With support for 
Keyword: STICHT
Reverse Whois » KEYWORD [sticht ] { 11,756 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | sticht.com | Porkbun, LLC | 16 Jun 1998 | 9 Aug 2024 | 15 Jun 2032 |
| 2 | sticht.biz | 1&1 Internet AG | 6 Apr 2006 | 21 May 2024 | 5 Apr 2025 |
| 3 | sticht.info | 1&1 Internet AG | 2 Jul 2002 | 16 Aug 2024 | 2 Jul 2025 |
| 4 | sticht.net | Porkbun, LLC | 4 Sep 1998 | 17 Aug 2022 | 3 Sep 2031 |
| 5 | sticht.org | Porkbun, LLC | 4 Sep 1998 | 10 Aug 2024 | 3 Sep 2025 |
| 6 | sticht.xyz | Dynadot, LLC | 18 Jan 2022 | 29 Mar 2024 | 18 Jan 2024 |
| 7 | sticht.mobi | RegistryGate GmbH | 5 Nov 2017 | 6 Aug 2023 | 5 Nov 2023 |
| 8 | sticht.co | GoDaddy.com, LLC | 23 Nov 2022 | 12 Dec 2023 | 23 Nov 2023 |
| 9 | sticht.berlin | 1&1 Internet AG | 18 Mar 2014 | 2 Sep 2014 | 18 Mar 2025 |
| 10 | sticht.autos | Ledl.net GmbH | 7 Jan 2024 | 12 Feb 2025 | 7 Jan 2025 |
| 11 | sticht.nl | - | 28 Oct 2003 | 28 Jan 2025 | - |
| 12 | sticht.rocks | Google, Inc. | 18 Feb 2022 | 8 Feb 2025 | 18 Feb 2026 |
| 13 | sticht.se | - | 27 Sep 2005 | 23 Jul 2024 | 27 Sep 2025 |
| 14 | sticht.eu | RegistryGate GmbH | - | - | - |
| 15 | stichtingebola.com | NameWeb BVBA | 21 Oct 2014 | 20 Oct 2017 | 21 Oct 2018 |
| 16 | stichtingababa.com | Key-Systems GmbH | 21 Oct 2014 | 25 Nov 2017 | 21 Oct 2018 |
| 17 | stichtinggood.nl | - | 18 Jan 2010 | 30 Nov 2021 | - |
| 18 | stichtingmilieunet.nl | - | 26 Feb 2024 | 9 Sep 2024 | - |
| 19 | stichtingso.nl | - | 1 Jun 2006 | 14 Apr 2020 | - |
| 20 | stichtingstiefmoeders.nl | - | 27 Jul 2006 | 17 Mar 2021 | - |
| 21 | stichtingabelschuiling.nl | - | - | - | - |
| 22 | stichtingargus.nl | One.com A/S | 28 Nov 2005 | 10 Oct 2024 | - |
| 23 | stichtingibk.nl | - | 28 Oct 2013 | 17 Apr 2023 | - |
| 24 | stichtingsecretgarden.nl | - | 6 Oct 2008 | 10 Dec 2024 | - |
| 25 | stichtingleeuw.nl | - | 24 Aug 2011 | 1 Nov 2022 | - |
| 26 | stichtingbodypaint.com | PSI-USA, Inc. dba Domain Robot | 24 Oct 2014 | 24 Oct 2014 | 24 Oct 2015 |
| 27 | stichtingbabyspullen.nl | - | 26 Sep 2010 | 14 Nov 2024 | - |
| 28 | stichtingmediwiet.nl | - | 21 Jul 2012 | 26 Nov 2024 | - |
| 29 | stichtingnailprofessionals.com | Realtime Register B.V. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 30 | stichtingfutureinternational.com | GoDaddy.com, LLC | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 31 | stichtite.com | NameCheap, Inc. | 29 Dec 2023 | 29 Dec 2023 | 29 Dec 2033 |
| 32 | stichtingnailprofessionals.org | Realtime Register B.V. | 27 Oct 2014 | 27 Oct 2014 | 27 Oct 2015 |
| 33 | stichtingsportsponsoring.com | Cronon AG | 29 Oct 2014 | 29 Oct 2014 | 29 Oct 2017 |
| 34 | stichtingsaamwerk.com | eNom, Inc. | 29 Oct 2014 | 29 Sep 2017 | 29 Oct 2018 |
| 35 | stichtinglunalight.com | Hosting Concepts B.V. dba Openprovider | 29 Oct 2014 | 29 Oct 2017 | 29 Oct 2018 |
| 36 | stichtech.com | TurnCommerce, Inc. DBA NameBright.com | 3 Jun 2021 | 6 May 2023 | 3 Jun 2025 |
| 37 | stichtingoengbigiesma.com | Tucows Domains Inc. | 27 Oct 2013 | 31 Oct 2014 | 27 Oct 2015 |
| 38 | stichtingwelkom.org | Key-Systems GmbH | 29 Oct 2014 | 30 Oct 2017 | 29 Oct 2018 |
| 39 | stichtingiqplus.com | Tucows Domains Inc. | 28 Oct 2010 | 1 Nov 2014 | 28 Oct 2015 |
| 40 | stichtingamabella.com | NameWeb BVBA | 31 Oct 2014 | 30 Oct 2017 | 31 Oct 2018 |
| 41 | stichtingoudsassenheim.org | Tucows Domains Inc. | 30 Oct 2014 | 3 Nov 2015 | 30 Oct 2016 |
| 42 | stichtingtarget.com | Hosting Concepts B.V. dba Openprovider | 1 Nov 2014 | 16 Oct 2017 | 1 Nov 2018 |
| 43 | stichtingwakkermens.org | Tucows Domains Inc. | 31 Oct 2014 | 7 Oct 2024 | 31 Oct 2025 |
| 44 | stichtingsoso.org | Tucows Domains Inc. | 31 Oct 2014 | 19 Dec 2017 | 31 Oct 2018 |
| 45 | stichting-cascade.nl | - | 3 May 2000 | 15 Jul 2022 | - |
| 46 | stichterauctions.com | GoDaddy.com, LLC | 4 Apr 2001 | 5 Apr 2023 | 4 Apr 2025 |
| 47 | stichtingveranwoordgrondstofbeheer.org | Tucows Domains Inc. | 28 Oct 2009 | 1 Nov 2014 | 28 Oct 2015 |
| 48 | stichtingfamiliehart.nl | - | - | - | - |
| 49 | stichtingvoor.org | Hosting Concepts B.V. dba Openprovider | 3 Nov 2014 | 4 Jun 2017 | 3 Nov 2017 |
| 50 | stichtingnewstart.com | Cronon AG | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2018 |
| 51 | stichting-unitaire-wetenschap.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2014 | 4 Nov 2024 | 5 Nov 2025 |
| 52 | stichtingkarelbijlsmavoorafrika.org | Tucows Domains Inc. | 18 Aug 2014 | 22 Aug 2015 | 18 Aug 2016 |
| 53 | stichtingrotterdamsestrafsrechtswinkel.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 18 Aug 2014 | 18 Aug 2014 | 18 Aug 2015 |
| 54 | stichting-pay.com | Cronon AG | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 55 | stichtingpay.com | Cronon AG | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 56 | stichtingvivatarbor.com | Tucows Domains Inc. | 17 Aug 2010 | 20 Aug 2014 | 17 Aug 2015 |
| 57 | stichtingzwemles.com | Realtime Register B.V. | 20 Aug 2014 | 20 Aug 2014 | 20 Aug 2015 |
| 58 | stichtingobj.com | eNom, Inc. | 12 Jan 2015 | 15 Dec 2016 | 12 Jan 2018 |
| 59 | stichtingpisquarefoundation.com | register.com, Inc. | 12 Jan 2015 | 5 Jan 2025 | 12 Jan 2026 |
| 60 | stichtingnewstart.org | Cronon AG | 5 Nov 2014 | 6 Nov 2017 | 5 Nov 2018 |
| 61 | stichtingnewstart.net | Cronon AG | 5 Nov 2014 | 5 Nov 2014 | 5 Nov 2018 |
| 62 | stichting-unitaire-wetenschap.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Nov 2014 | 9 Nov 2024 | 5 Nov 2025 |
| 63 | stichtingexchange.com | Hosting Concepts B.V. dba Openprovider | 28 Feb 2015 | 28 Feb 2015 | 28 Feb 2016 |
| 64 | stichtingkwartiermakerpodiumzuid.com | Key-Systems GmbH | 14 Apr 2015 | 13 Apr 2017 | 14 Apr 2018 |
| 65 | stichtingkwartiermakerpodiumzuid.org | Key-Systems GmbH | 14 Apr 2015 | 15 Apr 2017 | 14 Apr 2018 |
| 66 | stichtinglobipikien.org | Launchpad, Inc. | 15 Aug 2016 | 26 Sep 2017 | 15 Aug 2018 |
| 67 | stichtingpodiumzuid.com | Key-Systems GmbH | 14 Apr 2015 | 13 Apr 2017 | 14 Apr 2018 |
| 68 | stichtingpodiumzuid.org | Key-Systems GmbH | 14 Apr 2015 | 15 Apr 2017 | 14 Apr 2018 |
| 69 | stichtingpratenovergezondheid.org | Key-Systems GmbH | 14 Apr 2015 | 15 Apr 2017 | 14 Apr 2018 |
| 70 | stichtingtherevelation.com | Mijn InternetOplossing B.V. | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 71 | stichtingmarexa.com | Tucows Domains Inc. | 20 Aug 2013 | 23 Aug 2014 | 20 Aug 2015 |
| 72 | stichtingnovi.com | DropCatch.com 409 LLC | 8 Nov 2014 | 9 Nov 2016 | 8 Nov 2017 |
| 73 | stichtinggrotebroer.com | Cronon AG | 8 Nov 2014 | 8 Nov 2014 | 8 Nov 2015 |
| 74 | stichtingbcs.com | Key-Systems GmbH | 12 Aug 2014 | 12 Aug 2014 | 12 Aug 2015 |
| 75 | stichtingdefensiemusea.com | Tucows Domains Inc. | 26 Aug 2014 | 6 Nov 2023 | 26 Aug 2023 |
| 76 | stichtingkotu.com | Realtime Register B.V. | 26 Aug 2014 | 26 Aug 2014 | 26 Aug 2015 |
| 77 | stichtingnaomi.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 25 Aug 2014 | 1 Aug 2024 | 25 Aug 2025 |
| 78 | stichtingoobw.org | Tucows Domains Inc. | 25 Aug 2014 | 1 Aug 2024 | 25 Aug 2025 |
| 79 | stichtingpluswonen.net | Acens Technologies, S.L.U. | 14 Aug 2014 | 14 Aug 2014 | 14 Aug 2015 |
| 80 | stichtinglapse.com | Network Solutions, LLC | 27 Aug 2014 | 27 Aug 2014 | 27 Aug 2015 |
| 81 | stichtingbigboyschuil.org | Realtime Register B.V. | 27 Aug 2014 | - | 27 Aug 2015 |
| 82 | stichtingpassaat.com | Cronon AG | 11 Nov 2014 | 31 Dec 2024 | 11 Nov 2025 |
| 83 | stichtinlowenangarharoosten.org | Tucows Domains Inc. | 6 Nov 2012 | 10 Nov 2014 | 6 Nov 2015 |
| 84 | stichtinginnovatiefleren.com | Key-Systems GmbH | 13 Nov 2014 | 18 Jan 2017 | 13 Nov 2018 |
| 85 | stichtingdo.org | Cronon AG | 11 Sep 2014 | 12 Sep 2017 | 11 Sep 2018 |
| 86 | stichtingduurzaamontwikkelen.org | Cronon AG | 11 Sep 2014 | - | 11 Sep 2015 |
| 87 | stichtingduurzameontwikkeling.org | Cronon AG | 11 Sep 2014 | 12 Sep 2017 | 11 Sep 2018 |
| 88 | stichting-now.com | Network Solutions, LLC | 12 Sep 2014 | 12 Sep 2014 | 12 Sep 2015 |
| 89 | stichtingpower4every1.com | - | 30 Aug 2014 | 30 Aug 2014 | 30 Aug 2017 |
| 90 | stichtsgenootschapharmelen.com | Marcaria.com International, Inc. | 14 Nov 2014 | 14 Nov 2014 | 14 Nov 2015 |
| 91 | stichtingskasuaris.com | Hosting Concepts B.V. dba Openprovider | 14 Nov 2014 | 24 Jun 2015 | 14 Nov 2017 |
| 92 | stichtingkitabo.com | FBS Inc. | 13 May 2016 | 26 Jul 2017 | 13 May 2018 |
| 93 | stichtingpublicperformance.com | Tucows Domains Inc. | 28 Aug 2009 | 1 Sep 2014 | 28 Aug 2015 |
| 94 | stichtingpublicperformance.net | Tucows Domains Inc. | 28 Aug 2009 | 31 Aug 2014 | 28 Aug 2015 |
| 95 | stichtingsavechild.net | - | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2017 |
| 96 | stichting-un1ek.info | Tucows Domains Inc. | 1 Sep 2014 | 8 Aug 2024 | 1 Sep 2025 |
| 97 | stichtingbigboy.com | Network Solutions, LLC | 1 Sep 2014 | 1 Sep 2014 | 1 Sep 2015 |
| 98 | stichtingpublicperformance.org | Tucows Domains Inc. | 28 Aug 2009 | 1 Sep 2014 | 28 Aug 2015 |
| 99 | stichtingdian.org | FastDomain Inc. | 13 Nov 2014 | 12 Dec 2023 | 13 Nov 2026 |
| 100 | stichtingmerkfriesland.com | Acens Technologies, S.L.U. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 101 | stichtingmerkfryslan.com | Acens Technologies, S.L.U. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 102 | stichtingparadigma.com | Realtime Register B.V. | 2 Sep 2014 | 2 Sep 2014 | 2 Sep 2015 |
| 103 | stichtingsavechild.com | Hosting Concepts B.V. dba Openprovider | 22 Oct 2018 | 22 Oct 2018 | 22 Oct 2019 |
| 104 | stichtingga.com | Easyspace LTD | 15 Sep 2014 | 15 Sep 2016 | 15 Sep 2017 |
| 105 | stichtingusawa.com | Mijn InternetOplossing B.V. | 15 Sep 2014 | 15 Sep 2014 | 15 Sep 2015 |
| 106 | stichtingamaani.org | Launchpad, Inc. | 14 Jan 2018 | 30 Jan 2018 | 14 Jan 2019 |
| 107 | stichtingtop.com | Tucows Domains Inc. | 17 Sep 2014 | 21 Sep 2015 | 17 Sep 2016 |
| 108 | stichtingleeuw.com | Key-Systems GmbH | 26 Aug 2016 | 18 Jan 2025 | 26 Aug 2025 |
| 109 | stichtingzwemdiploma.com | Realtime Register B.V. | 18 Sep 2014 | 18 Sep 2014 | 18 Sep 2015 |
| 110 | stichtingnostrimundi.com | OVH sas | 16 Nov 2013 | 16 Nov 2017 | 16 Nov 2018 |
| 111 | stichtingkompas.com | Tucows Domains Inc. | 17 Nov 2014 | 26 Dec 2017 | 17 Nov 2018 |
| 112 | stichtingkasuaris.com | Hosting Concepts B.V. dba Openprovider | 17 Nov 2014 | 12 Nov 2015 | 17 Nov 2018 |
| 113 | stichtingechoes.com | Xin Net Technology Corporation | 13 Nov 2013 | 17 Nov 2014 | 13 Nov 2015 |
| 114 | stichting-nostrimundi.com | OVH sas | 16 Nov 2013 | 16 Nov 2017 | 16 Nov 2018 |
| 115 | stichtingerfgoedstein.com | Tucows Domains Inc. | 2 Sep 2012 | 5 Sep 2014 | 2 Sep 2015 |
| 116 | stichtingnotas.com | Tucows Domains Inc. | 3 Sep 2002 | 6 Sep 2014 | 3 Sep 2015 |
| 117 | stichtingcactus.org | Cronon AG | 17 Nov 2014 | 18 Nov 2016 | 17 Nov 2017 |
| 118 | stichtingrafaela.com | Key-Systems GmbH | 18 Nov 2014 | 18 Jan 2025 | 18 Nov 2025 |
| 119 | stichtingdude.com | Metaregistrar BV Applications | 18 Nov 2014 | 20 Nov 2024 | 18 Nov 2025 |
| 120 | stichting365.com | GoDaddy.com, LLC | 18 Nov 2014 | 18 Nov 2014 | 18 Nov 2015 |
| 121 | stichting2gezer.com | Tucows Domains Inc. | 18 Nov 2014 | 20 Oct 2017 | 18 Nov 2018 |
| 122 | stichter.com | Fabulous.com Pty Ltd. | 3 Sep 2007 | 13 Dec 2024 | 3 Sep 2026 |
| 123 | stichting-eu-keurmerk.com | Realtime Register B.V. | 8 Sep 2014 | 28 Dec 2016 | 8 Sep 2017 |
| 124 | stichtingbassetherplaatsennederland.com | Tucows Domains Inc. | 5 Sep 2011 | 9 Sep 2014 | 5 Sep 2015 |
| 125 | stichtingcareforpeople.com | Acens Technologies, S.L.U. | 9 Sep 2014 | 9 Sep 2014 | 9 Sep 2015 |
| 126 | stichtingideefix.com | Tucows Domains Inc. | 9 Sep 2014 | 11 Aug 2024 | 9 Sep 2025 |
| 127 | stichtingsabi.org | Key-Systems GmbH | 2 Oct 2014 | 3 Oct 2017 | 2 Oct 2018 |
| 128 | stichting-noaberschap.com | Cronon AG | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 129 | stichtinghawre.com | Key-Systems GmbH | 3 Oct 2014 | 3 Oct 2014 | 3 Oct 2015 |
| 130 | stichtingoompaul.com | Metaregistrar BV Applications | 3 Oct 2014 | 5 Oct 2024 | 3 Oct 2025 |
| 131 | stichtingwijsamen.com | Tucows Domains Inc. | 3 Oct 2014 | 4 Sep 2024 | 3 Oct 2025 |
| 132 | stichtcode.com | Hetzner Online AG | 10 Sep 2014 | 25 Oct 2017 | 10 Sep 2018 |
| 133 | stichting-hogar.net | Internet Domain Services BS Corp | 22 Oct 2019 | 22 Oct 2019 | 22 Oct 2020 |
| 134 | stichtingdog.org | Hosting Concepts B.V. dba Openprovider | 4 Oct 2014 | 9 Oct 2024 | 4 Oct 2025 |
| 135 | stichtinggroeit.org | Key-Systems GmbH | 19 Nov 2014 | - | 19 Nov 2015 |
| 136 | stichting-groeit.org | Key-Systems GmbH | 19 Nov 2014 | - | 19 Nov 2015 |
| 137 | stichtingtiv.com | Network Solutions, LLC | 5 Oct 2014 | 5 Oct 2014 | 5 Oct 2015 |
| 138 | stichtinglisanne.com | Tucows Domains Inc. | 20 Sep 2013 | 23 Sep 2014 | 20 Sep 2015 |
| 139 | stichtingsos.org | Cronon AG | 6 Oct 2014 | 20 Nov 2024 | 6 Oct 2025 |
| 140 | stichtingstophetpesten.com | GMO Internet Inc. | 21 Dec 2017 | 22 Dec 2017 | 21 Dec 2018 |
| 141 | stichtingree.info | Cronon AG | 20 Nov 2014 | - | 20 Nov 2015 |
| 142 | stichtingkinderidee.com | Realtime Register B.V. | 21 Nov 2014 | 28 Dec 2016 | 21 Nov 2018 |
| 143 | stichtingcell.org | NameWeb BVBA | 7 Oct 2014 | 4 Dec 2017 | 7 Oct 2018 |
| 144 | stichtingdakloos.org | Key-Systems GmbH | 7 Oct 2014 | 8 Oct 2016 | 7 Oct 2017 |
| 145 | stichtingree.com | Cronon AG | 7 Oct 2014 | 7 Oct 2014 | 7 Oct 2015 |
| 146 | stichtingree.org | Cronon AG | 7 Oct 2014 | - | 7 Oct 2015 |
| 147 | stichtinggroeimee.org | Key-Systems GmbH | 20 Nov 2014 | - | 20 Nov 2015 |
| 148 | stichtingcareofpeople.com | Cronon AG | 8 Oct 2014 | 8 Oct 2014 | 8 Oct 2015 |
| 149 | stichtingcareofpeople.org | Cronon AG | 8 Oct 2014 | - | 8 Oct 2015 |
| 150 | stichtingbasis.com | Tucows Domains Inc. | 22 Nov 2014 | 26 Nov 2015 | 22 Nov 2016 |
| 151 | stichtingtango.org | Key-Systems GmbH | 28 Sep 2014 | 29 Sep 2017 | 28 Sep 2018 |
| 152 | stichtingtango.com | Key-Systems GmbH | 28 Sep 2014 | 3 Nov 2017 | 28 Sep 2018 |
| 153 | stichtingkweekje.com | Key-Systems GmbH | 26 Sep 2014 | 12 Nov 2016 | 26 Sep 2018 |
| 154 | stichtingkasumaidunia.com | GoDaddy.com, LLC | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 155 | stichtingkaapkoru.com | Key-Systems GmbH | 25 Sep 2014 | 24 Sep 2017 | 25 Sep 2018 |
| 156 | stichtinggreenict.com | Key-Systems GmbH | 26 Sep 2014 | 1 Nov 2017 | 26 Sep 2018 |
| 157 | stichtingcalebfoundation.com | Key-Systems GmbH | 26 Sep 2014 | 18 Jan 2025 | 26 Sep 2025 |
| 158 | stichtingcaleb.com | Key-Systems GmbH | 26 Sep 2014 | 18 Jan 2025 | 26 Sep 2025 |
| 159 | stichtagx.com | Key-Systems GmbH | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 160 | stichtinghibernate.com | Tucows Domains Inc. | 24 Nov 2014 | 6 Dec 2016 | 24 Nov 2017 |
| 161 | stichtingdoen.com | DropCatch.com 535 LLC | 12 Feb 2016 | 13 Feb 2017 | 12 Feb 2018 |
| 162 | stichtingvancoothhoeve.com | Key-Systems GmbH | 17 Oct 2014 | 21 Nov 2016 | 17 Oct 2017 |
| 163 | stichtinghulpvoordesenior.com | Hosting Concepts B.V. dba Openprovider | 13 Oct 2014 | 13 Oct 2016 | 13 Oct 2017 |
| 164 | stichtingsokosoko.com | Network Solutions, LLC | 13 Oct 2014 | 13 Oct 2014 | 13 Oct 2015 |
| 165 | stichtinggoedvoorelkaar.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 25 Nov 2014 | 25 Nov 2014 | 25 Nov 2015 |
| 166 | stichtingjetwinsaircraft01.com | Hosting Concepts B.V. dba Openprovider | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 167 | stichtingharmonia.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 168 | stichtingeducatienederland.com | PSI-USA, Inc. dba Domain Robot | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 169 | stichtingconsumentenondernemersbelang.com | Tucows Domains Inc. | 16 Oct 2013 | 20 Oct 2014 | 16 Oct 2015 |
| 170 | stichtingbalkan.com | eNom, Inc. | 19 Oct 2014 | 19 Oct 2014 | 19 Oct 2015 |
| 171 | stichtv.com | NameCheap, Inc. | 20 Jun 2017 | 21 May 2024 | 20 Jun 2025 |
| 172 | stichtingaanloop.com | Tucows Domains Inc. | 15 Oct 2014 | 19 Oct 2015 | 15 Oct 2016 |
| 173 | stichtinggiz-methodiek.info | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 174 | stichtinggiz-methodiek.net | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 175 | stichtinggizmethodiek.info | NameCheap, Inc. | 3 Mar 2025 | 3 Mar 2025 | 3 Mar 2026 |
| 176 | stichtinggizmethodiek.net | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 177 | stichtinggizmethodiek.org | GoDaddy.com, LLC | 15 Oct 2014 | 15 Oct 2014 | 15 Oct 2015 |
| 178 | stichtingnederlandgezond.info | Tucows Domains Inc. | 12 Oct 2010 | 16 Oct 2014 | 12 Oct 2015 |
| 179 | stichtingnederlandgezond.net | Tucows Domains Inc. | 12 Oct 2010 | 16 Oct 2014 | 12 Oct 2015 |
| 180 | stichtingsar.com | DropCatch.com 1430 LLC | 8 Dec 2017 | 10 Dec 2017 | 8 Dec 2018 |
| 181 | stichtingdayik.com | Register.it SPA | 27 Nov 2014 | 23 May 2024 | 27 Nov 2025 |
| 182 | stichtingnohagroningen.org | Wild West Domains, LLC | 26 Nov 2014 | 26 Oct 2017 | 26 Nov 2018 |
| 183 | stichtingsocialclub.com | Realtime Register B.V. | 1 Dec 2014 | 1 Dec 2014 | 1 Dec 2015 |
| 184 | stichtingspaak.org | Tucows Domains Inc. | 26 Nov 2009 | 30 Nov 2014 | 26 Nov 2015 |
| 185 | stichtingsocialclub.info | Realtime Register B.V. | 1 Dec 2014 | - | 1 Dec 2015 |
| 186 | stichtingwmm.info | Hosting Concepts B.V. dba Openprovider | 4 Dec 2014 | 9 Nov 2016 | 4 Dec 2017 |
| 187 | stichtingwerkgroepmedischemissers.info | Hosting Concepts B.V. dba Openprovider | 4 Dec 2014 | 9 Nov 2016 | 4 Dec 2017 |
| 188 | stichtingwmm.org | Hosting Concepts B.V. dba Openprovider | 4 Dec 2014 | 9 Nov 2016 | 4 Dec 2017 |
| 189 | stichtingwerkgroepmedischemissers.org | Hosting Concepts B.V. dba Openprovider | 4 Dec 2014 | 9 Nov 2016 | 4 Dec 2017 |
| 190 | stichtingahus.org | PSI-USA, Inc. dba Domain Robot | 5 Dec 2014 | 6 Dec 2017 | 5 Dec 2018 |
| 191 | stichtingpcos.com | Realtime Register B.V. | 7 Dec 2014 | 7 Dec 2014 | 7 Dec 2015 |
| 192 | stichterauction.com | GoDaddy.com, LLC | 8 Dec 2014 | 8 Dec 2014 | 8 Dec 2015 |
| 193 | stichtingdehoogeweide.org | Key-Systems GmbH | 8 Dec 2014 | - | 8 Dec 2015 |
| 194 | stichtingbusrampsierre.com | Key-Systems GmbH | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 195 | stichtingstopebola.com | The Registrar Company B.V. | 11 Dec 2014 | 12 Dec 2016 | 11 Dec 2017 |
| 196 | stichtingbusrampsierre.org | Key-Systems GmbH | 10 Dec 2014 | - | 10 Dec 2015 |
| 197 | stichtingbusrampsierre.net | Key-Systems GmbH | 10 Dec 2014 | 10 Dec 2014 | 10 Dec 2015 |
| 198 | stichtingjogja.org | GoDaddy.com, LLC | 11 Dec 2014 | 10 Feb 2015 | 11 Dec 2017 |
| 199 | stichtingderegenboogkatwijk.net | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 11 Dec 2014 | 11 Dec 2014 | 11 Dec 2015 |
| 200 | stichtingdaimoon.org | OnlineNIC, Inc. | 10 May 2017 | 10 Jul 2017 | 10 May 2018 |
| 201 | stichting12q.com | Hosting Concepts B.V. dba Openprovider | 14 Dec 2014 | 14 Dec 2024 | 14 Dec 2025 |
| 202 | stichtingutopia.com | Tucows Domains Inc. | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2015 |
| 203 | stichting-partner.com | Network Solutions, LLC | 15 Dec 2014 | 27 Dec 2016 | 15 Dec 2018 |
| 204 | stichtingnrv.com | Realtime Register B.V. | 16 Dec 2014 | 27 Jan 2018 | 16 Dec 2017 |
| 205 | stichtingtothemax.com | Realtime Register B.V. | 17 Dec 2014 | 19 Dec 2016 | 17 Dec 2017 |
| 206 | stichtingopleiding.com | DROPCATCH.COM 753 LLC | 4 Mar 2018 | 4 Mar 2018 | 4 Mar 2019 |
| 207 | stichtingflow.com | Realtime Register B.V. | 17 Dec 2014 | 17 Dec 2014 | 17 Dec 2015 |
| 208 | stichtingbemore.com | Key-Systems GmbH | 17 Dec 2014 | 18 Dec 2016 | 17 Dec 2017 |
| 209 | stichtingicad.com | Wild West Domains, LLC | 22 Dec 2014 | 22 Dec 2014 | 22 Dec 2015 |
| 210 | stichtingdierenbemiddeling.com | Tucows Domains Inc. | 22 Dec 2014 | 23 Nov 2024 | 22 Dec 2025 |
| 211 | stichtingmimpianak.com | Hosting Concepts B.V. dba Openprovider | 26 Dec 2014 | 26 Dec 2016 | 26 Dec 2017 |
| 212 | stichtingduister.com | Key-Systems GmbH | 29 Dec 2014 | 2 Feb 2017 | 29 Dec 2017 |
| 213 | stichtingdigitaleleermiddelen.com | Key-Systems GmbH | 30 Dec 2014 | 29 Dec 2016 | 30 Dec 2017 |
| 214 | stichtingdigitaleleermiddelen.org | Key-Systems GmbH | 30 Dec 2014 | 31 Dec 2016 | 30 Dec 2017 |
| 215 | stichting-soz.org | Domain.com, LLC | 31 Dec 2014 | 1 Jan 2015 | 31 Dec 2015 |
| 216 | stichtingmunster.info | Tucows Domains Inc. | 1 Jan 2015 | 5 Jan 2016 | 1 Jan 2017 |
| 217 | stichtingbas.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 11 Aug 2015 | 11 Aug 2015 | 11 Aug 2016 |
| 218 | stichtingsportsponsoring.club | Cronon AG | 29 Oct 2014 | 31 Mar 2017 | 28 Oct 2017 |
| 219 | stichtsevecht.catering | Key-Systems, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 220 | stichtingpuntfrl.frl | Metaregistrar BV Applications | 2 Feb 2015 | 3 Feb 2025 | 2 Feb 2026 |
| 221 | stichting.frl | Metaregistrar BV Applications | 2 Feb 2015 | 3 Feb 2025 | 2 Feb 2026 |
| 222 | stichtingb-artvintageaudio.audio | Cronon AG | 16 Feb 2015 | - | 16 Feb 2016 |
| 223 | stichting.help | Tucows Domains Inc. | 16 Feb 2015 | 20 Feb 2016 | 16 Feb 2017 |
| 224 | stichtingzorgopmaat.frl | NameWeb BVBA | 30 Mar 2015 | 1 Apr 2017 | 3 Apr 2018 |
| 225 | stichtingbetterwetter.frl | Key-Systems, LLC | 16 Feb 2015 | 18 May 2017 | 3 Apr 2018 |
| 226 | stichtingbasbacker.frl | Mijndomein.nl BV | 27 Feb 2015 | 3 Apr 2015 | 3 Apr 2016 |
| 227 | stichtingdewerf.frl | Mijndomein.nl BV | 20 Mar 2015 | 2 Apr 2017 | 3 Apr 2018 |
| 228 | stichtinglenafonds.com | Tucows Domains Inc. | 10 Aug 2013 | 14 Aug 2015 | 10 Aug 2016 |
| 229 | stichtingcadre.org | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 13 Aug 2015 | 22 Jul 2017 | 13 Aug 2018 |
| 230 | stichtingfaf.frl | Hosting Concepts B.V. dba Openprovider | 15 Apr 2015 | 5 Jun 2017 | 15 Apr 2018 |
| 231 | stichtingbin.com | Realtime Register B.V. | 6 Jan 2015 | 8 Jan 2017 | 6 Jan 2018 |
| 232 | stichtingelshaddai.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Jan 2015 | 10 Jan 2015 | 10 Jan 2016 |
| 233 | stichtingtransitievergoeding.com | Hosting Concepts B.V. dba Openprovider | 13 Jan 2015 | 13 Jan 2017 | 13 Jan 2018 |
| 234 | stichtingdierenbemiddelingeuropa.com | Tucows Domains Inc. | 13 Jan 2015 | 15 Dec 2024 | 13 Jan 2026 |
| 235 | stichtingbock.com | URL Solutions, Inc. | 20 Mar 2024 | 27 Feb 2025 | 20 Mar 2026 |
| 236 | stichtinglisanga.com | Cronon AG | 15 Jan 2015 | 15 Jan 2015 | 15 Jan 2016 |
| 237 | stichtingbabs.org | Cronon AG | 23 Feb 2019 | 23 Feb 2025 | 23 Feb 2026 |
| 238 | stichtingsmaragd.com | Realtime Register B.V. | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 239 | stichting.amsterdam | Metaregistrar BV Applications | 29 May 2015 | 27 Nov 2024 | 29 May 2025 |
| 240 | stichting.date | Tucows Domains Inc. | 2 Jul 2015 | 28 Jul 2015 | 1 Jul 2016 |
| 241 | stichtinghgi.com | - | 16 Aug 2015 | 16 Aug 2015 | 16 Aug 2017 |
| 242 | stichtingbloedzweettranen.info | Tucows Domains Inc. | 13 Aug 2013 | 17 Aug 2015 | 13 Aug 2016 |
| 243 | stichtingbloedzweettranen.com | Tucows Domains Inc. | 13 Aug 2013 | 17 Aug 2015 | 13 Aug 2016 |
| 244 | stichtingbloedzweetentranen.info | Tucows Domains Inc. | 13 Aug 2013 | 17 Aug 2015 | 13 Aug 2016 |
| 245 | stichtingbloedzweetentranen.com | Tucows Domains Inc. | 13 Aug 2013 | 17 Aug 2015 | 13 Aug 2016 |
| 246 | stichting.golf | Key-Systems, LLC | 5 Aug 2015 | 16 Jan 2025 | 5 Aug 2025 |
| 247 | stichtingnationaalonderwijsfonds.org | Key-Systems GmbH | 17 Jan 2015 | 18 Jan 2017 | 17 Jan 2018 |
| 248 | stichtingrolitos.com | GoDaddy.com, LLC | 17 Aug 2015 | 17 Aug 2015 | 17 Aug 2016 |
| 249 | stichtingolympischstadion.amsterdam | Hosting Concepts B.V. dba Openprovider | 17 Aug 2015 | 16 Aug 2024 | 17 Aug 2025 |
| 250 | stichtingdiogenes.amsterdam | Metaregistrar BV Applications | 17 Aug 2015 | 20 Jul 2017 | 17 Aug 2017 |
| 251 | stichtingcrossingborders.com | Hosting Concepts B.V. dba Openprovider | 17 Aug 2015 | 17 Aug 2024 | 17 Aug 2025 |
| 252 | stichtinghansvaneck.org | Hosting Concepts B.V. dba Openprovider | 20 Jan 2015 | 19 Mar 2024 | 20 Jan 2026 |
| 253 | stichtingratatouille.com | Cronon AG | 22 Jan 2015 | 23 Jan 2015 | 22 Jan 2016 |
| 254 | stichting-sltr.com | Key-Systems GmbH | 23 Jan 2015 | 22 Jan 2017 | 23 Jan 2018 |
| 255 | stichtinglunata.org | Key-Systems GmbH | 23 Jan 2015 | 23 Jan 2015 | 23 Jan 2016 |
| 256 | stichtingulpiano.org | register.com, Inc. | 24 Jan 2008 | 24 Jan 2025 | 24 Jan 2026 |
| 257 | stichtingechoes.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Jan 2015 | 25 Jan 2015 | 25 Jan 2016 |
| 258 | stichtingdiversity.com | Tucows Domains Inc. | 28 Jan 2015 | 30 Dec 2024 | 28 Jan 2026 |
| 259 | stichtingkinderenvandezon.org | Hosting Concepts B.V. dba Openprovider | 29 Jan 2015 | 29 Jan 2025 | 29 Jan 2026 |
| 260 | stichtingclearwaterinitiative.org | PSI-USA, Inc. dba Domain Robot | 29 Jan 2015 | 30 Jan 2017 | 29 Jan 2018 |
| 261 | stichtingsocom.com | Mijn InternetOplossing B.V. | 1 Feb 2015 | 1 Feb 2015 | 1 Feb 2016 |
| 262 | stichtingbelgischbier.org | Gandi SAS | 31 Jan 2015 | 25 Jan 2017 | 31 Jan 2018 |
| 263 | stichtingatar.com | - | 8 Jul 2024 | 12 Sep 2024 | 8 Jul 2025 |
| 264 | stichtingwielerbaangeleen.com | PSI-USA, Inc. dba Domain Robot | 3 Feb 2015 | 4 Feb 2025 | 3 Feb 2026 |
| 265 | stichtingisharewecare.com | Tucows Domains Inc. | 4 Feb 2015 | 30 Apr 2017 | 4 Feb 2018 |
| 266 | stichtingstraatarm.com | Tucows Domains Inc. | 5 Feb 2015 | 5 Feb 2015 | 5 Feb 2016 |
| 267 | stichtingstraatarm.info | Tucows Domains Inc. | 5 Feb 2015 | 17 Mar 2024 | 5 Feb 2024 |
| 268 | stichtingcaribbeanartseu.com | Cronon AG | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2016 |
| 269 | stichtingbondrufm.com | Cronon AG | 8 Feb 2015 | 8 Feb 2015 | 8 Feb 2018 |
| 270 | stichting-set-free.com | Tucows Domains Inc. | 5 Feb 2012 | 9 Feb 2015 | 5 Feb 2016 |
| 271 | stichtigcab.com | Cronon AG | 20 Aug 2015 | 20 Aug 2015 | 20 Aug 2016 |
| 272 | stichtingsaludpabida.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 10 Feb 2015 | 10 Feb 2015 | 10 Feb 2016 |
| 273 | stichtinghartvoorzuidsinai.com | Tucows Domains Inc. | 11 Feb 2015 | 15 Feb 2017 | 11 Feb 2017 |
| 274 | stichtingthehandacademy.com | Realtime Register B.V. | 12 Feb 2015 | 12 Feb 2015 | 12 Feb 2016 |
| 275 | stichtingthehandacademy.org | Realtime Register B.V. | 12 Feb 2015 | - | 12 Feb 2016 |
| 276 | stichtingkleijngeluk.com | Key-Systems GmbH | 13 Feb 2015 | 14 Feb 2015 | 13 Feb 2016 |
| 277 | stichtingebenvloed.org | Realtime Register B.V. | 21 Aug 2015 | 19 May 2024 | 21 Aug 2025 |
| 278 | stichtingelpis.org | Tucows Domains Inc. | 15 Feb 2015 | 31 Jan 2017 | 15 Feb 2019 |
| 279 | stichtingstoryline.com | Cronon AG | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2018 |
| 280 | stichtingmiok.com | Key-Systems GmbH | 17 Feb 2015 | 24 Mar 2017 | 17 Feb 2018 |
| 281 | stichtinghulpisonderweg.com | Tucows Domains Inc. | 14 Feb 2014 | 18 Feb 2015 | 14 Feb 2016 |
| 282 | stichtingapf.com | Key-Systems GmbH | 17 Feb 2015 | 16 Jan 2025 | 17 Feb 2026 |
| 283 | stichtingachmeaapf.com | Nom-iq Ltd. dba COM LAUDE | 17 Feb 2015 | 17 Feb 2015 | 17 Feb 2016 |
| 284 | stichtingstoryline.org | Cronon AG | 17 Feb 2015 | 18 Feb 2017 | 17 Feb 2018 |
| 285 | stichtingmiok.org | Key-Systems GmbH | 17 Feb 2015 | 18 Feb 2017 | 17 Feb 2018 |
| 286 | stichtingbto.org | Key-Systems GmbH | 17 Feb 2015 | 17 Feb 2025 | 17 Feb 2026 |
| 287 | stichtinggarantiefonds.com | Realtime Register B.V. | 19 Feb 2015 | 20 Feb 2025 | 19 Feb 2026 |
| 288 | stichtingprisma.org | Cronon AG | 19 Feb 2015 | 19 Feb 2025 | 19 Feb 2026 |
| 289 | stichtingrenaissance.org | The Registrar Company B.V. | 20 Feb 2015 | 21 Feb 2017 | 20 Feb 2018 |
| 290 | stichtinglucianaoms.com | Tucows Domains Inc. | 21 Feb 2009 | 25 Feb 2015 | 21 Feb 2016 |
| 291 | stichtingdubocalc.com | Realtime Register B.V. | 24 Feb 2015 | 25 Feb 2015 | 24 Feb 2016 |
| 292 | stichtingdubocalc.org | Realtime Register B.V. | 24 Feb 2015 | 25 Feb 2015 | 24 Feb 2016 |
| 293 | stichtingmunsterclub.org | Hosting Concepts B.V. dba Openprovider | 25 Feb 2015 | 25 Feb 2015 | 25 Feb 2016 |
| 294 | stichtingita.com | NameCheap, Inc. | 9 Dec 2022 | 20 Feb 2024 | 9 Dec 2023 |
| 295 | stichtingterri.org | Key-Systems GmbH | 27 Feb 2015 | 11 Jul 2017 | 27 Feb 2019 |
| 296 | stichtingmensenrechtenvrienden.org | Tucows Domains Inc. | 27 Feb 2015 | 29 Jan 2017 | 27 Feb 2018 |
| 297 | stichtingcestlavie.com | Key-Systems GmbH | 2 Mar 2015 | 6 Apr 2017 | 2 Mar 2018 |
| 298 | stichtingwerkshop.com | Realtime Register B.V. | 3 Mar 2015 | 4 Mar 2025 | 3 Mar 2026 |
| 299 | stichtingmountmeru.com | Key-Systems GmbH | 5 Mar 2015 | 10 Apr 2017 | 5 Mar 2018 |
| 300 | stichtinglevensgeluk.com | Realtime Register B.V. | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 301 | stichtinggecko.org | Key-Systems GmbH | 7 Mar 2015 | 8 Mar 2017 | 7 Mar 2018 |
| 302 | stichtingmooigoed.com | Tucows Domains Inc. | 6 Mar 2013 | 10 Mar 2015 | 6 Mar 2016 |
| 303 | stichtingbuurmeisjeproduxies.com | Virtual Registrar, Inc. | 11 Mar 2015 | 7 Mar 2017 | 11 Mar 2018 |
| 304 | stichtingbevingsschadeherstel.com | Realtime Register B.V. | 11 Mar 2015 | 10 Mar 2017 | 11 Mar 2018 |
| 305 | stichting-pantaleon.com | eNom, Inc. | 11 Mar 2015 | 11 Mar 2015 | 11 Mar 2016 |
| 306 | stichtingsahne.org | Hosting Concepts B.V. dba Openprovider | 21 Dec 2010 | 4 Feb 2025 | 21 Dec 2025 |
| 307 | stichtingcontinuiteitfugro.com | PSI-USA, Inc. dba Domain Robot | 13 Mar 2015 | 18 Jan 2017 | 17 Jan 2018 |
| 308 | stichtingsupport.com | Cronon AG | 29 Jul 2020 | 29 Jul 2020 | 29 Jul 2021 |
| 309 | stichtingfrigg.com | Key-Systems GmbH | 16 Mar 2015 | 16 Mar 2015 | 16 Mar 2016 |
| 310 | stichtingrechtspraktijkletselschade.org | Mijn InternetOplossing B.V. | 15 Mar 2015 | 11 Sep 2016 | 15 Mar 2018 |
| 311 | stichting-zip.com | Tucows Domains Inc. | 18 Mar 2015 | 18 Mar 2015 | 18 Mar 2016 |
| 312 | stichtingnhsd.org | Cronon AG | 18 Mar 2015 | 19 Mar 2017 | 18 Mar 2018 |
| 313 | stichtingsteun.com | Realtime Register B.V. | 20 Mar 2015 | 20 Mar 2015 | 20 Mar 2016 |
| 314 | stichtingcarnavalzevenbergen.com | GMO Internet Inc. | 23 Mar 2015 | 31 Mar 2017 | 22 Mar 2018 |
| 315 | stichtingnox.com | Tucows Domains Inc. | 24 Mar 2015 | 9 Mar 2024 | 24 Mar 2025 |
| 316 | stichting-heuvelland.com | Key-Systems GmbH | 24 Mar 2015 | 23 Mar 2017 | 24 Mar 2018 |
| 317 | stichtingbuku.net | Tucows Domains Inc. | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 318 | stichtingfoundation.com | Cronon AG | 27 Aug 2015 | 27 Aug 2015 | 27 Aug 2017 |
| 319 | stichting-uniek-curacao.org | Key-Systems GmbH | 27 Aug 2015 | 28 Aug 2016 | 27 Aug 2017 |
| 320 | stichtingwenters.com | Tucows Domains Inc. | 27 Mar 2004 | 31 Mar 2017 | 27 Mar 2017 |
| 321 | stichtingbehoudcultureelerfgoedlattropbreklenkamp.com | Tucows Domains Inc. | 30 Mar 2015 | 27 Mar 2024 | 30 Mar 2025 |
| 322 | stichtingheuvelland.com | - | - | - | - |
| 323 | stichtingeerstelijnspsychologen.com | Tucows Domains Inc. | 29 Mar 2013 | 2 Apr 2015 | 29 Mar 2016 |
| 324 | stichtingekspedysjewytmarsum.frl | Hosting Concepts B.V. dba Openprovider | 20 Apr 2015 | 31 Jul 2024 | 20 Apr 2025 |
| 325 | stichtingsportzorg.com | Hosting Concepts B.V. dba Openprovider | 2 Apr 2015 | 2 Apr 2024 | 2 Apr 2025 |
| 326 | stichting-sportzorg.com | Hosting Concepts B.V. dba Openprovider | 2 Apr 2015 | 2 Apr 2024 | 2 Apr 2025 |
| 327 | stichting-chateaux.com | OVH sas | 2 Apr 2015 | 23 Apr 2019 | 2 Apr 2020 |
| 328 | stichtingeerstelijnspsychologen.info | Tucows Domains Inc. | 29 Mar 2013 | 2 Apr 2015 | 29 Mar 2016 |
| 329 | stichtingdreamcatcher.org | Realtime Register B.V. | 2 Apr 2015 | - | 2 Apr 2016 |
| 330 | stichtingtimeoutfrankrijk.com | Tucows Domains Inc. | 3 Apr 2012 | 7 Apr 2015 | 3 Apr 2016 |
| 331 | stichtingblauwgrond.com | Key-Systems GmbH | 28 Jan 2010 | 5 Mar 2017 | 28 Jan 2018 |
| 332 | stichtingromana.com | Realtime Register B.V. | 31 Aug 2015 | 1 Sep 2024 | 31 Aug 2025 |
| 333 | stichtinglezen.com | Key-Systems GmbH | 31 Aug 2015 | 18 Jan 2025 | 31 Aug 2025 |
| 334 | stichtingestafetteloop.com | Tucows Domains Inc. | 27 Aug 2010 | 31 Aug 2015 | 27 Aug 2016 |
| 335 | stichtingrenteopslag.org | Cronon AG | 29 Aug 2015 | 30 Aug 2016 | 29 Aug 2017 |
| 336 | stichtingrenteopslag.net | Cronon AG | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2017 |
| 337 | stichtingrenteopslag.com | Cronon AG | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2017 |
| 338 | stichtingrentemisslag.org | Cronon AG | 29 Aug 2015 | 30 Aug 2016 | 29 Aug 2017 |
| 339 | stichtingrentemisslag.net | Cronon AG | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2017 |
| 340 | stichtingrentemisslag.com | Cronon AG | 29 Aug 2015 | 29 Aug 2015 | 29 Aug 2017 |
| 341 | stichtingallforall.com | Tucows Domains Inc. | 30 Aug 2015 | 2 Jul 2017 | 30 Aug 2017 |
| 342 | stichtinggroeimee.com | Hosting Concepts B.V. dba Openprovider | 8 Apr 2015 | 8 Apr 2024 | 8 Apr 2025 |
| 343 | stichtingdegoudenbloem.com | Tucows Domains Inc. | 3 Sep 2015 | 5 Aug 2016 | 3 Sep 2017 |
| 344 | stichtingelbaraka.com | Key-Systems GmbH | 10 Apr 2015 | 10 Sep 2016 | 10 Apr 2018 |
| 345 | stichtingadministratiekantoorabnamro.com | CSC Corporate Domains, Inc. | 4 Sep 2015 | 31 Aug 2024 | 4 Sep 2025 |
| 346 | stichtingdehoophoek.info | PSI-USA, Inc. dba Domain Robot | 14 Apr 2015 | 14 Apr 2015 | 14 Apr 2016 |
| 347 | stichtingkloosterdorpsteyl.com | Tucows Domains Inc. | 16 Apr 2015 | 18 Mar 2017 | 16 Apr 2018 |
| 348 | stichting-gehandicapten-somalieche-tilburg.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 16 Apr 2015 | 16 Apr 2015 | 16 Apr 2016 |
| 349 | stichtingstudybackup.com | GoDaddy.com, LLC | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 350 | stichtingdierenkliniek.com | eNom, Inc. | 5 Sep 2015 | 5 Sep 2015 | 5 Sep 2016 |
| 351 | stichtingkloosterdorpsteyl.org | Tucows Domains Inc. | 16 Apr 2015 | 18 Mar 2017 | 16 Apr 2018 |
| 352 | stichtingdeniz.com | Mijn InternetOplossing B.V. | 20 Apr 2015 | 20 Apr 2015 | 20 Apr 2016 |
| 353 | stichtingkeck.com | Cronon AG | 21 Apr 2015 | 21 Apr 2015 | 21 Apr 2018 |
| 354 | stichtingwetenschapsfondsdystonie.com | Tucows Domains Inc. | 24 Apr 2015 | 26 Mar 2024 | 24 Apr 2025 |
| 355 | stichtingaylan.com | Cronon AG | 7 Sep 2015 | 7 Sep 2015 | 7 Sep 2017 |
| 356 | stichtinglooverhof.com | Wild West Domains, LLC | 27 Apr 2015 | 27 Apr 2015 | 27 Apr 2016 |
| 357 | stichtinggo.com | TurnCommerce, Inc. DBA NameBright.com | 15 Jul 2018 | 9 Jul 2020 | 15 Jul 2025 |
| 358 | stichtinggo.info | Tucows Domains Inc. | 28 Apr 2015 | 30 Mar 2017 | 28 Apr 2018 |
| 359 | stichtinglyonessclaim.com | Hetzner Online AG | 29 Apr 2015 | 29 Apr 2017 | 29 Apr 2018 |
| 360 | stichtingjkbrotterdam.com | Cronon AG | 30 Apr 2015 | 30 Apr 2015 | 30 Apr 2018 |
| 361 | stichtingfondsbewegingsstoornissen.com | Tucows Domains Inc. | 1 May 2015 | 2 Apr 2024 | 1 May 2025 |
| 362 | stichtingcare4u.com | Key-Systems GmbH | 29 Apr 2015 | 3 Jun 2017 | 29 Apr 2018 |
| 363 | stichtingfondsbewegingsstoornissen.info | Tucows Domains Inc. | 1 May 2015 | 7 Apr 2024 | 1 May 2025 |
| 364 | stichtingzorgkringloop.com | Realtime Register B.V. | 19 Nov 2016 | 10 Nov 2024 | 19 Nov 2025 |
| 365 | stichtingcitycare.com | Realtime Register B.V. | 3 May 2015 | 4 Apr 2017 | 3 May 2018 |
| 366 | stichtingrobinhood.com | Launchpad, Inc. | 4 May 2015 | 4 May 2015 | 4 May 2016 |
| 367 | stichtingroofvogel.com | Key-Systems GmbH | 9 Sep 2015 | 18 Jan 2025 | 9 Sep 2025 |
| 368 | stichtingpro-visie.com | Key-Systems GmbH | 5 May 2015 | 5 May 2020 | 5 May 2021 |
| 369 | stichtingcab.com | Cronon AG | 10 Sep 2015 | 9 Sep 2024 | 10 Sep 2024 |
| 370 | stichtingdewering.net | Tucows Domains Inc. | 4 May 2014 | 8 May 2015 | 4 May 2016 |
| 371 | stichting-plus.com | Cronon AG | 9 May 2015 | 9 May 2015 | 9 May 2018 |
| 372 | stichtingmaa.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 May 2015 | 5 May 2024 | 8 May 2025 |
| 373 | stichtingfangdema.org | Key-Systems GmbH | 11 May 2015 | 11 May 2015 | 11 May 2016 |
| 374 | stichtingdobru.org | FastDomain Inc. | 13 May 2015 | 30 Apr 2016 | 13 May 2018 |
| 375 | stichtingtechnischeopleidingen.com | Realtime Register B.V. | 15 May 2015 | 29 Nov 2023 | 15 May 2025 |
| 376 | stichtingkaka.org | eNom, Inc. | 19 Aug 2016 | 14 Mar 2017 | 19 Aug 2018 |
| 377 | stichtingportaal.com | Tucows Domains Inc. | 13 May 2011 | 17 May 2015 | 13 May 2016 |
| 378 | stichtinghartvoorzorg.com | Tucows Domains Inc. | 16 May 2015 | 16 May 2015 | 16 May 2016 |
| 379 | stichtingmana.com | GoDaddy.com, LLC | 18 May 2015 | 17 May 2024 | 18 May 2025 |
| 380 | stichtingkoorlibota.com | Tucows Domains Inc. | 15 May 2014 | 19 May 2015 | 15 May 2016 |
| 381 | stichtingchayacarcia.com | Tucows Domains Inc. | 9 Sep 2010 | 13 Sep 2015 | 9 Sep 2016 |
| 382 | stichterexcavating.com | GoDaddy.com, LLC | 23 May 2016 | 20 Dec 2024 | 28 Dec 2025 |
| 383 | stichtingsteekjehanduitenhelpjenaaste.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 May 2015 | 20 May 2015 | 20 May 2016 |
| 384 | stichtingforsa.com | Key-Systems GmbH | 22 May 2015 | 15 Jun 2024 | 22 May 2024 |
| 385 | stichtingnechama.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 12 Jun 2014 | 28 May 2015 | 12 Jun 2015 |
| 386 | stichtingdatabasekwaliteitsindicatorenzorg.com | Tucows Domains Inc. | 30 May 2015 | 1 May 2017 | 30 May 2018 |
| 387 | stichtingbam.com | Tucows Domains Inc. | 27 Jul 2024 | 16 Jan 2025 | 27 Jul 2025 |
| 388 | stichtingvoorslachtoffers.com | Tucows Domains Inc. | 1 Jun 2010 | 5 Jun 2015 | 1 Jun 2016 |
| 389 | stichtinghumaninterest.com | Hosting Concepts B.V. dba Openprovider | 4 Jun 2015 | 4 Jun 2017 | 4 Jun 2018 |
| 390 | stichtingsuperwisemedia.org | GoDaddy.com, LLC | 3 Jun 2015 | 3 Jun 2015 | 3 Jun 2016 |
| 391 | stichtingvoorslachtoffers.net | Tucows Domains Inc. | 1 Jun 2010 | 5 Jun 2015 | 1 Jun 2016 |
| 392 | stichtingvoorslachtoffers.info | Tucows Domains Inc. | 1 Jun 2010 | 5 Jun 2015 | 1 Jun 2016 |
| 393 | stichtingtikkiejijbenthem.com | Cronon AG | 16 Sep 2015 | 5 Nov 2024 | 16 Sep 2025 |
| 394 | stichtingsportpromotiebonaire.com | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 395 | stichtingsportenbonaire.com | GoDaddy.com, LLC | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 396 | stichtingmaaltijdvooreenkind.com | Key-Systems GmbH | 16 Sep 2015 | 20 Jul 2016 | 16 Sep 2017 |
| 397 | stichtingpromotieambachtelijkzuivelbereiding.com | Key-Systems GmbH | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2016 |
| 398 | stichtinghoreactie.com | Tucows Domains Inc. | 8 Jun 2015 | 12 Jun 2018 | 8 Jun 2018 |
| 399 | stichtingreisgeboekt.com | Hosting Concepts B.V. dba Openprovider | 9 Jun 2015 | 13 May 2024 | 9 Jun 2025 |
| 400 | stichtingdeoverblijf.com | Hosting Concepts B.V. dba Openprovider | 9 Jun 2015 | 9 Jun 2024 | 9 Jun 2025 |
| 401 | stichtingplasticwhale.org | Key-Systems GmbH | 17 Sep 2015 | 27 Sep 2016 | 17 Sep 2017 |
| 402 | stichtinghetlichtpunt.com | Tucows Domains Inc. | 11 Jun 2015 | 16 Jun 2021 | 11 Jun 2021 |
| 403 | stichtingcare.com | Realtime Register B.V. | 12 Jul 2018 | 12 Jul 2018 | 12 Jul 2019 |
| 404 | stichtingkeurmerkkwaliteitontwerper.com | eNom, Inc. | 15 Jun 2015 | 18 Jun 2017 | 15 Jun 2017 |
| 405 | stichtingfrajas.com | register.com, Inc. | 18 Sep 2015 | 19 Sep 2024 | 18 Sep 2025 |
| 406 | stichtingpaardenmetplezier.com | GMO Internet Inc. | 16 Jun 2015 | 30 Jun 2016 | 15 Jun 2017 |
| 407 | stichtingatriumclaim.com | Hetzner Online AG | 16 Jun 2015 | 15 Jun 2017 | 16 Jun 2018 |
| 408 | stichtingfeelgood.org | Realtime Register B.V. | 15 Jun 2015 | 16 Jun 2017 | 15 Jun 2018 |
| 409 | stichtingthegoldenoldies.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 18 Jun 2015 | 18 Jun 2015 | 18 Jun 2016 |
| 410 | stichtfix.com | Key-Systems GmbH | 2 Feb 2016 | 18 Jan 2025 | 2 Feb 2026 |
| 411 | stichtinglawine.org | - | 16 Nov 2024 | 30 Nov 2024 | 16 Nov 2025 |
| 412 | stichtingswl.com | Wild West Domains, LLC | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 413 | stichtingaante.com | Tucows Domains Inc. | 19 Jun 2015 | 19 Jun 2015 | 19 Jun 2016 |
| 414 | stichtingdatawarehousekwaliteitsindicatorenzorg.com | Tucows Domains Inc. | 21 Jun 2015 | 23 May 2017 | 21 Jun 2018 |
| 415 | stichtinghuskyrescuenederland.com | Network Solutions, LLC | 22 Jun 2015 | 24 Jun 2017 | 22 Jun 2018 |
| 416 | stichtingtennis.com | Metaregistrar BV Applications | 23 Jun 2015 | 25 Jun 2024 | 23 Jun 2025 |
| 417 | stichtingfootprint.com | Cronon AG | 23 Jun 2015 | 12 Aug 2024 | 23 Jun 2025 |
| 418 | stichtingcareforkidstunesie.com | Cronon AG | 23 Jun 2015 | 23 Jun 2015 | 23 Jun 2016 |
| 419 | stichtingtama.org | Cronon AG | 23 Jun 2015 | 24 Jun 2017 | 23 Jun 2018 |
| 420 | stichtingfootprint.org | Cronon AG | 23 Jun 2015 | 7 Aug 2024 | 23 Jun 2025 |
| 421 | stichtingsurifoundation.com | Tucows Domains Inc. | 22 Jun 2005 | 26 Jun 2015 | 22 Jun 2016 |
| 422 | stichtopia.com | GoDaddy.com, LLC | 1 Dec 2020 | 1 Dec 2020 | 1 Dec 2021 |
| 423 | stichtingsportenwelzijn.com | Network Solutions, LLC | 26 Jun 2015 | 26 Jun 2015 | 26 Jun 2016 |
| 424 | stichtingumoja.com | Realtime Register B.V. | 27 Jun 2015 | 19 Jun 2024 | 27 Jun 2025 |
| 425 | stichtingtitane.com | Dynadot, LLC | 27 Jun 2015 | 28 Jun 2017 | 27 Jun 2017 |
| 426 | stichtingshatir.com | NameWeb BVBA | 27 Jun 2015 | 25 Jun 2024 | 27 Jun 2025 |
| 427 | stichtingumoja.org | Realtime Register B.V. | 27 Jun 2015 | 24 Jun 2024 | 27 Jun 2025 |
| 428 | stichtinghks.com | Tucows Domains Inc. | 30 Jun 2015 | 1 Jun 2017 | 30 Jun 2018 |
| 429 | stichtinggrenzenlozekunst.com | Tucows Domains Inc. | 20 Sep 2010 | 24 Sep 2015 | 20 Sep 2016 |
| 430 | stichtingfob.org | eNom, Inc. | 26 Jun 2014 | 30 Jun 2024 | 26 Jun 2025 |
| 431 | stichtinghetkleutercollege.com | Hosting Concepts B.V. dba Openprovider | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 432 | stichtinghetkindercollege.com | Hosting Concepts B.V. dba Openprovider | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 433 | stichtingyonguwan.com | Key-Systems GmbH | 3 Jul 2015 | 2 Jul 2017 | 3 Jul 2018 |
| 434 | stichtingopluchting.com | Cronon AG | 21 Jul 2010 | 9 Sep 2024 | 21 Jul 2025 |
| 435 | stichtingjudansa.com | Network Solutions, LLC | 4 Jul 2015 | 29 Jun 2017 | 4 Jul 2018 |
| 436 | stichtinghelpinghands.com | Wild West Domains, LLC | 4 Jul 2015 | 5 Jul 2024 | 4 Jul 2025 |
| 437 | stichtingsosnow.com | Key-Systems GmbH | 5 Jul 2015 | 5 Jul 2015 | 5 Jul 2016 |
| 438 | stichtingsimeontenholt.com | Metaregistrar BV Applications | 6 Jul 2015 | 8 Jul 2024 | 6 Jul 2025 |
| 439 | stichtingkindcollege.com | Hosting Concepts B.V. dba Openprovider | 6 Jul 2015 | 6 Jul 2017 | 6 Jul 2018 |
| 440 | stichtingkindercentrumnissewaard.com | Tucows Domains Inc. | 5 Jul 2013 | 9 Jul 2015 | 5 Jul 2016 |
| 441 | stichtinghettalentencollege.com | Hosting Concepts B.V. dba Openprovider | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 442 | stichtinghetkenniscollege.com | Hosting Concepts B.V. dba Openprovider | 25 Sep 2015 | 25 Sep 2015 | 25 Sep 2016 |
| 443 | stichtingmijninzicht.com | Cronon AG | 9 Jul 2015 | 9 Jul 2015 | 9 Jul 2016 |
| 444 | stichtingfusion.com | Annulet LLC | 14 Aug 2017 | 30 Sep 2024 | 14 Aug 2025 |
| 445 | stichterriedelblainandpostler.com | GoDaddy.com, LLC | 10 Jul 2015 | 18 Sep 2022 | 10 Jul 2025 |
| 446 | stichterriedelandblain.com | GoDaddy.com, LLC | 10 Jul 2015 | 18 Sep 2022 | 10 Jul 2025 |
| 447 | stichterriedel.com | GoDaddy.com, LLC | 10 Jul 2015 | 18 Sep 2022 | 10 Jul 2025 |
| 448 | stichterlegal.com | GoDaddy.com, LLC | 10 Jul 2015 | 18 Sep 2022 | 10 Jul 2025 |
| 449 | stichterlaw.com | GoDaddy.com, LLC | 10 Jul 2015 | 18 Sep 2022 | 10 Jul 2025 |
| 450 | stichterandassociates.com | GoDaddy.com, LLC | 10 Jul 2015 | 18 Sep 2022 | 10 Jul 2025 |
| 451 | stichtingpromotieclubvanzuid.com | Tucows Domains Inc. | 11 Jul 2015 | 21 Sep 2024 | 11 Jul 2024 |
| 452 | stichtingmatsya.org | Key-Systems GmbH | 10 Jul 2015 | 11 Jul 2017 | 10 Jul 2018 |
| 453 | stichtingvwclaim.org | EPAG Domainservices GmbH | 26 Sep 2015 | 27 Aug 2016 | 26 Sep 2017 |
| 454 | stichtingvwclaim.com | EPAG Domainservices GmbH | 26 Sep 2015 | 27 Aug 2016 | 26 Sep 2017 |
| 455 | stichtingvolkswagenclaim.org | EPAG Domainservices GmbH | 26 Sep 2015 | 27 Aug 2016 | 26 Sep 2017 |
| 456 | stichtingvolkswagenclaim.com | EPAG Domainservices GmbH | 26 Sep 2015 | 27 Aug 2016 | 26 Sep 2017 |
| 457 | stichtingbeerputpensioen.com | Cronon AG | 13 Jul 2015 | 13 Jul 2015 | 13 Jul 2016 |
| 458 | stichtingbreastcarefoundation.com | Realtime Register B.V. | 8 Sep 2016 | 9 Sep 2024 | 8 Sep 2025 |
| 459 | stichtingbos.com | Cronon AG | 15 Jul 2015 | 15 Jul 2015 | 15 Jul 2017 |
| 460 | stichtingmattie.com | Hosting Concepts B.V. dba Openprovider | 16 Jul 2015 | 28 Aug 2024 | 16 Jul 2025 |
| 461 | stichtingdelaine.com | Key-Systems GmbH | 16 Jul 2015 | 16 Jul 2017 | 16 Jul 2018 |
| 462 | stichtinglemat.com | Key-Systems GmbH | 27 Sep 2015 | 18 Jan 2025 | 27 Sep 2025 |
| 463 | stichtingfem.com | Mijn InternetOplossing B.V. | 27 Sep 2015 | 27 Sep 2015 | 27 Sep 2016 |
| 464 | stichtingnostram.com | Tucows Domains Inc. | 28 Sep 2015 | 30 Aug 2016 | 28 Sep 2017 |
| 465 | stichtingrabinhomeofhope.com | GoDaddy.com, LLC | 22 Jul 2015 | 22 Jul 2015 | 22 Jul 2016 |
| 466 | stichtingsranandagu.com | Tucows Domains Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 467 | stichtingbunatinangasosolobi.com | Tucows Domains Inc. | 24 Jul 2015 | 24 Jul 2015 | 24 Jul 2016 |
| 468 | stichtingzuidafrika.com | GMO Internet Inc. | 30 Sep 2015 | 29 Sep 2016 | 29 Sep 2017 |
| 469 | stichtingrfwb.com | Key-Systems GmbH | 29 Sep 2015 | 18 Jan 2025 | 29 Sep 2025 |
| 470 | stichtingclear.com | GMO Internet Inc. | 16 Dec 2016 | 13 Jan 2017 | 15 Dec 2017 |
| 471 | stichtingmentorschap.com | Realtime Register B.V. | 25 Jul 2015 | 25 Jul 2015 | 25 Jul 2016 |
| 472 | stichtundstachelt.com | - | - | - | - |
| 473 | stichtingodin.com | Cronon AG | 26 Jul 2015 | 26 Jul 2024 | 26 Jul 2024 |
| 474 | stichtingonderlingesamenwerking.com | Cronon AG | 27 Jul 2015 | 15 Sep 2024 | 27 Jul 2025 |
| 475 | stichtingonderlingesamenwerking.org | Cronon AG | 27 Jul 2015 | 10 Sep 2024 | 27 Jul 2025 |
| 476 | stichtingonderlingesamenwerking.net | Cronon AG | 27 Jul 2015 | 15 Sep 2024 | 27 Jul 2025 |
| 477 | stichtingmatsya.com | Key-Systems GmbH | 28 Jul 2015 | 29 Jul 2016 | 28 Jul 2017 |
| 478 | stichtingvem.com | Mijn InternetOplossing B.V. | 30 Sep 2015 | 30 Sep 2015 | 30 Sep 2016 |
| 479 | stichting-aap.ngo | Key-Systems, LLC | 21 Apr 2015 | 20 Feb 2025 | 21 Apr 2025 |
| 480 | stichtingvolkswageninvestorclaim.com | EPAG Domainservices GmbH | 1 Oct 2015 | 2 Oct 2024 | 1 Oct 2025 |
| 481 | stichtingvolkswagenconsumerclaim.com | EPAG Domainservices GmbH | 1 Oct 2015 | 1 Sep 2016 | 1 Oct 2017 |
| 482 | stichtingvolkswagencarclaim.com | 1API GmbH | 1 Oct 2015 | 15 Dec 2024 | 1 Oct 2025 |
| 483 | stichtingaap.ong | Key-Systems, LLC | 21 Apr 2015 | 20 Feb 2025 | 21 Apr 2025 |
| 484 | stichtingaap.ngo | Key-Systems, LLC | 21 Apr 2015 | 20 Feb 2025 | 21 Apr 2025 |
| 485 | stichting-aap.ong | Key-Systems, LLC | 21 Apr 2015 | 20 Feb 2025 | 21 Apr 2025 |
| 486 | stichtingsula.com | Cronon AG | 31 Jul 2015 | 31 Jul 2015 | 31 Jul 2017 |
| 487 | stichtingdivinelight.com | 1API GmbH | 31 Jul 2015 | 7 Jan 2025 | 31 Jul 2026 |
| 488 | stichtagsabrechnung.com | PSI-USA, Inc. dba Domain Robot | 31 Jul 2015 | 19 Sep 2024 | 21 Mar 2025 |
| 489 | stichtingfamaw.com | Cronon AG | 1 Aug 2015 | 1 Aug 2015 | 1 Aug 2017 |
| 490 | stichtingh.com | - | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2017 |
| 491 | stichtinghetgroeneplatform.com | Key-Systems GmbH | 3 Aug 2015 | 7 Sep 2016 | 3 Aug 2017 |
| 492 | stichtingvolkswageninvestorsclaim.org | EPAG Domainservices GmbH | 2 Oct 2015 | 2 Sep 2016 | 2 Oct 2017 |
| 493 | stichtingvolkswageninvestorsclaim.com | EPAG Domainservices GmbH | 2 Oct 2015 | 3 Oct 2024 | 2 Oct 2025 |
| 494 | stichtingcdpo.com | SafeNames Ltd. | 2 Oct 2015 | 3 Oct 2024 | 2 Oct 2025 |
| 495 | stichtingsenazorg.info | Tucows Domains Inc. | 2 Aug 2015 | 2 Aug 2015 | 2 Aug 2016 |
| 496 | stichtinghetgroeneplatform.org | Key-Systems GmbH | 3 Aug 2015 | 4 Aug 2016 | 3 Aug 2017 |
| 497 | stichtingbrein.info | Tucows Domains Inc. | 31 Jul 2009 | 4 Aug 2015 | 31 Jul 2016 |
| 498 | stichtingpayincontrol.com | Key-Systems GmbH | 6 Aug 2015 | 7 Aug 2015 | 6 Aug 2016 |
| 499 | stichtingforexclaim.com | EPAG Domainservices GmbH | 6 Aug 2015 | 30 Jun 2017 | 6 Aug 2018 |
| 500 | stichtingforexclaim.org | EPAG Domainservices GmbH | 6 Aug 2015 | 30 Jun 2017 | 6 Aug 2018 |
| 501 | stichtingvriendenvanpepeyn.com | Cronon AG | 3 Oct 2015 | 3 Oct 2015 | 3 Oct 2016 |
| 502 | stichtingzonnepanelen.org | GoDaddy.com, LLC | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 503 | stichtingstadsherstel.frl | Key-Systems, LLC | 5 Oct 2015 | 4 Oct 2024 | 5 Oct 2024 |
| 504 | stichtinghorecarecht.com | Realtime Register B.V. | 5 Oct 2015 | 7 Oct 2016 | 5 Oct 2017 |
| 505 | stichtingonline.org | Networking4all B.V. | 8 Oct 2015 | - | 8 Oct 2016 |
| 506 | stichtingengelenwerk.com | Key-Systems GmbH | 8 Oct 2015 | 20 Nov 2024 | 8 Oct 2024 |
| 507 | stichtingcol.com | Tucows Domains Inc. | 8 Oct 2015 | 9 Sep 2016 | 8 Oct 2017 |
| 508 | stichtingevenementenzwolle.com | Realtime Register B.V. | 9 Oct 2015 | 10 Oct 2024 | 9 Oct 2025 |
| 509 | stichtingglas.net | GMO Internet Inc. | 11 Oct 2015 | 11 Oct 2016 | 11 Oct 2017 |
| 510 | stichtingchildagain.com | Network Solutions, LLC | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2016 |
| 511 | stichtingcentre2explore.com | eNom, Inc. | 14 Oct 2015 | 14 Oct 2015 | 14 Oct 2017 |
| 512 | stichtingalhoeda.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 513 | stichting-dada.com | Cronon AG | 15 Oct 2015 | 15 Oct 2015 | 15 Oct 2016 |
| 514 | stichtingbadrijnmond.net | Cronon AG | 17 Oct 2015 | 17 Oct 2015 | 17 Oct 2016 |
| 515 | stichtingsador.com | Realtime Register B.V. | 20 Oct 2015 | 29 Dec 2016 | 20 Oct 2017 |
| 516 | stichtingcharisma.com | Tucows Domains Inc. | 20 Oct 2015 | 21 Oct 2024 | 20 Oct 2025 |
| 517 | stichtingbibi.org | Key-Systems GmbH | 20 Oct 2015 | 21 Oct 2016 | 20 Oct 2017 |
| 518 | stichtingpalconfoundation.net | Realtime Register B.V. | 21 Oct 2015 | 23 Oct 2016 | 21 Oct 2017 |
| 519 | stichtingmunster.org | Key-Systems GmbH | 21 Oct 2015 | 22 Oct 2016 | 21 Oct 2017 |
| 520 | stichtingbigboy.net | Network Solutions, LLC | 21 Oct 2015 | 19 Oct 2016 | 21 Oct 2017 |
| 521 | stichtingmamataxi.com | Cronon AG | 23 Oct 2015 | 12 Dec 2024 | 23 Oct 2025 |
| 522 | stichtingdedagbesteding.org | - | 23 Oct 2015 | 23 Oct 2015 | 23 Oct 2017 |
| 523 | stichtingamfortas.com | Tucows Domains Inc. | 21 Oct 2013 | 25 Oct 2015 | 21 Oct 2016 |
| 524 | stichtingdorothea.com | Tucows Domains Inc. | 25 Oct 2015 | 26 Sep 2016 | 25 Oct 2017 |
| 525 | stichting-abdat.com | - | 26 Oct 2015 | 26 Oct 2015 | 26 Oct 2017 |
| 526 | stichtingvuur.org | OVH sas | 27 Oct 2015 | 26 Oct 2016 | 27 Oct 2017 |
| 527 | stichtingsecureafamily.org | TLD Registrar Solutions Ltd. | 27 Oct 2015 | 27 Oct 2015 | 27 Oct 2016 |
| 528 | stichtingvriendenceeshiep.info | Network Solutions, LLC | 29 Oct 2015 | 29 Oct 2015 | 29 Oct 2016 |
| 529 | stichtingsgentertainments.com | - | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 530 | stichtingiqplus.info | Tucows Domains Inc. | 29 Oct 2010 | 2 Nov 2015 | 29 Oct 2016 |
| 531 | stichtingiqplus.org | Tucows Domains Inc. | 29 Oct 2010 | 2 Nov 2015 | 29 Oct 2016 |
| 532 | stichtingintermissie.com | Tucows Domains Inc. | 2 Nov 2015 | 4 Oct 2016 | 2 Nov 2017 |
| 533 | stichtingbce.com | Tucows Domains Inc. | 3 Nov 2015 | 3 Nov 2015 | 3 Nov 2016 |
| 534 | stichtingwin.com | Key-Systems GmbH | 9 May 2005 | 4 Nov 2015 | 9 May 2016 |
| 535 | stichterauctions.net | Tucows Domains Inc. | 2 Nov 2010 | 6 Nov 2015 | 2 Nov 2016 |
| 536 | stichtingzwerfdierenkreta.com | One.com A/S | 5 Nov 2015 | 6 Oct 2024 | 5 Nov 2025 |
| 537 | stichtingmalumbanutheater.com | Tucows Domains Inc. | 4 Nov 2011 | 8 Nov 2015 | 4 Nov 2016 |
| 538 | stichtinghandinhand.com | Key-Systems GmbH | 12 Jan 2018 | 12 Jan 2018 | 12 Jan 2019 |
| 539 | stichtingvrolijkwerk.com | Tucows Domains Inc. | 6 Nov 2012 | 10 Nov 2015 | 6 Nov 2016 |
| 540 | stichtinggastvrijarnhem.com | The Registrar Company B.V. | 9 Nov 2015 | 29 Dec 2024 | 9 Nov 2025 |
| 541 | stichtingmama.com | Cronon AG | 10 Nov 2015 | 30 Dec 2024 | 10 Nov 2025 |
| 542 | stichtingqpo.com | GoDaddy.com, LLC | 12 Nov 2015 | 12 Nov 2015 | 12 Nov 2016 |
| 543 | stichtinganderbeeld.com | Realtime Register B.V. | 12 Nov 2015 | 14 Nov 2024 | 12 Nov 2025 |
| 544 | stichtingjacobvancampen.amsterdam | Key-Systems, LLC | 13 Nov 2015 | 10 Nov 2024 | 13 Nov 2024 |
| 545 | stichting-visible-results.com | Tucows Domains Inc. | 14 Nov 2008 | 18 Nov 2015 | 14 Nov 2016 |
| 546 | stichtingspray.com | Key-Systems GmbH | 18 Nov 2015 | 23 Dec 2016 | 18 Nov 2017 |
| 547 | stichtingdate.net | Cronon AG | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 548 | stichtingomdenken.com | Key-Systems GmbH | 20 Nov 2015 | 26 Dec 2016 | 20 Nov 2017 |
| 549 | stichtingdate.com | Cronon AG | 21 Nov 2015 | 21 Nov 2015 | 21 Nov 2016 |
| 550 | stichtingaireywijksamengroen.com | Key-Systems GmbH | 20 Nov 2015 | 25 Dec 2016 | 20 Nov 2017 |
| 551 | stichtingsun.org | Hosting Concepts B.V. dba Openprovider | 21 Nov 2015 | 26 Nov 2024 | 21 Nov 2025 |
| 552 | stichting-ssli.com | Hosting Concepts B.V. dba Openprovider | 22 Nov 2015 | 22 Nov 2015 | 22 Nov 2016 |
| 553 | stichtingzuidafrika.org | Dynadot9 LLC | 24 Nov 2015 | 4 Jul 2016 | 24 Nov 2017 |
| 554 | stichtinghelvoirt.net | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 24 Nov 2015 | 24 Nov 2015 | 24 Nov 2016 |
| 555 | stichtingfietskoeriers.amsterdam | Metaregistrar BV Applications | 25 Nov 2015 | 20 Jul 2017 | 25 Nov 2017 |
| 556 | stichtingangelina.com | Key-Systems GmbH | 26 May 2013 | 27 May 2015 | 26 May 2016 |
| 557 | stichting-plek.com | eNom, Inc. | 29 Nov 2015 | 29 Nov 2015 | 29 Nov 2016 |
| 558 | stichting-bladi.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 29 Nov 2015 | 29 Jan 2025 | 29 Nov 2024 |
| 559 | stichtsgenootschap-harmelen.com | CSC Corporate Domains, Inc. | 30 Nov 2015 | 26 Nov 2024 | 30 Nov 2025 |
| 560 | stichtingsob.com | Realtime Register B.V. | 30 Nov 2015 | 30 Nov 2015 | 30 Nov 2016 |
| 561 | stichtingokz.com | PSI-USA, Inc. dba Domain Robot | 2 Dec 2015 | 14 Jul 2017 | 2 Dec 2017 |
| 562 | stichtinglionsfiatlas.com | Cronon AG | 2 Dec 2015 | 2 Dec 2015 | 2 Dec 2017 |
| 563 | stichtingtrueillusion.com | GMO Internet Inc. | 11 Jan 2017 | 1 Feb 2017 | 11 Jan 2018 |
| 564 | stichtingremaya.com | Tucows Domains Inc. | 4 Dec 2015 | 1 Jun 2017 | 4 Dec 2017 |
| 565 | stichtingpolderkolder.com | GMO Internet Inc. | 12 Feb 2021 | 12 Feb 2021 | 12 Feb 2022 |
| 566 | stichtingiguana.com | Tucows Domains Inc. | 4 Dec 2015 | 5 Nov 2024 | 4 Dec 2025 |
| 567 | stichtingremaya.org | Tucows Domains Inc. | 4 Dec 2015 | 1 Jun 2017 | 4 Dec 2017 |
| 568 | stichters.com | NameCheap, Inc. | 15 Aug 2019 | - | 15 Aug 2020 |
| 569 | stichtinghelpendehanden.com | Realtime Register B.V. | 7 Dec 2015 | 8 Dec 2024 | 7 Dec 2025 |
| 570 | stichtingen.net | Key-Systems GmbH | 8 Dec 2015 | 9 Dec 2015 | 8 Dec 2016 |
| 571 | stichtingbarberbooking.com | The Registrar Company B.V. | 8 Dec 2015 | 9 Dec 2016 | 8 Dec 2017 |
| 572 | stichtinginhuis.com | Key-Systems GmbH | 11 Dec 2015 | 12 Dec 2015 | 11 Dec 2016 |
| 573 | stichtinghandelshuis.com | Key-Systems GmbH | 13 Dec 2015 | 13 Dec 2015 | 13 Dec 2016 |
| 574 | stichtingbeter.com | Tucows Domains Inc. | 9 Dec 2011 | 13 Dec 2015 | 9 Dec 2016 |
| 575 | stichtingnrvs.info | Hosting Concepts B.V. dba Openprovider | 14 Dec 2015 | 19 Dec 2024 | 14 Dec 2025 |
| 576 | stichtingmilagros.com | Mijn InternetOplossing B.V. | 15 Dec 2015 | 17 Dec 2016 | 15 Dec 2017 |
| 577 | stichtingwinwin.com | Tucows Domains Inc. | 13 Dec 2011 | 17 Dec 2015 | 13 Dec 2016 |
| 578 | stichtingimpactmakers.net | Key-Systems GmbH | 17 Dec 2015 | 30 Jan 2025 | 17 Dec 2024 |
| 579 | stichtingwelzijn.com | Amazon Registrar, Inc. | 19 Dec 2015 | 19 Dec 2015 | 19 Dec 2016 |
| 580 | stichtingweldoen.com | Tucows Domains Inc. | 21 Dec 2015 | 25 Dec 2018 | 21 Dec 2018 |
| 581 | stichtingafyagroup.com | - | 10 Mar 2024 | 19 Feb 2025 | 10 Mar 2025 |
| 582 | stichtingplus.com | Annulet LLC | 6 Mar 2016 | 23 Apr 2024 | 6 Mar 2025 |
| 583 | stichtingaartie.com | Network Solutions, LLC | 23 Dec 2015 | 23 Dec 2015 | 23 Dec 2017 |
| 584 | stichtingsabi.com | GMO Internet Inc. | 26 Dec 2015 | 13 Dec 2016 | 25 Dec 2017 |
| 585 | stichtingjamisensohouse.com | Cronon AG | 27 Dec 2015 | 27 Dec 2015 | 27 Dec 2016 |
| 586 | stichtingsemblis.org | eNom, Inc. | 29 Dec 2015 | 13 Mar 2017 | 29 Dec 2017 |
| 587 | stichtingpasifica.com | Tucows Domains Inc. | 29 Dec 2015 | 29 Dec 2015 | 29 Dec 2016 |
| 588 | stichting-fdk.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 30 Dec 2015 | 30 Dec 2015 | 30 Dec 2016 |
| 589 | stichtingdigitaleduurzaamheid.com | Tucows Domains Inc. | 31 Dec 2015 | 2 Dec 2024 | 31 Dec 2025 |
| 590 | stichtage.com | 1&1 Internet AG | 16 Sep 2024 | 16 Sep 2024 | 16 Sep 2025 |
| 591 | stichtingjenny.com | Cronon AG | 4 Jan 2016 | 4 Jan 2016 | 4 Jan 2017 |
| 592 | stichtinggroei.com | Wild West Domains, LLC | 5 Jan 2016 | 5 Jan 2016 | 5 Jan 2017 |
| 593 | stichtinglittlewe.com | Metaregistrar BV Applications | 6 Jan 2016 | 8 Jan 2025 | 6 Jan 2026 |
| 594 | stichtinglittewe.com | eNom, Inc. | 6 Jan 2016 | 9 Dec 2016 | 6 Jan 2018 |
| 595 | stichtingkanz.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 6 Jan 2016 | 7 Dec 2024 | 6 Jan 2026 |
| 596 | stichtingarbeidsparticipatie.com | Cronon AG | 6 Jan 2016 | 25 Feb 2025 | 6 Jan 2026 |
| 597 | stichtingkieteman.com | Tucows Domains Inc. | 10 Jan 2016 | 12 Dec 2024 | 10 Jan 2026 |
| 598 | stichtingbrood.com | Tucows Domains Inc. | 10 Jan 2016 | 11 Jan 2016 | 10 Jan 2017 |
| 599 | stichtingoranjedag.info | Dynadot, LLC | 21 Mar 2023 | 30 Apr 2024 | 21 Mar 2024 |
| 600 | stichtingresourcemutumbu.com | Cronon AG | 13 Jan 2016 | 4 Mar 2025 | 13 Jan 2026 |
| 601 | stichtingpinkforall.com | Tucows Domains Inc. | 13 Jan 2016 | 17 Jan 2018 | 13 Jan 2018 |
| 602 | stichtingkringloophenh.com | Key-Systems GmbH | 13 Jan 2016 | 12 Jan 2017 | 13 Jan 2018 |
| 603 | stichting-stops.nl | - | - | - | - |
| 604 | stichtinganimalfriendseurope.com | Tucows Domains Inc. | 11 Jan 2011 | 15 Jan 2016 | 11 Jan 2017 |
| 605 | stichtingisla.com | Key-Systems GmbH | 15 Jan 2016 | 26 Feb 2025 | 15 Jan 2026 |
| 606 | stichtingepilepsiecuracao.org | eNom, Inc. | 15 Jan 2016 | 14 Mar 2017 | 15 Jan 2018 |
| 607 | stichtingbeachsoccersuriname.com | Tucows Domains Inc. | 15 Jan 2016 | 19 Jan 2021 | 15 Jan 2021 |
| 608 | stichtingwesselings-vanbreemen.nl | - | 31 Jan 2014 | 24 Jan 2024 | - |
| 609 | stichting-dare.com | Wix.com Ltd. | 7 Oct 2021 | 7 Sep 2024 | 7 Oct 2025 |
| 610 | stichtse-vecht.org | Register.it SPA | 18 Jan 2016 | 24 Nov 2024 | 18 Jan 2026 |
| 611 | stichtingcirkel.org | Hosting Concepts B.V. dba Openprovider | 19 Jan 2016 | 21 Mar 2017 | 19 Jan 2018 |
| 612 | stichtingfamiliehulp.com | Realtime Register B.V. | 19 Jan 2016 | 19 Jan 2016 | 19 Jan 2017 |
| 613 | stichtingjongtalent.com | Cronon AG | 21 Jan 2016 | 21 Jan 2016 | 21 Jan 2017 |
| 614 | stichtingpodiumeuritmie.com | Hosting Concepts B.V. dba Openprovider | 20 Jan 2016 | 13 Jan 2025 | 20 Jan 2026 |
| 615 | stichtingnabij.org | Hosting Concepts B.V. dba Openprovider | 20 Jan 2016 | 20 Jan 2025 | 20 Jan 2026 |
| 616 | stichtingwillame.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 18 Jan 2012 | 21 Nov 2016 | 18 Jan 2018 |
| 617 | stichtingmeerkracht.nl | - | - | - | - |
| 618 | stichtingweetwatjebesteedt.org | Tucows Domains Inc. | 22 Jan 2010 | 26 Jan 2016 | 22 Jan 2017 |
| 619 | stichtingbankiaclaim.com | EPAG Domainservices GmbH | 27 Jan 2016 | 21 Dec 2016 | 27 Jan 2018 |
| 620 | stichtingnationaalvakexamenuitvaartzorg.com | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 621 | stichtingnationaalvakexamenuitvaartverzorging.com | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 622 | stichtingnationaalvakexamenuitvaartleider.com | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 623 | stichtingnationaalvakexamenuitvaartbranche.com | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 624 | stichtingnationaalvakexamenuitvaart.com | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 625 | stichtingnationaalvakexamen.com | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 626 | stichtingnationaalvakexamenuitvaartzorg.org | Hosting Concepts B.V. dba Openprovider | 28 Jan 2016 | 28 Jan 2025 | 28 Jan 2026 |
| 627 | stichtingnationaalvakexamenuitvaartverzorging.org | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 628 | stichtingnationaalvakexamenuitvaartleider.org | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 629 | stichtingnationaalvakexamenuitvaartbranche.org | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 630 | stichtingnationaalvakexamenuitvaart.org | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 631 | stichtingnationaalvakexamen.org | Tucows Domains Inc. | 28 Jan 2016 | 30 Dec 2016 | 28 Jan 2018 |
| 632 | stichtingdierenvoedselbank.club | Key-Systems, LLC | 28 Jan 2016 | 14 Mar 2017 | 27 Jan 2018 |
| 633 | stichtingimran.com | Launchpad, Inc. | 29 Jan 2016 | 29 Jan 2016 | 29 Jan 2017 |
| 634 | stichtingbdsar.com | Metaregistrar BV Applications | 30 Jan 2016 | 1 Feb 2025 | 30 Jan 2026 |
| 635 | stichtingmies.nl | - | 16 Jul 2008 | 11 Nov 2021 | - |
| 636 | stichtingovsk.com | Key-Systems GmbH | 1 Feb 2016 | 2 Feb 2017 | 1 Feb 2018 |
| 637 | stichtingprisma.nl | - | 16 Mar 2000 | 20 Jun 2011 | - |
| 638 | stichtinggroeimee.nl | - | 20 Nov 2014 | 9 Jul 2024 | - |
| 639 | stichtingumurage.org | GoDaddy.com, LLC | 2 Feb 2016 | 7 Feb 2017 | 2 Feb 2018 |
| 640 | stichtingsamen.info | Cronon AG | 2 Feb 2016 | - | 2 Feb 2017 |
| 641 | stichtingappril.com | Key-Systems GmbH | 2 Feb 2016 | 3 Feb 2016 | 2 Feb 2017 |
| 642 | stichtingstoer.com | Realtime Register B.V. | 3 Feb 2016 | 5 Feb 2017 | 3 Feb 2018 |
| 643 | stichtingkolibrie.com | Tucows Domains Inc. | 4 Feb 2016 | 8 Feb 2019 | 4 Feb 2019 |
| 644 | stichtingkeurmerkautodelen.com | Realtime Register B.V. | 5 Feb 2016 | 2 Feb 2017 | 5 Feb 2018 |
| 645 | stichtinginvestorclaimsagainstvolkswagen.com | Realtime Register B.V. | 5 Feb 2016 | 7 Feb 2017 | 5 Feb 2018 |
| 646 | stichtingsupport.org | eNom, Inc. | 6 Feb 2016 | 6 Feb 2016 | 6 Feb 2017 |
| 647 | stichtingbalans.nl | - | 4 Feb 2002 | 17 May 2018 | - |
| 648 | stichtinghumanitas.nl | - | 22 Sep 2008 | 19 Feb 2020 | - |
| 649 | stichtinginnovationvalleyeurope.com | Key-Systems GmbH | 8 Feb 2016 | 15 Mar 2017 | 8 Feb 2018 |
| 650 | stichtinghetgroeneplatform.nl | - | - | - | - |
| 651 | stichtingfrontrow.com | Cronon AG | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2018 |
| 652 | stichtingdeverrassing.com | Key-Systems GmbH | 11 Feb 2016 | 11 Feb 2016 | 11 Feb 2017 |
| 653 | stichtsepopfestival.com | Network Solutions, LLC | 12 Feb 2016 | 12 Feb 2016 | 12 Feb 2017 |
| 654 | stichtingndsm.com | Key-Systems GmbH | 12 Feb 2016 | 11 Feb 2025 | 12 Feb 2026 |
| 655 | stichting-eclipse.info | GMO Internet Inc. | 20 Nov 2010 | 29 Apr 2016 | 20 Nov 2017 |
| 656 | stichtsepop.com | - | 24 Apr 2022 | 25 Apr 2023 | 24 Apr 2024 |
| 657 | stichtingseniorenhulp.com | Tucows Domains Inc. | 12 Feb 2014 | 16 Feb 2016 | 12 Feb 2017 |
| 658 | stichting-seniorenhulp.com | Tucows Domains Inc. | 12 Feb 2014 | 16 Feb 2016 | 12 Feb 2017 |
| 659 | stichting-goedhartjes.com | Tucows Domains Inc. | 15 Feb 2016 | 17 Jan 2017 | 15 Feb 2018 |
| 660 | stichtingkennisplein.nl | - | 15 Oct 2009 | 7 Jul 2024 | - |
| 661 | stichtingkunstinontwikkeling.com | Tucows Domains Inc. | 14 Feb 2013 | 18 Feb 2016 | 14 Feb 2017 |
| 662 | stichting-vrijepleegzorg.org | OVH sas | 17 Feb 2016 | 22 Feb 2017 | 17 Feb 2018 |
| 663 | stichtingbeertje.com | FastDomain Inc. | 18 Feb 2016 | 4 Jan 2025 | 18 Feb 2026 |
| 664 | stichtingvoorscholen.com | Key-Systems GmbH | 18 Feb 2016 | 25 Mar 2017 | 18 Feb 2018 |
| 665 | stichtingsare.com | Key-Systems GmbH | 19 Feb 2016 | 19 Feb 2017 | 19 Feb 2018 |
| 666 | stichting-dime.nl | - | - | - | - |
| 667 | stichtingmentorschap.nl | - | 21 Sep 2006 | 13 Apr 2021 | - |
| 668 | stichtingfocusonkids.org | GoDaddy.com, LLC | 22 Feb 2016 | 13 Jul 2024 | 22 Feb 2026 |
| 669 | stichtingfocusonkids.net | GoDaddy.com, LLC | 22 Feb 2016 | 1 Mar 2024 | 22 Feb 2026 |
| 670 | stichtingfocusonkids.info | GoDaddy.com, LLC | 22 Feb 2016 | 15 Jul 2024 | 22 Feb 2026 |
| 671 | stichtingfocusonkids.com | GoDaddy.com, LLC | 22 Feb 2016 | 1 Mar 2024 | 22 Feb 2026 |
| 672 | stichtinggroenehabitat.com | Domainshype.com, Inc. | 23 Feb 2016 | 24 Apr 2016 | 23 Feb 2018 |
| 673 | stichtingsmn.net | Cronon AG | 24 Feb 2016 | 25 Feb 2025 | 24 Feb 2026 |
| 674 | stichtingdiereninnood.com | Cronon AG | 6 Nov 2018 | 6 Nov 2018 | 6 Nov 2019 |
| 675 | stichtingmarkthal.com | - | 3 Nov 2023 | 16 Dec 2024 | 3 Nov 2024 |
| 676 | stichtingdeheiligebron.com | Realtime Register B.V. | 25 Feb 2016 | 25 Feb 2016 | 25 Feb 2017 |
| 677 | stichtingontwikkelingssamenwerkingnoordwijk.com | register.com, Inc. | 28 Feb 2016 | 13 Feb 2017 | 28 Feb 2018 |
| 678 | stichtingdehaven.nl | - | 10 Jan 2001 | 3 Aug 2023 | - |
| 679 | stichtingtamarepeople.com | Tucows Domains Inc. | 26 Feb 2014 | 1 Mar 2016 | 26 Feb 2017 |
| 680 | stichtinglof.org | Realtime Register B.V. | 1 Mar 2016 | 27 Feb 2017 | 1 Mar 2018 |
| 681 | stichtingpronkenco.com | Key-Systems GmbH | 1 Mar 2016 | 2 May 2017 | 1 Mar 2019 |
| 682 | stichtingnoordkaapchallenge.com | Cronon AG | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2018 |
| 683 | stichtingleegstand.com | Tucows Domains Inc. | 1 Mar 2016 | 1 Mar 2016 | 1 Mar 2017 |
| 684 | stichtingvita.com | Tucows Domains Inc. | 28 Feb 2013 | 3 Mar 2016 | 28 Feb 2017 |
| 685 | stichtinglatoer.com | Key-Systems GmbH | 3 Mar 2016 | 18 Jan 2025 | 3 Mar 2026 |
| 686 | stichting-edunet.org | Cronon AG | 3 Mar 2016 | 4 Mar 2017 | 3 Mar 2018 |
| 687 | stichting-edunet.net | Cronon AG | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2018 |
| 688 | stichting-edunet.com | Cronon AG | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2018 |
| 689 | stichtingjouderijglobal.com | Realtime Register B.V. | 4 Mar 2016 | 1 Mar 2025 | 4 Mar 2026 |
| 690 | stichtingnce.com | Tucows Domains Inc. | 5 Mar 2016 | 4 Feb 2025 | 5 Mar 2026 |
| 691 | stichtinghelpnederland.org | Tucows Domains Inc. | 5 Mar 2016 | 4 Feb 2017 | 5 Mar 2018 |
| 692 | stichtinghelpnederland.info | Tucows Domains Inc. | 5 Mar 2016 | 4 Feb 2017 | 5 Mar 2018 |
| 693 | stichtinghelpnederland.com | Tucows Domains Inc. | 5 Mar 2016 | 4 Feb 2017 | 5 Mar 2018 |
| 694 | stichting-ook.nl | - | 13 Dec 2013 | 22 Jan 2025 | - |
| 695 | stichtingonderanderen.nl | - | 11 Aug 2013 | 1 Feb 2021 | - |
| 696 | stichterlodge.org | GoDaddy.com, LLC | 10 Mar 2016 | 13 Jul 2024 | 10 Mar 2025 |
| 697 | stichtinghelpendehand.com | Key-Systems GmbH | 10 Mar 2016 | 10 Jun 2020 | 10 Mar 2021 |
| 698 | stichtingsmidrenders.com | Realtime Register B.V. | 14 Mar 2016 | 15 Mar 2024 | 14 Mar 2025 |
| 699 | stichtinghoopvoordejongerenint.com | Mijn InternetOplossing B.V. | 14 Mar 2016 | 14 Mar 2016 | 14 Mar 2017 |
| 700 | stichtingpawsforchange.org | FastDomain Inc. | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 701 | stichtingpaardenkracht.org | Tucows Domains Inc. | 16 Mar 2016 | 15 Feb 2017 | 16 Mar 2018 |
| 702 | stichtingmovi.com | Tucows Domains Inc. | 16 Mar 2016 | 16 Mar 2016 | 16 Mar 2017 |
| 703 | stichtingpushdeheerbaan.org | Hosting Concepts B.V. dba Openprovider | 17 Mar 2016 | 31 Mar 2017 | 17 Mar 2018 |
| 704 | stichtinghoormij.com | Key-Systems GmbH | 18 Mar 2016 | 18 Jan 2025 | 18 Mar 2025 |
| 705 | stichtingchikwawafonds.com | PSI-USA, Inc. dba Domain Robot | 18 Mar 2016 | 1 Feb 2025 | 4 Jan 2026 |
| 706 | stichting-ij-land.info | Tucows Domains Inc. | 16 Mar 2011 | 16 Mar 2011 | 16 Mar 2017 |
| 707 | stichtinginti.com | Network Solutions, LLC | 20 Mar 2016 | 22 Mar 2024 | 20 Mar 2025 |
| 708 | stichtinggrip.com | Cronon AG | 20 Mar 2016 | 23 Feb 2025 | 20 Mar 2025 |
| 709 | stichtingunivers.com | Tucows Domains Inc. | 18 Mar 2010 | 18 Mar 2010 | 18 Mar 2017 |
| 710 | stichtingmoca.com | Cronon AG | 21 Mar 2016 | 10 May 2024 | 21 Mar 2025 |
| 711 | stichtingnewtechkids.org | GoDaddy.com, LLC | 22 Mar 2016 | 6 Sep 2024 | 22 Mar 2025 |
| 712 | stichtingnewtechkids.com | GoDaddy.com, LLC | 22 Mar 2016 | 22 Mar 2016 | 22 Mar 2019 |
| 713 | stichtingfair.org | Wild West Domains, LLC | 23 Mar 2016 | 21 Feb 2017 | 23 Mar 2018 |
| 714 | stichtingteddy.com | Tucows Domains Inc. | 27 Mar 2016 | 26 Mar 2017 | 27 Mar 2018 |
| 715 | stichtingnla.org | Key-Systems GmbH | 28 Mar 2016 | 24 Apr 2017 | 28 Mar 2018 |
| 716 | stichtingjod.net | Domain.com, LLC | 28 Mar 2016 | 28 Mar 2016 | 28 Mar 2017 |
| 717 | stichtingsteunblijfvanmijnlijf.nl | - | - | - | - |
| 718 | stichting-support.com | Cronon AG | 29 Mar 2016 | 29 Mar 2016 | 29 Mar 2018 |
| 719 | stichting-walk-on.org | Tucows Domains Inc. | 31 Mar 2016 | 7 Mar 2024 | 31 Mar 2025 |
| 720 | stichtingpal.net | Tucows Domains Inc. | 31 Mar 2010 | 31 Mar 2010 | 31 Mar 2017 |
| 721 | stichtingfinancieleplanners.com | Key-Systems GmbH | 4 Apr 2016 | 18 Jan 2025 | 4 Apr 2025 |
| 722 | stichtingfinancieelplanners.com | Key-Systems GmbH | 4 Apr 2016 | 18 Jan 2025 | 4 Apr 2025 |
| 723 | stichting-timulazu.com | GMO Internet Inc. | 6 Apr 2016 | 28 Apr 2017 | 5 Apr 2018 |
| 724 | stichtinghelpsyrie.org | Cronon AG | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 725 | stichtingnieuwsindeklas.net | GMO Internet Inc. | 6 Apr 2016 | 6 Apr 2016 | 6 Apr 2017 |
| 726 | stichtinghelpsyrie.com | Cronon AG | 26 Dec 2019 | 14 Feb 2025 | 26 Dec 2025 |
| 727 | stichtingblockchain.org | Register.it SPA | 8 Apr 2016 | 9 Apr 2017 | 8 Apr 2018 |
| 728 | stichtingdegoudentip.com | Realtime Register B.V. | 8 Apr 2016 | 9 Apr 2024 | 8 Apr 2025 |
| 729 | stichtingblockchain.net | Register.it SPA | 8 Apr 2016 | 11 May 2017 | 8 Apr 2018 |
| 730 | stichtingblockchain.com | GoDaddy.com, LLC | 1 Oct 2021 | 1 Oct 2021 | 1 Oct 2022 |
| 731 | stichtsevecht.nl | - | 20 Nov 2009 | 19 Nov 2024 | - |
| 732 | stichtingtriomfator.com | Wild West Domains, LLC | 9 Apr 2016 | 10 Mar 2024 | 9 Apr 2025 |
| 733 | stichtingautosportnederland.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 9 Apr 2016 | 10 Mar 2017 | 9 Apr 2018 |
| 734 | stichting-opherme.org | - | 11 Apr 2016 | 11 Apr 2016 | 11 Apr 2017 |
| 735 | stichtingwaardigwonen.com | Realtime Register B.V. | 13 Apr 2016 | 14 Apr 2024 | 13 Apr 2025 |
| 736 | stichtingislamicrelief.org | Tucows Domains Inc. | 14 Apr 2016 | 12 May 2017 | 14 Apr 2018 |
| 737 | stichtingislamicrelief.com | Tucows Domains Inc. | 14 Apr 2016 | 18 Apr 2018 | 14 Apr 2018 |
| 738 | stichtingak.com | NameJolt.com LLC | 1 Jul 2016 | 2 Jul 2017 | 1 Jul 2018 |
| 739 | stichtingvbv.nl | - | 22 Sep 2005 | 13 Dec 2022 | - |
| 740 | stichtingjongsuriname.com | Tucows Domains Inc. | 18 Apr 2016 | 20 Mar 2024 | 18 Apr 2025 |
| 741 | stichtingondernemershulp.com | Realtime Register B.V. | 19 Apr 2016 | 12 Jun 2017 | 19 Apr 2018 |
| 742 | stichting.bio | Hosting Concepts B.V. dba Openprovider | 21 Apr 2016 | 27 Apr 2024 | 21 Apr 2026 |
| 743 | stichtingpoort.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 4 Dec 2019 | 4 Dec 2019 | 4 Dec 2020 |
| 744 | stichtingkio.nl | - | 3 Mar 2003 | 12 Apr 2022 | - |
| 745 | stichtingvitaleouderen.com | NameWeb BVBA | 24 Apr 2016 | 23 Apr 2017 | 24 Apr 2018 |
| 746 | stichtinghetbuitenhof.com | Metaregistrar BV Applications | 25 Apr 2016 | 27 Apr 2024 | 25 Apr 2025 |
| 747 | stichtinglevenskunst.org | - | 20 Apr 2012 | 20 Apr 2012 | 20 Apr 2017 |
| 748 | stichtingdewaarheid.net | Tucows Domains Inc. | 22 Apr 2014 | 22 Apr 2014 | 22 Apr 2017 |
| 749 | stichtingdewaarheid.com | Tucows Domains Inc. | 22 Apr 2014 | 22 Apr 2014 | 22 Apr 2017 |
| 750 | stichting-jaanvi.com | Key-Systems GmbH | 25 Apr 2016 | 30 May 2017 | 25 Apr 2018 |
| 751 | stichtingmoringaformawa.org | Wild West Domains, LLC | 26 Apr 2016 | 27 Mar 2017 | 26 Apr 2018 |
| 752 | stichtingdewaarheid.org | - | 22 Apr 2014 | 22 Apr 2014 | 22 Apr 2017 |
| 753 | stichtingmeo.com | Key-Systems GmbH | 26 Apr 2016 | 31 May 2017 | 26 Apr 2018 |
| 754 | stichtingcube24.com | Wild West Domains, LLC | 27 Apr 2016 | 27 Apr 2016 | 27 Apr 2017 |
| 755 | stichtingmeerwonen.nl | - | 16 Apr 2015 | 31 Oct 2024 | - |
| 756 | stichtingmsmeevoorhsct.com | Cronon AG | 2 May 2016 | 2 May 2016 | 2 May 2018 |
| 757 | stichtingsportzorgnederland.com | Key-Systems GmbH | 3 May 2016 | 18 Jan 2025 | 3 May 2025 |
| 758 | stichtingjohanna.org | NameWeb BVBA | 5 May 2016 | 3 May 2017 | 5 May 2018 |
| 759 | stichtingdistinto.nl | - | 12 Nov 2012 | 15 Feb 2024 | - |
| 760 | stichtingprivacy.nl | - | - | - | - |
| 761 | stichtinglezen.org | The Registrar Company B.V. | 10 May 2016 | 24 Jun 2024 | 10 May 2025 |
| 762 | stichterllc.com | Google, Inc. | 9 Aug 2021 | 25 Jul 2024 | 9 Aug 2025 |
| 763 | stichterengineering.com | Google, Inc. | 10 May 2016 | 11 May 2024 | 10 May 2025 |
| 764 | stichtingprivacyschadeclaims.info | Realtime Register B.V. | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 765 | stichtingprivacyschadeclaim.info | Realtime Register B.V. | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 766 | stichtingjens.com | Beijing Lanhai Jiye Technology Co., Ltd | 17 Oct 2023 | 18 Oct 2024 | 17 Oct 2025 |
| 767 | stichtingprivacyschadeclaim.org | Realtime Register B.V. | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 768 | stichtingprivacyschadeclaims.com | REALTIME REGISTER BV | 13 May 2016 | 13 May 2016 | 13 May 2017 |
| 769 | stichtinglivelylivesfoundation.com | Realtime Register B.V. | 14 May 2016 | 16 May 2017 | 14 May 2018 |
| 770 | stichtinglivelylives.com | Realtime Register B.V. | 14 May 2016 | 16 May 2017 | 14 May 2018 |
| 771 | stichtingbestgetest.com | Realtime Register B.V. | 16 May 2016 | 18 May 2024 | 16 May 2025 |
| 772 | stichtingprojekten.com | Bizcn.com, Inc. | 5 Aug 2021 | 5 Aug 2021 | 5 Aug 2022 |
| 773 | stichtingpassiefbouwen.com | Realtime Register B.V. | 19 May 2016 | 21 May 2017 | 19 May 2018 |
| 774 | stichtingpassiefbouwen.org | Realtime Register B.V. | 19 May 2016 | 20 May 2017 | 19 May 2018 |
| 775 | stichtingthallo.org | PDR Ltd. d/b/a PublicDomainRegistry.com | 3 Apr 2012 | 26 Mar 2017 | 3 Apr 2018 |
| 776 | stichtingjongtalent.nl | - | - | - | - |
| 777 | stichtingspecialway.com | Tucows Domains Inc. | 22 May 2016 | 23 Apr 2017 | 22 May 2018 |
| 778 | stichtingaashiyana.com | Key-Systems GmbH | 22 May 2016 | 18 Jan 2025 | 22 May 2025 |
| 779 | stichtingimpact.org | Cronon AG | 24 May 2016 | 24 May 2016 | 24 May 2017 |
| 780 | stichtingunderoneroofbolgatanga.com | Tucows Domains Inc. | 24 May 2016 | 25 Apr 2017 | 24 May 2018 |
| 781 | stichtingup.org | Key-Systems GmbH | 25 May 2016 | 25 May 2016 | 25 May 2017 |
| 782 | stichtingsona.org | GoDaddy.com, LLC | 25 May 2016 | 14 Jul 2024 | 25 May 2025 |
| 783 | stichtingup.com | Key-Systems GmbH | 25 May 2016 | 25 May 2016 | 25 May 2017 |
| 784 | stichtingsuccesvolsamenleven.com | Key-Systems GmbH | 25 May 2016 | 24 May 2017 | 25 May 2018 |
| 785 | stichtingjeugdhonkbal.amsterdam | NameWeb BVBA | 26 May 2016 | 24 May 2017 | 26 May 2018 |
| 786 | stichtingaandacht.com | Cronon AG | 24 Oct 2022 | 24 Dec 2024 | 24 Oct 2024 |
| 787 | stichtinghersenschudding.com | Hosting Concepts B.V. dba Openprovider | 30 May 2016 | 5 Sep 2024 | 30 May 2025 |
| 788 | stichtingyasmin.com | Realtime Register B.V. | 31 May 2016 | 2 Jun 2017 | 31 May 2018 |
| 789 | stichtingzino.com | Tucows Domains Inc. | 1 Jun 2016 | 20 Jul 2024 | 1 Jun 2026 |
| 790 | stichtinghope.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 31 May 2016 | 31 May 2016 | 31 May 2017 |
| 791 | stichtingtheway.org | TierraNet Inc. d/b/a DomainDiscover | 5 Jun 2016 | 5 Aug 2016 | 5 Jun 2018 |
| 792 | stichtingstreetart.org | Metaregistrar BV Applications | 5 Jun 2016 | 20 Jul 2024 | 5 Jun 2025 |
| 793 | stichtingsecretsantanederland.org | PSI-USA, Inc. dba Domain Robot | 6 Jun 2016 | 7 Jun 2017 | 6 Jun 2018 |
| 794 | stichtingvano.nl | - | - | - | - |
| 795 | stichtingpromundo.com | PSI-USA, Inc. dba Domain Robot | 8 Jun 2016 | 28 Jul 2024 | 8 Jun 2025 |
| 796 | stichtingnautischoudewater.com | Hosting Concepts B.V. dba Openprovider | 8 Jun 2016 | 8 Jun 2017 | 8 Jun 2018 |
| 797 | stichting-woon.com | PSI-USA, Inc. dba Domain Robot | 8 Jun 2016 | 28 Jul 2017 | 8 Jun 2018 |
| 798 | stichtingmagnolia.org | Key-Systems GmbH | 10 Jun 2016 | 15 Jan 2025 | 10 Jun 2025 |
| 799 | stichtingwereldburger.com | Key-Systems GmbH | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 800 | stichtingvandestraat.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 10 Jun 2016 | 20 May 2017 | 10 Jun 2018 |
| 801 | stichtinghartvoorlelystatters.com | PSI-USA, Inc. dba Domain Robot | 10 Jun 2016 | 16 Aug 2017 | 16 Aug 2018 |
| 802 | stichtingdnwb.com | Key-Systems GmbH | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 803 | stichtingdenieuwewereldburger.com | Key-Systems GmbH | 10 Jun 2016 | 9 Jun 2017 | 10 Jun 2018 |
| 804 | stichting-wereldburger.com | Key-Systems GmbH | 10 Jun 2016 | 9 Jun 2017 | 10 Jun 2018 |
| 805 | stichting-dnwb.com | Key-Systems GmbH | 10 Jun 2016 | 10 Jun 2016 | 10 Jun 2017 |
| 806 | stichtingcultuurinnovatie.com | Vautron Rechenzentrum AG | 13 Jun 2016 | 15 Jun 2017 | 13 Jun 2018 |
| 807 | stichtingwirja.com | Key-Systems GmbH | 13 Jun 2016 | 18 Jan 2025 | 13 Jun 2025 |
| 808 | stichting-kops.com | NameWeb BVBA | 13 Jun 2016 | 13 Jun 2020 | 13 Jun 2020 |
| 809 | stichtingimmo.org | The Registrar Company B.V. | 5 Sep 2011 | 18 Nov 2024 | 5 Sep 2025 |
| 810 | stichting-immo.org | The Registrar Company B.V. | 5 Sep 2011 | 18 Nov 2024 | 5 Sep 2025 |
| 811 | stichthage.com | Tucows Domains Inc. | 14 Jun 2016 | 16 May 2024 | 14 Jun 2025 |
| 812 | stichtingruigerus.com | GMO Internet Inc. | 26 Aug 2021 | 17 Aug 2024 | 26 Aug 2025 |
| 813 | stichtingdetruckersvrienden.com | Realtime Register B.V. | 15 Jun 2016 | 17 Jun 2017 | 15 Jun 2018 |
| 814 | stichting-angelheart.com | Tucows Domains Inc. | 15 Jun 2016 | 15 Jun 2016 | 15 Jun 2017 |
| 815 | stichtinghollandsglorie.com | GMO Internet Inc. | 11 Jun 2018 | 11 Jun 2018 | 11 Jun 2019 |
| 816 | stichtingwittetulp.nl | - | 21 Nov 2024 | 21 Nov 2024 | - |
| 817 | stichtingzorgclaims.com | Hosting Concepts B.V. dba Openprovider | 17 Jun 2016 | 21 May 2020 | 17 Jun 2020 |
| 818 | stichtingbom.org | Limited Liability Company "Registrar of domain nam… | 22 Oct 2022 | 22 Oct 2023 | 22 Oct 2024 |
| 819 | stichtingaggz.com | Beijing Lanhai Jiye Technology Co., Ltd | 30 Jul 2023 | 1 Jan 2025 | 30 Jul 2025 |
| 820 | stichtingplacereplacetfoundation.com | GoDaddy.com, LLC | 20 Jun 2016 | 20 Jun 2016 | 20 Jun 2017 |
| 821 | stichtingnlpo.com | Key-Systems GmbH | 21 Jun 2016 | 18 Jan 2025 | 21 Jun 2025 |
| 822 | stichtingnlpo.org | Key-Systems GmbH | 21 Jun 2016 | 15 Jan 2025 | 21 Jun 2025 |
| 823 | stichtingnlpo.net | Key-Systems GmbH | 21 Jun 2016 | 18 Jan 2025 | 21 Jun 2025 |
| 824 | stichtingpretletters.com | Key-Systems GmbH | 22 Jun 2016 | 21 Jun 2017 | 22 Jun 2018 |
| 825 | stichtingbehoudboeier.org | Tucows Domains Inc. | 24 Jun 2016 | 4 Aug 2024 | 24 Jun 2024 |
| 826 | stichtingkithara.com | Realtime Register B.V. | 24 Jun 2016 | 26 Jun 2017 | 24 Jun 2018 |
| 827 | stichtingunited.com | Hosting Concepts B.V. dba Openprovider | 27 Aug 2024 | 21 Jan 2025 | 27 Aug 2025 |
| 828 | stichtingwsn.nl | - | - | - | - |
| 829 | stichtingbreder.org | Key-Systems GmbH | 27 Jun 2016 | 15 Jan 2025 | 27 Jun 2025 |
| 830 | stichting-aad.org | Realtime Register B.V. | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 831 | stichting-aad.net | REALTIME REGISTER BV | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 832 | stichtingrooz.com | Realtime Register B.V. | 27 Jun 2016 | 28 Jun 2024 | 27 Jun 2025 |
| 833 | stichtingmetelkaar.com | - | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 834 | stichtingbreder.com | Key-Systems GmbH | 27 Jun 2016 | 18 Jan 2025 | 27 Jun 2025 |
| 835 | stichting-aad.com | REALTIME REGISTER BV | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 836 | stichting-aad.online | Realtime Register B.V. | 27 Jun 2016 | 27 Jun 2016 | 27 Jun 2017 |
| 837 | stichtingkeurmerkthanatopraxie.org | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 12 Aug 2024 | 28 Jun 2025 |
| 838 | stichtingkeurmerkmortuariumbeheer.org | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 12 Aug 2024 | 28 Jun 2025 |
| 839 | stichtingkeurmerkmortuaria.org | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 12 Aug 2024 | 28 Jun 2025 |
| 840 | stichtingkeurmerkcrematoria.org | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 12 Aug 2024 | 28 Jun 2025 |
| 841 | stichtingibid.org | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 25 Jun 2003 | 27 Jun 2017 | 25 Jun 2018 |
| 842 | stichtingkeurmerkthanatopraxie.com | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 9 Aug 2024 | 28 Jun 2025 |
| 843 | stichtingkeurmerkmortuariumbeheer.com | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 9 Aug 2024 | 28 Jun 2025 |
| 844 | stichtingkeurmerkmortuaria.com | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 9 Aug 2024 | 28 Jun 2025 |
| 845 | stichtingkeurmerkcrematoria.com | Hosting Concepts B.V. dba Openprovider | 28 Jun 2016 | 9 Aug 2024 | 28 Jun 2025 |
| 846 | stichtingdierencentrumfriesland.com | Cronon AG | 28 Jun 2016 | 28 Jun 2016 | 28 Jun 2018 |
| 847 | stichtingaavb.com | Tucows Domains Inc. | 29 Jun 2016 | 31 May 2024 | 29 Jun 2025 |
| 848 | stichtingbijzondergewoongezinamersfoort.com | Tucows Domains Inc. | 29 Jun 2016 | 29 Jun 2016 | 29 Jun 2017 |
| 849 | stichtingpromotorsvanabbemuseum.com | Key-Systems GmbH | 21 Jan 2021 | 20 Jan 2025 | 21 Jan 2026 |
| 850 | stichtingwerkinbeweging.com | Hosting Concepts B.V. dba Openprovider | 30 Jun 2016 | 30 Jun 2017 | 30 Jun 2018 |
| 851 | stichting-hbh.org | Key-Systems GmbH | 24 Jul 2008 | 15 Jan 2025 | 24 Jul 2025 |
| 852 | stichtinggokverlies.org | Alpnames Limited | 2 Jul 2016 | 2 Jul 2016 | 2 Jul 2017 |
| 853 | stichtinggokverlies.com | Alpnames Limited | 2 Jul 2016 | 2 Jul 2016 | 2 Jul 2017 |
| 854 | stichtingmoontje.org | Tucows Domains Inc. | 4 Jul 2016 | 8 Jul 2023 | 4 Jul 2024 |
| 855 | stichting-moon.org | Tucows Domains Inc. | 4 Jul 2016 | 8 Jul 2023 | 4 Jul 2024 |
| 856 | stichtingmoontje.com | Tucows Domains Inc. | 4 Jul 2016 | 14 Sep 2023 | 4 Jul 2023 |
| 857 | stichting-moon.com | Tucows Domains Inc. | 4 Jul 2016 | 8 Jul 2023 | 4 Jul 2024 |
| 858 | stichtag.xyz | NameCheap, Inc. | 4 Jul 2016 | 17 Aug 2017 | 4 Jul 2018 |
| 859 | stichtingincrease.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 5 Jul 2016 | 13 Jun 2024 | 5 Jul 2025 |
| 860 | stichtingglas.com | EuroDNS S.A. | 23 Oct 2007 | 17 Sep 2024 | 22 Oct 2025 |
| 861 | stichtingsamenleuker.nl | - | - | - | - |
| 862 | stichtinghelderwater.com | TurnCommerce, Inc. DBA NameBright.com | 6 Jan 2020 | 15 Feb 2025 | 6 Jan 2025 |
| 863 | stichtingthalia.org | Realtime Register B.V. | 7 Jul 2016 | 7 Jul 2016 | 7 Jul 2017 |
| 864 | stichtingaladdin.org | Hosting Concepts B.V. dba Openprovider | 7 Jul 2016 | 21 Aug 2024 | 7 Jul 2025 |
| 865 | stichtingeducatiedekans.net | Tucows Domains Inc. | 4 Jun 2014 | 8 Jun 2016 | 4 Jun 2016 |
| 866 | stichting-woon.info | PSI-USA, Inc. dba Domain Robot | 8 Jun 2016 | 12 May 2017 | 8 Jun 2018 |
| 867 | stichtingfloris.xyz | Realtime Register B.V. | 13 Jun 2016 | 18 Jun 2016 | 13 Jun 2017 |
| 868 | stichtingcirculairefinanciering.org | Key-Systems GmbH | 9 Jul 2016 | 15 Jan 2025 | 9 Jul 2025 |
| 869 | stichtingkwest.nl | - | 17 Oct 2007 | 27 Jan 2025 | - |
| 870 | stichtingsoos.nl | - | 2 Mar 2005 | 8 Dec 2022 | - |
| 871 | stichtingaanelkaar.com | Tucows Domains Inc. | 12 Jul 2016 | 13 Jun 2017 | 12 Jul 2018 |
| 872 | stichtingwoon.amsterdam | Hosting Concepts B.V. dba Openprovider | 13 Jul 2016 | 13 Jul 2017 | 13 Jul 2018 |
| 873 | stichting-woon.amsterdam | Hosting Concepts B.V. dba Openprovider | 13 Jul 2016 | 13 Jul 2017 | 13 Jul 2018 |
| 874 | stichtingbeeldendekunst.amsterdam | PSI-USA, Inc. dba Domain Robot | 17 Aug 2015 | 17 Aug 2024 | 17 Aug 2025 |
| 875 | stichtingpuja.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 13 Jul 2016 | 18 Jun 2024 | 13 Jul 2025 |
| 876 | stichtag.tattoo | PSI-USA, Inc. dba Domain Robot | 20 May 2014 | 4 Jul 2023 | 20 May 2024 |
| 877 | stichtingkeurmerkletselschade.tips | Realtime Register B.V. | 9 May 2014 | 23 Jun 2024 | 9 May 2025 |
| 878 | stichtingsprank.com | Key-Systems GmbH | 14 Jul 2016 | 18 Jan 2025 | 14 Jul 2025 |
| 879 | stichtingpatientveiligheid.biz | Realtime Register B.V. | 1 Sep 2010 | 24 Jul 2016 | 31 Aug 2017 |
| 880 | stichtingvalk.biz | Hosting Concepts B.V. dba Openprovider | 4 Dec 2007 | 3 Dec 2016 | 3 Dec 2017 |
| 881 | stichtingverliespolis.biz | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 20 Mar 2009 | 4 May 2017 | 19 Mar 2018 |
| 882 | stichting.biz | NameWeb BVBA | 25 Dec 2024 | 30 Dec 2024 | 25 Dec 2025 |
| 883 | stichtingdehofstede.biz | Tucows Domains Inc. | 22 Jul 2010 | 25 Jul 2018 | 21 Jul 2018 |
| 884 | stichtag.biz | Corehub, S.R.L. | 17 May 2006 | 28 Jul 2024 | 16 May 2025 |
| 885 | stichtsevecht.biz | Register.it SPA | 8 Sep 2010 | 24 Nov 2024 | 7 Sep 2026 |
| 886 | stichtingtandang.biz | Tucows Domains Inc. | 30 Jan 2012 | 2 Feb 2018 | 29 Jan 2018 |
| 887 | stichtinghelderwater.biz | Realtime Register B.V. | 8 Aug 2011 | 22 Sep 2019 | 7 Aug 2020 |
| 888 | stichtingnieuwsindeklas.biz | EPAG Domainservices GmbH | 14 Apr 2011 | 29 May 2017 | 13 Apr 2018 |
| 889 | stichtingiproper.biz | Moniker Online Services LLC | 20 Jan 2012 | 5 Mar 2020 | 19 Jan 2021 |
| 890 | stichtingpantarhei.com | Key-Systems GmbH | 7 Nov 2024 | 27 Nov 2024 | 7 Nov 2025 |
| 891 | stichtingsionpoort.com | Hosting Concepts B.V. dba Openprovider | 18 Jul 2016 | 21 Jun 2017 | 18 Jul 2017 |
| 892 | stichtingenergycoin.org | Key-Systems GmbH | 21 Jul 2016 | 22 Jul 2017 | 21 Jul 2018 |
| 893 | stichtingfrom.com | Beijing Lanhai Jiye Technology Co., Ltd | 31 Dec 2021 | 1 Jan 2024 | 31 Dec 2024 |
| 894 | stichtingkind.org | Key-Systems GmbH | 22 Jul 2016 | 23 Jul 2017 | 22 Jul 2018 |
| 895 | stichtingsamensterk.com | Cronon AG | 20 Feb 2025 | 20 Feb 2025 | 20 Feb 2026 |
| 896 | stichtingpolitiektheater.org | Hosting Concepts B.V. dba Openprovider | 25 Jul 2016 | 25 Jul 2017 | 25 Jul 2018 |
| 897 | stichting-passie.com | Hosting Concepts B.V. dba Openprovider | 26 Jul 2016 | 30 Dec 2024 | 26 Jul 2025 |
| 898 | stichtingsocrates.com | Metaregistrar BV Applications | 27 Jul 2016 | 29 Jul 2024 | 27 Jul 2025 |
| 899 | stichting040doet.org | Key-Systems GmbH | 27 Jul 2016 | 8 Sep 2017 | 27 Jul 2018 |
| 900 | stichtinghandtohand.net | REALTIME REGISTER BV | 28 Jul 2016 | 28 Jul 2016 | 28 Jul 2017 |
| 901 | stichtingdan.org | Hosting Concepts B.V. dba Openprovider | 1 Aug 2016 | 15 Sep 2024 | 1 Aug 2025 |
| 902 | stichtingsportvooriederkind.com | Tucows Domains Inc. | 3 Aug 2016 | 7 Aug 2018 | 3 Aug 2018 |
| 903 | stichtingsportvooriederkind.org | Tucows Domains Inc. | 3 Aug 2016 | 13 Oct 2023 | 3 Aug 2023 |
| 904 | stichtingmarketing.com | eNom, Inc. | 4 Aug 2016 | 6 Jul 2017 | 4 Aug 2018 |
| 905 | stichtingkeurmerkoverledenzorg.com | Hosting Concepts B.V. dba Openprovider | 5 Aug 2016 | 9 Aug 2024 | 5 Aug 2025 |
| 906 | stichtingsalvage.com | NETIM SARL | 5 Aug 2016 | 5 Aug 2016 | 5 Aug 2025 |
| 907 | stichtingkeurmerkoverledenzorg.org | Hosting Concepts B.V. dba Openprovider | 5 Aug 2016 | 19 Sep 2024 | 5 Aug 2025 |
| 908 | stichtingoobi.com | Key-Systems GmbH | 6 Aug 2016 | 11 Sep 2017 | 6 Aug 2018 |
| 909 | stichtingambientefeliz.com | Wix.com Ltd. | 27 Feb 2023 | 28 Jan 2025 | 27 Feb 2027 |
| 910 | stichtinghoogbegaafd.org | Key-Systems GmbH | 8 Aug 2016 | 9 Aug 2017 | 8 Aug 2018 |
| 911 | stichtingbasicreturn4you.international | Key-Systems, LLC | 8 Aug 2016 | 20 Sep 2017 | 8 Aug 2017 |
| 912 | stichting-sl.com | - | 10 Aug 2016 | 10 Aug 2016 | 10 Aug 2017 |
| 913 | stichthepurplethread.com | Google, Inc. | 10 Aug 2016 | 10 Aug 2016 | 10 Aug 2021 |
| 914 | stichtingsamenleuker.com | Tucows Domains Inc. | 10 Aug 2016 | 16 Sep 2017 | 10 Aug 2018 |
| 915 | stichtingsiis.com | Wild West Domains, LLC | 16 Aug 2016 | 17 Jul 2024 | 16 Aug 2026 |
| 916 | stichtingplatformdranken.com | Hosting Concepts B.V. dba Openprovider | 17 Aug 2016 | 11 Apr 2024 | 17 Aug 2025 |
| 917 | stichtingliberales.org | Cronon AG | 17 Aug 2016 | 1 Oct 2024 | 17 Aug 2025 |
| 918 | stichtingmargaux.com | Key-Systems GmbH | 18 Aug 2016 | 18 Jan 2025 | 18 Aug 2025 |
| 919 | stichtingdeachterwacht.com | - | 18 Aug 2016 | 18 Aug 2016 | 18 Aug 2017 |
| 920 | stichtinghelpcuba.com | - | 20 Aug 2016 | 20 Aug 2016 | 20 Aug 2017 |
| 921 | stichtingsultanacharity.com | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 22 Aug 2016 | 23 Aug 2017 | 22 Aug 2018 |
| 922 | stichtingsultanacharity.one | One.com A/S | 22 Aug 2016 | 26 Aug 2017 | 22 Aug 2018 |
| 923 | stichting-koersen-op-ontwikkeling.com | Realtime Register B.V. | 23 Aug 2016 | 24 Jul 2017 | 23 Aug 2018 |
| 924 | stichtingdeflorakokjesminimakidsclub.com | Key-Systems GmbH | 24 Aug 2016 | 23 Aug 2024 | 24 Aug 2025 |
| 925 | stichtingkinderopvangkralingen.com | Hongkong Domain Name Information Management Co., L… | 9 Nov 2021 | 13 Nov 2022 | 9 Nov 2022 |
| 926 | stichtingutoz.com | Domain.com, LLC | 26 Aug 2016 | 26 Aug 2016 | 26 Aug 2018 |
| 927 | stichtingdebrink.com | Metaregistrar BV Applications | 26 Aug 2016 | 28 Aug 2024 | 26 Aug 2025 |
| 928 | stichtingjeugdinterventies.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 25 Aug 2016 | 21 Jan 2024 | 25 Aug 2025 |
| 929 | stichtingmanna.com | One.com A/S | 23 Jan 2022 | 24 Dec 2024 | 23 Jan 2026 |
| 930 | stichtingyeniyasam.com | Launchpad, Inc. | 24 Aug 2016 | 9 Aug 2017 | 24 Aug 2018 |
| 931 | stichtingyouandme.com | Tucows Domains Inc. | 28 Aug 2016 | 30 Jul 2017 | 28 Aug 2018 |
| 932 | stichtingallure.com | Annulet LLC | 15 Nov 2017 | 2 Jan 2025 | 15 Nov 2025 |
| 933 | stichtingderozeolifantjes.com | - | 30 Aug 2016 | 30 Aug 2016 | 30 Aug 2017 |
| 934 | stichting-echo.com | Metaregistrar BV Applications | 30 Aug 2016 | 1 Sep 2024 | 30 Aug 2025 |
| 935 | stichtinghuurdersbelangenhanzevast.com | Key-Systems GmbH | 31 Aug 2016 | 5 Oct 2017 | 31 Aug 2018 |
| 936 | stichtingalieman.org | Name.com, Inc. | 1 Sep 2016 | 21 Aug 2017 | 1 Sep 2018 |
| 937 | stichtingshgarantie.com | The Registrar Company B.V. | 1 Sep 2016 | 5 Jun 2023 | 1 Sep 2023 |
| 938 | stichtingmaatwerk.org | Hosting Concepts B.V. dba Openprovider | 4 Sep 2016 | 4 Sep 2017 | 4 Sep 2018 |
| 939 | stichting-estrela.org | Tucows Domains Inc. | 5 Sep 2016 | 9 Sep 2017 | 5 Sep 2018 |
| 940 | stichting-ierse-wolfshond.com | EnomV, Inc. | 6 Sep 2016 | 8 Jul 2024 | 6 Sep 2025 |
| 941 | stichtinghumikla.org | Vautron Rechenzentrum AG | 7 Sep 2016 | 22 Oct 2024 | 7 Sep 2025 |
| 942 | stichtingkickart.com | Network Solutions, LLC | 8 Sep 2016 | 6 Sep 2017 | 8 Sep 2018 |
| 943 | stichtingsekyere.com | Key-Systems GmbH | 9 Sep 2016 | 10 Sep 2017 | 9 Sep 2018 |
| 944 | stichtinghbn.com | The Registrar Company B.V. | 9 Sep 2016 | 10 Sep 2017 | 9 Sep 2018 |
| 945 | stichtinggwa.com | - | 9 Sep 2016 | 9 Sep 2016 | 9 Sep 2017 |
| 946 | stichtingjonel.com | PSI-USA, Inc. dba Domain Robot | 11 Sep 2016 | 12 Sep 2017 | 11 Sep 2018 |
| 947 | stichtinglimburgcycling.com | Key-Systems GmbH | 11 Sep 2016 | 18 Jan 2025 | 11 Sep 2025 |
| 948 | stichtingweworkatlive.com | Key-Systems GmbH | 4 Jul 2012 | 4 Jul 2017 | 4 Jul 2019 |
| 949 | stichtingbootvluchteling.com | DropCatch.com 866 LLC | 29 Nov 2019 | 30 Nov 2019 | 29 Nov 2020 |
| 950 | stichtingfilosoof.com | Realtime Register B.V. | 12 Sep 2016 | 24 Oct 2017 | 12 Sep 2017 |
| 951 | stichtingbootvluchteling.org | Tucows Domains Inc. | 12 Sep 2016 | 14 Aug 2017 | 12 Sep 2018 |
| 952 | stichtingtaalbrug.com | Key-Systems GmbH | 30 Dec 2024 | 30 Dec 2024 | 30 Dec 2025 |
| 953 | stichtingcultuurjam.com | FastDomain Inc. | 14 Sep 2016 | 20 Sep 2024 | 14 Sep 2025 |
| 954 | stichtingsupportersvoorhetleven.com | Key-Systems GmbH | 16 Sep 2016 | 15 Sep 2017 | 16 Sep 2018 |
| 955 | stichtingdesi.com | Tucows Domains Inc. | 22 Sep 2016 | 24 Aug 2017 | 22 Sep 2018 |
| 956 | stichtinghitc.org | Key-Systems GmbH | 23 Sep 2016 | 7 Nov 2017 | 23 Sep 2018 |
| 957 | stichting-begin.org | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 18 Sep 2017 | 27 Sep 2018 |
| 958 | stichtingbegin.net | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 18 Sep 2017 | 27 Sep 2018 |
| 959 | stichting-begin.net | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 18 Sep 2017 | 27 Sep 2018 |
| 960 | stichting-begin.com | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 18 Sep 2017 | 27 Sep 2018 |
| 961 | stichtingbegin.com | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 18 Sep 2017 | 27 Sep 2018 |
| 962 | stichtingbegin.org | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 18 Sep 2017 | 27 Sep 2018 |
| 963 | stichting-begin.info | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 27 Sep 2023 | 27 Sep 2024 |
| 964 | stichtingbegin.info | Hosting Concepts B.V. dba Openprovider | 27 Sep 2016 | 27 Sep 2023 | 27 Sep 2024 |
| 965 | stichtingdrijfkracht.com | Key-Systems GmbH | 8 Feb 2012 | 7 Feb 2017 | 8 Feb 2018 |
| 966 | stichtingzzp.com | NameCheap, Inc. | 1 Aug 2023 | 12 Sep 2024 | 1 Aug 2024 |
| 967 | stichtingrebio.com | Realtime Register B.V. | 4 Sep 2009 | 6 Sep 2017 | 4 Sep 2018 |
| 968 | stichtingcontinuiteit.com | Key-Systems GmbH | 11 Feb 2011 | 10 Feb 2017 | 11 Feb 2018 |
| 969 | stichtingdms.com | Key-Systems GmbH | 15 Oct 2008 | 15 Oct 2017 | 15 Oct 2018 |
| 970 | stichtingaquavivenda.com | PSI-USA, Inc. dba Domain Robot | 31 Aug 2005 | 20 Oct 2017 | 30 Aug 2018 |
| 971 | stichtingnoskorsow.com | Tucows Domains Inc. | 10 Apr 2003 | 14 Apr 2018 | 10 Apr 2018 |
| 972 | sticht-technologie.com | RegistryGate GmbH | 18 Oct 2013 | 19 Oct 2024 | 18 Oct 2025 |
| 973 | stichtingbaloe.com | eNom, Inc. | 23 Jan 2008 | 25 Dec 2016 | 23 Jan 2018 |
| 974 | stichtingvlinder.com | Hosting Concepts B.V. dba Openprovider | 17 Jan 2008 | 28 Sep 2017 | 17 Jan 2019 |
| 975 | stichtingadesse.com | Hosting Concepts B.V. dba Openprovider | 14 May 2012 | 14 May 2024 | 14 May 2025 |
| 976 | stichtingviceversa.com | Metaregistrar BV Applications | 23 May 2011 | 25 May 2024 | 23 May 2025 |
| 977 | stichtingroundtheworld.com | Tucows Domains Inc. | 22 Jul 2010 | 23 Jun 2024 | 22 Jul 2025 |
| 978 | stichtingzwerfkatalmere.com | Hosting Concepts B.V. dba Openprovider | 9 Oct 2013 | 16 Sep 2017 | 9 Oct 2018 |
| 979 | stichtingembrace.com | Key-Systems GmbH | 4 Jan 2022 | 18 Jan 2025 | 4 Jan 2026 |
| 980 | stichtinghandelingenafrika.com | Tucows Domains Inc. | 18 Oct 2010 | 22 Oct 2018 | 18 Oct 2018 |
| 981 | stichting-le-nid.com | Hosting Concepts B.V. dba Openprovider | 11 Feb 2013 | 11 Feb 2017 | 11 Feb 2018 |
| 982 | stichtingkiana.com | Key-Systems GmbH | 19 May 2008 | 23 Jun 2017 | 19 May 2018 |
| 983 | stichtinglifegoals.com | Realtime Register B.V. | 8 Nov 2010 | 22 Dec 2024 | 8 Nov 2026 |
| 984 | stichtingasbest.com | Hosting Concepts B.V. dba Openprovider | 14 Jul 2009 | 10 Aug 2017 | 14 Jul 2018 |
| 985 | stichtingbcco.com | CSL Computer Service Langenbach GmbH d/b/a joker.c… | 24 Apr 2005 | 30 Oct 2024 | 24 Apr 2028 |
| 986 | stichtingrespect.com | Hosting Concepts B.V. dba Openprovider | 30 Aug 2013 | 9 Sep 2024 | 30 Aug 2026 |
| 987 | stichtingdroomkinderen.com | Tucows Domains Inc. | 19 May 2010 | 20 Apr 2024 | 19 May 2025 |
| 988 | stichting-beheergroep.com | Hosting Concepts B.V. dba Openprovider | 7 Feb 2011 | 23 Mar 2017 | 7 Feb 2018 |
| 989 | stichtingvriendenhongarije.com | Realtime Register B.V. | 26 Aug 2012 | 30 Aug 2024 | 26 Aug 2025 |
| 990 | stichtingwijnonderwijs.com | Hosting Concepts B.V. dba Openprovider | 21 Nov 2013 | 15 Nov 2024 | 21 Nov 2025 |
| 991 | stichtingbuitengewoon.com | Realtime Register B.V. | 19 Nov 2011 | 20 Oct 2017 | 19 Nov 2018 |
| 992 | stichtingfinoce.com | GoDaddy.com, LLC | 7 Jul 2010 | 6 Jul 2024 | 7 Jul 2025 |
| 993 | stichtingdehofstede.com | Key-Systems GmbH | 8 Jan 2004 | 12 Feb 2016 | 8 Jan 2017 |
| 994 | stichthuiskes.com | Key-Systems GmbH | 19 Jun 2007 | 18 Jan 2025 | 19 Jun 2025 |
| 995 | stichttechnologie.com | World4You Internet Services GmbH | 11 Feb 2015 | 12 Feb 2025 | 11 Feb 2026 |
| 996 | stichtingjeugdsoos.com | Key-Systems GmbH | 2 Nov 2012 | 1 Nov 2017 | 2 Nov 2018 |
| 997 | stichtingzonnewende.com | Key-Systems GmbH | 11 Apr 2012 | 16 May 2017 | 11 Apr 2018 |
| 998 | stichtingdezienblijft.com | Cronon AG | 9 Oct 2014 | 28 Nov 2024 | 9 Oct 2025 |
| 999 | stichting-noor.com | CNOBIN INFORMATION TECHNOLOGY LIMITED | 29 Dec 2021 | 29 Dec 2021 | 29 Dec 2022 |
| 1000 | stichtermasonry.com | Google, Inc. | 15 Apr 2011 | 20 Apr 2024 | 15 Apr 2025 |
Displaying 1,000 out of 11,756 domains starting with the keyword "STICHT". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=sticht
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |