oct 2021 | 7 Oct 2023 | 6 Oct 2024 |
| 914 | stepbystepdevelopment.com | GoDaddy.com, LLC | 5 May 2020 | 6 May 2024 | 5 May 2025 |
| 915 | stepbysteprestaurants.com | Google, Inc. | 10 Aug 2016 | 9 Sep 2017 | 10 Aug 2017 |
| 916 | stepbystephyap.com | Beijing Lanhai Jiye Technology Co., Ltd | 28 Oct 2020 | 5 Aug 2024 | 28 Oct 2024 |
| 917 | stepbystepingles.com | - | 14 Aug 2016 | 14 Aug 2016 | 14 Aug 2018 |
| 918 | stepbystepdone.com | - | 26 Aug 2016 | 26 Aug 2016 | 26 Aug 2017 |
| 919 | stepbystephope.com | GoDaddy.com, LLC | 3 May 2019 | 3 May 2019 | 3 May 2020 |
| 920 | stepbystepdogtraining.com | Porkbun, LLC | 22 Jan 2022 | 22 Jan 2022 | 22 Jan 2032 |
| 921 | stepbystepethiopia.com | Network Solutions, LLC | 28 Aug 2016 | 30 Aug 2024 | 28 Aug 2025 |
| 922 | stepbystepstock.com | Google, Inc. | 5 Sep 2016 | 5 Oct 2017 | 5 Sep 2017 |
| 923 | stepbystepstocks.com | Tucows Domains Inc. | 23 Jun 2019 | 23 Jun 2019 | 23 Jun 2020 |
| 924 | stepbysteponlinesuccess.com | eNom, Inc. | 6 Sep 2016 | 19 Oct 2017 | 6 Sep 2017 |
| 925 | stepbysteproadmap.com | GoDaddy.com, LLC | 28 Feb 2021 | 29 Feb 2024 | 28 Feb 2025 |
| 926 | stepbystepremodeling.com | Google, Inc. | 7 Sep 2016 | 6 Jun 2024 | 7 Sep 2025 |
| 927 | stepbystephowto.com | NameCheap, Inc. | 24 Jul 2019 | 24 Jun 2024 | 24 Jul 2025 |
| 928 | stepbystepmakemoney.com | - | 7 Sep 2016 | 7 Sep 2016 | 7 Sep 2017 |
| 929 | stepbystepmlmuniversity.com | - | 8 Sep 2016 | 8 Sep 2016 | 8 Sep 2017 |
| 930 | stepbystepcraigslisttraining.com | GoDaddy.com, LLC | 12 Jun 2019 | 12 Jun 2019 | 12 Jun 2020 |
| 931 | stepbystepbaby.com | Tucows Domains Inc. | 5 Mar 2020 | 20 Feb 2024 | 5 Mar 2025 |
| 932 | stepbysteponechildatatime.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 30 Nov 2021 | 30 Nov 2021 | 30 Nov 2022 |
| 933 | stepbysteppregnancy.com | eNom, Inc. | 11 Sep 2016 | 23 Oct 2017 | 11 Sep 2017 |
| 934 | stepbystepweddingplanning.com.au | NorthNames Inc | - | 19 May 2015 | - |
| 935 | stepbystepresultsplan.com | 1&1 Internet AG | 17 Jan 2013 | 18 Jan 2017 | 17 Jan 2018 |
| 936 | stepbystepfinancialplanning.com | GoDaddy.com, LLC | 26 Feb 2008 | 27 Feb 2024 | 26 Feb 2026 |
| 937 | stepbystepplans.com | GoDaddy.com, LLC | 30 Jul 2009 | 31 Jul 2024 | 30 Jul 2025 |
| 938 | stepbystepplanning.com | GoDaddy.com, LLC | 30 Jul 2009 | 31 Jul 2024 | 30 Jul 2025 |
| 939 | stepbystephomebusinessplan.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Apr 2009 | 12 Apr 2018 | 13 Apr 2019 |
| 940 | stepbystepmarketingplan.me | GoDaddy.com, LLC | 23 Aug 2015 | 24 Aug 2017 | 23 Aug 2019 |
| 941 | stepbystepweddingplan.com | GoDaddy.com, LLC | 30 Jul 2009 | 31 Jul 2024 | 30 Jul 2025 |
| 942 | stepbystepplan.com | NameCheap, Inc. | 18 Oct 2022 | 18 Oct 2022 | 18 Oct 2023 |
| 943 | stepbystepeventplanning.com | GoDaddy.com, LLC | 8 Apr 2009 | 8 Apr 2016 | 8 Apr 2017 |
| 944 | stepbystepestateplanning.com | GoDaddy.com, LLC | 4 May 2022 | 5 May 2024 | 4 May 2026 |
| 945 | stepbystepmassage.com | GoDaddy.com, LLC | 12 Sep 2016 | 1 Sep 2024 | 12 Sep 2024 |
| 946 | stepbysteptomakemoney.com | - | 14 Sep 2016 | 14 Sep 2016 | 14 Sep 2017 |
| 947 | stepbystepsystemtomakemoney.com | - | 14 Sep 2016 | 14 Sep 2016 | 14 Sep 2017 |
| 948 | stepbystepforgirls.org | GoDaddy.com, LLC | 16 Sep 2016 | 28 Oct 2017 | 16 Sep 2018 |
| 949 | stepbysteptoronto.com | Tucows Domains Inc. | 17 Sep 2016 | 21 Sep 2017 | 17 Sep 2017 |
| 950 | stepbysteplifecoachingcenter.com | GoDaddy.com, LLC | 21 Aug 2020 | 14 Aug 2024 | 21 Aug 2025 |
| 951 | stepbysteplifecoachingcenter.org | GoDaddy.com, LLC | 11 Apr 2018 | 23 Jul 2024 | 11 Apr 2025 |
| 952 | stepbystepweddingplans.com | GoDaddy.com, LLC | 30 Jul 2009 | 31 Jul 2024 | 30 Jul 2025 |
| 953 | stepbysteppartners.com | GoDaddy.com, LLC | 15 Nov 2015 | 16 Nov 2023 | 15 Nov 2025 |
| 954 | stepbystepltd.com | GoDaddy.com, LLC | 28 Jul 2014 | 29 Jul 2024 | 28 Jul 2029 |
| 955 | stepbystepacd.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 Sep 2016 | 21 Sep 2017 | 19 Sep 2018 |
| 956 | stepbystepseikatsu.org | GMO Internet Inc. | 23 Sep 2016 | 3 Nov 2017 | 23 Sep 2018 |
| 957 | stepbystepaffiliatesuccess.com | eNom, Inc. | 26 Sep 2016 | 7 Nov 2017 | 26 Sep 2017 |
| 958 | stepbystepbpo.com | GoDaddy.com, LLC | 10 Jun 2019 | 10 Jun 2019 | 10 Jun 2020 |
| 959 | stepbystepmlm.com | GoDaddy.com, LLC | 12 Mar 2019 | 12 Mar 2019 | 12 Mar 2020 |
| 960 | stepbystepstyleforbusymoms.com | FastDomain Inc. | 28 Sep 2016 | 28 Sep 2017 | 28 Sep 2018 |
| 961 | stepbystepwithpeter.com | eNom, Inc. | 29 Sep 2016 | 10 Nov 2017 | 29 Sep 2017 |
| 962 | stepbystepfloors.com | TurnCommerce, Inc. DBA NameBright.com | 17 Dec 2018 | 11 Dec 2020 | 17 Dec 2024 |
| 963 | stepbystepprek.org | GoDaddy.com, LLC | 29 Sep 2016 | 10 Nov 2017 | 29 Sep 2018 |
| 964 | stepbystephcs.com | register.com, Inc. | 30 Sep 2016 | 14 Sep 2017 | 30 Sep 2018 |
| 965 | stepbystepchildren.com | eNom, Inc. | 11 Feb 2009 | 12 Jun 2024 | 11 Feb 2025 |
| 966 | stepbystepvegetablegardening.com | ALIBABA.COM SINGAPORE E-COMMERCE PRIVATE LIMITED | 8 Oct 2021 | 8 Oct 2021 | 8 Oct 2022 |
| 967 | stepbystepleadattraction.com | GoDaddy.com, LLC | 28 Feb 2012 | 19 Feb 2015 | 28 Feb 2017 |
| 968 | stepbystepproducts.com | Hosting Concepts B.V. dba Openprovider | 18 Nov 2022 | 29 Dec 2023 | 18 Nov 2023 |
| 969 | stepbystepfasten.com | Dynadot3 LLC | 29 Oct 2021 | 29 Oct 2021 | 29 Oct 2022 |
| 970 | stepbysteplearningonline.com | GoDaddy.com, LLC | 12 Jun 2012 | 13 Jun 2016 | 12 Jun 2017 |
| 971 | stepbystepuniversity.com | 1API GmbH | 17 Mar 2020 | 31 May 2023 | 17 Mar 2023 |
| 972 | stepbystepprofessionaldrivingschool.com | register.com, Inc. | 25 Jun 2011 | 30 Mar 2022 | 25 Jun 2027 |
| 973 | stepbystep-nursery.com | GoDaddy.com, LLC | 3 Sep 2012 | 8 Sep 2016 | 3 Sep 2017 |
| 974 | stepbystepprojectmanagement.com | eNom, Inc. | 25 Apr 2013 | 18 Apr 2024 | 25 Apr 2025 |
| 975 | stepbystepconnection.com | Domain.com, LLC | 1 Mar 2013 | 15 Sep 2015 | 1 Mar 2018 |
| 976 | stepbystepfootwork.com | 1&1 Internet AG | 21 Jan 2013 | 5 Oct 2018 | 21 Jan 2025 |
| 977 | stepbystepsales.com | NameCheap, Inc. | 26 Mar 2023 | 28 Mar 2024 | 26 Mar 2025 |
| 978 | stepbystepvideoguides.com | Wild West Domains, LLC | 28 May 2014 | 29 May 2016 | 28 May 2017 |
| 979 | stepbystepwirejewelry.com | Dynadot13 LLC | 22 Oct 2021 | 25 Oct 2021 | 22 Oct 2022 |
| 980 | stepbystepshoebank.com | Tucows Domains Inc. | 13 Jan 2011 | 29 Dec 2023 | 13 Jan 2025 |
| 981 | stepbystepds.com | 1&1 Internet AG | 4 Jun 2010 | 22 May 2024 | 4 Jun 2025 |
| 982 | stepbysteprun.com | GoDaddy.com, LLC | 20 May 2010 | 28 Aug 2021 | 20 May 2027 |
| 983 | stepbystepguides.com | Dynadot, LLC | 14 Sep 2021 | 18 Jul 2024 | 14 Sep 2024 |
| 984 | stepbystepincome.com | Blue Razor Domains, LLC | 10 Apr 2024 | 10 Apr 2024 | 10 Apr 2025 |
| 985 | stepbystepleadcapturemarketing.com | GoDaddy.com, LLC | 28 Feb 2012 | 19 Feb 2015 | 28 Feb 2017 |
| 986 | stepbystepdanceacademy.com | GoDaddy.com, LLC | 2 May 2006 | 31 Oct 2022 | 2 May 2026 |
| 987 | stepbystepamerica.com | Porkbun, LLC | 13 Jul 2005 | 12 Jul 2024 | 13 Jul 2025 |
| 988 | stepbystepvideoguide.com | Wild West Domains, LLC | 28 May 2014 | 28 May 2016 | 28 May 2017 |
| 989 | stepbystep-schulranzen-spezialist.com | PSI-USA, Inc. dba Domain Robot | 5 Oct 2006 | 24 Nov 2015 | 5 Oct 2016 |
| 990 | stepbystepstripping.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Aug 2021 | 24 Aug 2024 | 23 Aug 2025 |
| 991 | stepbystepeduplay.com | GoDaddy.com, LLC | 27 Mar 2019 | 27 Mar 2019 | 27 Mar 2020 |
| 992 | stepbystepleadcapturemarketingsystem.com | GoDaddy.com, LLC | 28 Feb 2012 | 19 Feb 2015 | 28 Feb 2017 |
| 993 | stepbystepcommissions.com | GoDaddy.com, LLC | 4 Feb 2011 | 26 Dec 2023 | 4 Feb 2025 |
| 994 | stepbystepjaguar.com | 1&1 Internet AG | 4 Apr 2014 | 21 Mar 2018 | 4 Apr 2025 |
| 995 | stepbystephabitatges.com | Dinahosting s.l. | 12 Dec 2023 | 20 Mar 2024 | 12 Dec 2024 |
| 996 | stepbystepshoes.com | GoDaddy.com, LLC | 19 Oct 2005 | 2 May 2023 | 2 May 2025 |
| 997 | stepbystep-projects.com | Metaregistrar BV Applications | 6 Jan 2010 | 8 Jan 2024 | 6 Jan 2025 |
| 998 | stepbystepeb5.com | - | 18 Jan 2024 | 21 Jan 2024 | 18 Jan 2025 |
| 999 | stepbystep-india.com | - | 30 Aug 2021 | 2 Sep 2021 | 30 Aug 2022 |
| 1000 | stepbystepformula.com | Wild West Domains, LLC | 23 Feb 2010 | 24 Feb 2016 | 23 Feb 2017 |
Displaying 1,000 out of 3,696 domains starting with the keyword "STEPBYSTEP". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=stepbystep
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |