Our database now contains whois records of 603 Million (603,152,403) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [603 Million Domains] $10,000 Details

Keyword: VALENT

Reverse Whois » KEYWORD [valent ]  { 42,978 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1valent.comAmazon Registrar, Inc.31 Oct 199520 May 202330 Oct 2027
2valent.systemsGoDaddy.com, LLC24 Jan 20156 Jan 201724 Jan 2018
3valent.ovhOVH sas7 Mar 20157 Mar 20177 Mar 2018
4valent.clickGransy s.r.o. d/b/a subreg.cz20 May 201511 May 202420 May 2025
5valent.designNameCheap, Inc.30 Jan 202314 Feb 202430 Jan 2024
6valent.clubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…4 Sep 202411 Oct 20244 Sep 2025
7valent.xyz-6 Oct 20216 Dec 20246 Oct 2025
8valent.topAlpnames Limited11 Apr 201611 Apr 201611 Apr 2017
9valent.biz-2 Dec 20247 Dec 20242 Dec 2025
10valent.infoGMO Internet Inc.11 Dec 20205 Nov 202411 Dec 2025
11valent.catEstrategias WebSite S.L.26 Jun 201314 Nov 202426 Jun 2025
12valent.netInames Co. Ltd.7 Aug 200427 Nov 20247 Aug 2025
13valent.orgTurnCommerce, Inc. DBA NameBright.com7 Apr 200428 May 20247 Apr 2026
14valent.usKey-Systems GmbH13 Jan 200412 Jan 202512 Jan 2025
15valent.xxx-1 Dec 201130 Jan 20121 Dec 2021
16valent.caGandi SAS12 Feb 200615 Apr 202412 Feb 2029
17valent.ch----
18valent.techGoogle, Inc.9 Feb 201710 Feb 20259 Feb 2026
19valent.solarGoDaddy.com, LLC5 Mar 202010 Mar 20205 Mar 2021
20valent.energyGoDaddy.com, LLC25 Jun 20179 Aug 202425 Jun 2025
21valent.emailPorkbun, LLC20 Oct 201724 Oct 202420 Oct 2025
22valent.co.uk-16 Sep 202317 Sep 202416 Sep 2025
23valent.uk-12 Nov 202412 Nov 202412 Nov 2025
24valent.worldGoDaddy.com, LLC21 Sep 201821 Sep 201821 Sep 2019
25valent.proPorkbun, LLC4 Feb 202416 Jan 20254 Feb 2026
26valent.technologyGoogle, Inc.9 Feb 20179 Feb 20259 Feb 2026
27valent.managementThe Registrar Company B.V.4 Jul 202018 Aug 20244 Jul 2025
28valent.storeGoDaddy.com, LLC6 Mar 202413 Oct 20246 Mar 2025
29valent.artNameCheap, Inc.8 Nov 202118 Nov 20248 Nov 2025
30valent.be-10 Jan 2023--
31valent.digitalNameCheap, Inc.1 Feb 20227 Jan 20251 Feb 2026
32valent.groupCommuniGal Communication Ltd.6 Feb 20257 Feb 20256 Feb 2026
33valent.toolsNameCheap, Inc.30 Aug 202230 Aug 202230 Aug 2023
34valent.ccNameBake LLC5 Oct 202216 Dec 20235 Oct 2023
35valent.com.coTucows Domains Inc.26 Sep 20201 Oct 202426 Sep 2024
36valent.networkNameCheap, Inc.14 Nov 202226 Dec 202414 Nov 2024
37valent.nl-14 Jul 19993 Jul 2018-
38valent.bondPorkbun, LLC29 Jun 202212 Dec 202429 Jun 2030
39valent.appCloudFlare, Inc.23 Jan 202429 Dec 202423 Jan 2026
40valent.com.hr-23 Apr 201130 May 201223 Apr 2025
41valent.md-3 Jul 2021-3 Jul 2025
42valent.pl-10 May 20102 May 202410 May 2025
43valent.cl-12 Jan 2001-9 Feb 2025
44valent.llcGoogle, Inc.15 Jan 20205 Jan 202515 Jan 2026
45valent.consultingGoDaddy.com, LLC21 Jul 20204 Sep 202421 Jul 2025
46valent.devPorkbun, LLC25 Mar 20218 Oct 202425 Mar 2029
47valent.funCV. Rumahweb Indonesia17 Oct 202422 Oct 202417 Oct 2025
48valent.im----
49valent.in101domain, Inc.16 Feb 200530 Jan 202416 Feb 2033
50valent.it-23 Jan 200414 Feb 202529 Jan 2026
51valent.nameunited-domains AG---
52valent.com.br-22 Oct 20204 Mar 202422 Oct 2026
53valent.ltdGoDaddy.com, LLC12 Jan 202412 Jan 202512 Jan 2026
54valent.clinicGoDaddy.com, LLC26 Jan 202426 Jan 202526 Jan 2026
55valent.coGoDaddy.com, LLC26 Jul 201021 Oct 202425 Jul 2026
56valent.ru-30 Nov 2006-30 Nov 2025
57valent.cz-1 Aug 20224 May 20191 Aug 2025
58valent.shopXiamen ChinaSource Internet Service Co., Ltd.19 Jul 202419 Jul 202419 Jul 2025
59valent.studioTucows Domains Inc.10 Sep 202412 Oct 202410 Sep 2025
60valent.tvTucows Domains Inc.18 Aug 201424 Aug 202418 Aug 2025
61valent.se-16 Jun 20224 Jun 202416 Jun 2028
62valent.partnersAutomattic Inc.22 Feb 202522 Feb 202522 Feb 2026
63valent.com.au--27 Feb 2025-
64valentinesfiesta.comTucows Domains Inc.6 Apr 200710 Dec 20176 Apr 2018
65valentina-arabians.de--3 Jul 2007-
66valentins.de--19 Sep 2023-
67valentinorossi.comRegister.it SPA2 Apr 201311 Jan 20259 Dec 2025
68valentinagallo.us-27 Jul 20241 Aug 202427 Jul 2025
69valentinas-kochbuch.de--7 May 2024-
70valentinbosioc.comPSI-USA, Inc. dba Domain Robot12 Jan 201027 Aug 202412 Jan 2028
71valentine.inGandi SAS16 Feb 200518 Jan 202516 Feb 2026
72valentijapan.comGMO Internet Inc.29 Jun 200723 May 202329 Jun 2026
73valentinecpa.netGMO Internet Inc.8 Apr 20168 Apr 20168 Apr 2017
74valentinafalls.comBeijing Lanhai Jiye Technology Co., Ltd27 Feb 202424 Jan 202527 Feb 2025
75valentinecarnival.comBeijing Lanhai Jiye Technology Co., Ltd27 Jan 20234 Dec 202427 Jan 2026
76valentinanappi.comNetEarth One Inc. d/b/a NetEarth3 Sep 201213 Aug 20243 Sep 2025
77valentingarcia.com.mx-21 Mar 20127 May 201221 Mar 2013
78valentino.comBarbero & Associates Limited21 Jul 199814 Mar 202420 Jul 2025
79valentinreport.comInterweb Advertising D.B.A. Profile Builder29 Sep 201529 Sep 201529 Sep 2016
80valentynodesign.comFastDomain Inc.4 Nov 202117 Jan 20244 Nov 2023
81valentinolibro.comTucows Domains Inc.21 Oct 20141 Jan 202521 Oct 2024
82valentineswine.comGoDaddy.com, LLC13 Nov 20203 Dec 202413 Nov 2026
83valentinedaywishesquotes.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
84valentinedaymessagesquotes.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
85valentinecherrycreations.comTucows Domains Inc.26 Apr 201630 Apr 201726 Apr 2017
86valentinechain.comOVH sas21 Oct 201424 Jan 201721 Oct 2017
87valentinabeia.com-3 May 202410 Aug 20243 May 2025
88valentin-mitev.comNameCheap, Inc.21 Oct 201421 Sep 202421 Oct 2025
89valentinjalba.comTucows Domains Inc.22 Oct 201413 Oct 201722 Oct 2018
90valentinestreet.comTurnCommerce, Inc. DBA NameBright.com22 Oct 201416 Oct 202022 Oct 2025
91valentinathorner.comNameCheap, Inc.22 Oct 201422 Sep 202422 Oct 2025
92valentinathoerner.comNameCheap, Inc.22 Oct 201422 Sep 202422 Oct 2025
93valentinanessi.bizRegistryGate GmbH22 Oct 201413 Jan 202521 Oct 2025
94valentchamber.comGoDaddy.com, LLC16 Jun 200817 Jun 202416 Jun 2025
95valentina-db.comGoDaddy.com, LLC18 Oct 200519 Oct 202418 Oct 2025
96valentina.ch----
97valentine1.comNetwork Solutions, LLC28 Jan 19971 Dec 202129 Jan 2027
98valentinecirano.comGoDaddy.com, LLC2 Dec 202015 Dec 20222 Dec 2023
99valentinedaygifts2015.comGoDaddy.com, LLC28 Jan 201528 Jan 201528 Jan 2016
100valentinedayspecial.comWhiteglove Domains, Incorporated18 Jun 201919 Jun 201918 Jun 2020
101valentinedayx.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Dec 201411 Dec 201410 Dec 2015
102valentinenyc.comGoDaddy.com, LLC19 Dec 201220 Nov 202423 Oct 2025
103valentines-2015.comGMO Internet Inc.2 Jul 20182 Jul 20182 Jul 2019
104valentines2015images.comGoDaddy.com, LLC19 Aug 201919 Aug 201919 Aug 2020
105valentinesday14feb.comHiChina Zhicheng Technology Limited23 Jul 201823 Jul 201823 Jul 2019
106valentinesday2015.giftGoDaddy.com, LLC26 Dec 201431 Dec 201426 Dec 2015
107valentinesday2015card.comGoDaddy.com, LLC9 Jan 20159 Jan 20159 Jan 2016
108valentinesday2015greetingcards.comXin Net Technology Corporation9 Jul 20189 Jul 20189 Jul 2019
109valentinesday2015k.netGMO Internet Inc.8 Apr 20168 Apr 20168 Apr 2017
110valentinesday2015pictures.comGoDaddy.com, LLC10 Jan 201524 Feb 201510 Jan 2016
111valentinesday2015v.comGoDaddy.com, LLC9 Jan 201523 Feb 20159 Jan 2016
112valentinesday2015wishes.comGoDaddy.com, LLC2 Jan 20152 Jan 20152 Jan 2016
113valentinesday2015z.comBigRock Solutions Ltd.2 Jan 20152 Jan 20152 Jan 2016
114valentinesdaycardsprintables.comDynadot, LLC9 Oct 202219 Dec 20239 Oct 2023
115valentinesdaymahjong.comGoDaddy.com, LLC10 Jan 201210 Jan 202510 Jan 2026
116valentinesdaymessagespoems.comBigRock Solutions Ltd.3 Feb 20153 Feb 20153 Feb 2016
117valentinesdayquotespoems.com35 Technology Co., Ltd.26 Mar 2018-26 Mar 2019
118valentinesdaysms.in-3 Jan 201520 Jan 20173 Jan 2018
119valentinesdaywallpaperimages.comDynadot, LLC19 Dec 202228 Feb 202419 Dec 2023
120valentineuniversity.comGoDaddy.com, LLC6 Apr 20147 Apr 20246 Apr 2025
121valentineweeklist.in-2 Oct 201320 Jan 20172 Oct 2017
122valentinexday.comRealtime Register B.V.31 Oct 202214 Nov 202331 Oct 2023
123valentinhotels.comTucows Domains Inc.19 Aug 200414 Aug 202319 Aug 2028
124valentinmaya.comAcens Technologies, S.L.U.6 Apr 20071 Apr 20246 Apr 2025
125valentino.cn-17 Mar 2003-17 Mar 2032
126valentino.inSiliconHouse.Net Pvt. Ltd.16 May 200614 Jun 202316 May 2027
127valentinobasket.it-6 Nov 202321 Dec 20246 Nov 2024
128valentinomea.it-6 Jul 201322 Jul 20246 Jul 2025
129valentinos.comDNC Holdings, Inc.6 May 19975 May 20237 May 2028
130valentinosbenidorm.comEstrategias WebSite S.L.3 Oct 20143 Oct 20143 Oct 2015
131valentinska.cz-18 Mar 200226 Jul 201517 Mar 2026
132valenth.comGoDaddy.com, LLC21 May 200821 May 202421 May 2025
133valentinogaremi.ca-19 Apr 201019 Mar 202418 Apr 2025
134valentina-site.ru-12 Oct 2011-12 Oct 2025
135valentinako.netÄ°simtescil BiliÅŸim A.Åž.27 Dec 20218 Feb 202527 Dec 2024
136valentinescards.orgDomainhysteria.com LLC3 Mar 20163 Mar 20173 Mar 2018
137valentinanessi.infoRegistryGate GmbH22 Oct 201415 Jan 202522 Oct 2025
138valentus.comGoDaddy.com, LLC24 Feb 200731 Oct 202224 Feb 2026
139valentinedaywishes.comTurnCommerce, Inc. DBA NameBright.com29 Apr 201723 Apr 202029 Apr 2025
140valentinayakovleva.comLimited Liability Company "Registrar of domain nam…27 Mar 201527 Mar 201527 Mar 2016
141valentinogaravanimuseum.comOVH sas22 Oct 201223 Oct 202422 Oct 2025
142valentinocheapsale.comBarbero & Associates Limited26 Apr 201713 Mar 202426 Apr 2025
143valentino-store.comBarbero & Associates Limited10 Jan 20165 Sep 202310 Jan 2026
144valentinesdelightfarms.comGoDaddy.com, LLC23 Oct 201424 Oct 202423 Oct 2029
145valentineburning.comGoDaddy.com, LLC25 Jan 201625 Jan 201625 Jan 2017
146valentinabows.comTucows Domains Inc.23 Oct 201427 Oct 201523 Oct 2016
147valentinaalibertiarchitetto.comWild West Domains, LLC23 Oct 201422 Sep 202423 Oct 2025
148valentinaquintero.com.ve-16 Oct 201521 Oct 201516 Oct 2016
149valentine.gr----
150valentineloungeweargroup.comTucows Domains Inc.26 Oct 20236 Jan 202526 Oct 2024
151valenta.se-28 Feb 200220 Jan 202428 Feb 2025
152valento.es----
153valentinanessi.orgRegistryGate GmbH22 Oct 201422 Oct 202422 Oct 2025
154valentinanessi.netRegistryGate GmbH22 Oct 201423 Oct 202422 Oct 2025
155valentinamarrone.comTucows Domains Inc.21 Jan 201523 Jan 202521 Jan 2026
156valentustour.comGoDaddy.com, LLC15 May 201416 May 202415 May 2025
157valentiaislandcottages.comBlacknight Internet Solutions Ltd.7 Mar 200510 Feb 20237 Mar 2026
158valentinashep.comFastDomain Inc.25 Oct 201429 Dec 201525 Oct 2017
159valentinaparis.comGoDaddy.com, LLC13 Jun 202313 Jun 202313 Jun 2024
160valentinafelce.comGoDaddy.com, LLC25 Oct 201425 Oct 202425 Oct 2025
161valenti-versusfilms.com1&1 Internet AG25 Jan 201413 Apr 201825 Jan 2026
162valentinesdayquotes2015.netTucows Domains Inc.31 Dec 201531 Dec 201531 Dec 2016
163valentinesdayquotescards2015.comMfro Inc.6 Jun 20196 Jun 20196 Jun 2020
164valentinesdayquotes2015.comGMO Internet Inc.25 Dec 201518 Nov 201625 Dec 2017
165valentina.ru-1 Aug 2000-1 Aug 2025
166valentinoshoe.comKey-Systems GmbH11 Mar 20179 Aug 202411 Mar 2025
167valentin-software.comRegistryGate GmbH7 Nov 200712 Dec 20247 Nov 2025
168valentine.es----
169valentinogaravanimuseum.orgOVH sas22 Oct 20126 Dec 202422 Oct 2025
170valentinecherrycreations.orgTucows Domains Inc.19 Oct 201323 Oct 201419 Oct 2015
171valentinomunoz.comGoDaddy.com, LLC25 May 201326 May 201525 May 2016
172valentinoromero.comTucows Domains Inc.25 Oct 201426 Sep 201725 Oct 2018
173valentinecourse.comGoDaddy.com, LLC26 Oct 20146 Jan 202526 Oct 2024
174valentinatopclass.comDreamHost, LLC25 Oct 201425 Oct 201425 Oct 2015
175valentinasbridal.comTucows Domains Inc.22 Oct 201026 Oct 201422 Oct 2015
176valentinaraschielli.comTucows Domains Inc.25 Oct 201429 Oct 201525 Oct 2016
177valentinamelie.comeNom, Inc.25 Oct 201425 Oct 201425 Oct 2015
178valentinagrace.comGoogle, Inc.1 Aug 202018 Jul 20241 Aug 2025
179valentin-m.comTucows Domains Inc.26 Oct 201411 Oct 202426 Oct 2025
180valentdevalencia.comGoDaddy.com, LLC26 May 201327 May 201526 May 2016
181valentinemechanical.usGoDaddy.com, LLC27 May 201327 May 201326 May 2015
182valentinasgarden.comWix.com Ltd.31 Oct 20204 Nov 202331 Oct 2024
183valentinemolet.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
184valentinpeichinoff.orgGoDaddy.com, LLC28 May 20099 Jun 201528 May 2016
185valentinesdaydoneforyou.comGoDaddy.com, LLC4 May 200929 May 201528 May 2016
186valentinewreath.comGoDaddy.com, LLC5 Jan 20246 Jan 20255 Jan 2026
187valentinestationary.comGoDaddy.com, LLC29 May 201030 May 201529 May 2016
188valentinoh.comWorld4You Internet Services GmbH14 Jan 202514 Jan 202514 Jan 2026
189valentinaoficial.orgGoDaddy.com, LLC30 May 201411 Jun 201530 May 2016
190valentinaoficial.netGoDaddy.com, LLC30 May 201431 May 201530 May 2016
191valentinehill.coGoDaddy.com, LLC31 May 20135 Jun 201530 May 2015
192valentinaoficial.infoGoDaddy.com, LLC30 May 201430 May 201530 May 2016
193valentinajewelers.comIHS Telekom, Inc.3 May 202017 Apr 20243 May 2025
194valentinaoficial.comNordreg AB18 Jun 202418 Jun 202418 Jun 2025
195valentusfocus.comGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2015
196valentinesplace.comTurnCommerce, Inc. DBA NameBright.com13 Jan 201812 Feb 202513 Jan 2025
197valentinerealtyinc.comName Nelly Corporation14 Jan 201915 Jan 201914 Jan 2020
198valentine-lemercier.comNetwork Solutions, LLC26 Oct 201426 Oct 201426 Oct 2015
199valentinaroom.com1&1 Internet AG26 Oct 201427 Oct 201626 Oct 2018
200valentinaailis.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…26 Oct 201426 Oct 201426 Oct 2015
201valentinebiofuel.org----
202valentinogifts.comBarbero & Associates Limited13 Jan 20225 Sep 202313 Jan 2026
203valentineforme.comGoDaddy.com, LLC3 Jun 20144 Jun 20153 Jun 2016
204valentegarza.netGoDaddy.com, LLC3 Jun 20134 Jun 20153 Jun 2016
205valentyn.proGoDaddy.com, LLC25 Oct 20149 Dec 202425 Oct 2025
206valentinospizzeriahg.comGoDaddy.com, LLC23 Jul 201823 Jul 201823 Jul 2019
207valentinovillarreallaw.comGoDaddy.com, LLC23 May 201424 May 201523 May 2016
208valentine2c.comGoDaddy.com, LLC22 May 201123 May 201522 May 2016
209valentze.comGoDaddy.com, LLC27 Oct 201427 Oct 201427 Oct 2015
210valentinguiod.comTucows Domains Inc.6 Dec 201710 Dec 20246 Dec 2025
211valentinegras.comWild West Domains, LLC27 Oct 201427 Sep 201627 Oct 2017
212valentinbrenner.comOne.com A/S27 Oct 201428 Oct 202427 Oct 2025
213valentinasolera.comTucows Domains Inc.27 Oct 201430 Sep 202427 Oct 2025
214valentinaphs.comTucows Domains Inc.24 Oct 201328 Oct 201424 Oct 2015
215valentinesbaltimoreescortservice.comGoDaddy.com, LLC4 Jun 20125 Jun 20154 Jun 2016
216valentusbuzz.comGoDaddy.com, LLC4 Jun 20145 Jun 20154 Jun 2016
217valentina-tikhonenko.comGoDaddy.com, LLC5 Jun 20146 Jun 20155 Jun 2016
218valentinesgiftbaskets.comNetwork Solutions, LLC12 Mar 200311 Jan 202512 Mar 2027
219valentinesurfacing.comNetwork Solutions, LLC22 Mar 202428 Mar 202422 Mar 2025
220valentich.comNetwork Solutions, LLC25 Feb 20165 Apr 202425 Feb 2027
221valentinelingerie.comGoDaddy.com, LLC3 Jul 20174 Jul 20243 Jul 2025
222valentinesdayflowergift.usWild West Domains, LLC29 Mar 20158 Mar 201728 Mar 2018
223valentinerealestate.comGoDaddy.com, LLC17 Nov 199918 Nov 202417 Nov 2025
224valentinesdaycardsideas.comeNom, Inc.28 Nov 20161 Dec 201728 Nov 2017
225valentinedates.comDropCatch.com 533 LLC21 Jun 201615 Jan 202021 Jun 2025
226valentinojpsaleforu.comGMO Internet Inc.28 Oct 201429 Oct 201428 Oct 2015
227valentineweightlossblog.comDomain.com, LLC28 Oct 201416 Sep 201528 Oct 2019
228valentinesdaycoupon.comDropCatch.com 970 LLC6 Jan 20206 Jan 20206 Jan 2021
229valentinesday2015quotes.comGoDaddy.com, LLC28 Oct 201428 Oct 201428 Oct 2015
230valentinescoupon.comDomain.com, LLC18 Oct 200610 Apr 201718 Oct 2017
231valentinedaycoupons.comHiChina Zhicheng Technology Limited30 Mar 201830 Mar 201830 Mar 2019
232valentinaestela.comAutomattic Inc.29 Aug 202211 Nov 202329 Aug 2023
233valentinestopsites.comGoDaddy.com, LLC18 Oct 200318 Apr 201518 Oct 2015
234valentinegift.coGoDaddy.com, LLC16 Dec 201319 May 201515 Dec 2015
235valentinarestaurant.comGoDaddy.com, LLC24 Dec 202025 Dec 202424 Dec 2025
236valentineconstruction.comeNom, Inc.6 Feb 201013 Feb 20256 Feb 2026
237valentinesdaytraditions.comeNom, Inc.19 Apr 200911 May 201719 Apr 2018
238valentinetrav.comeNom, Inc.20 Apr 201111 May 201720 Apr 2018
239valentinovo.comGoDaddy.com, LLC29 Jan 20214 Jan 202529 Jan 2026
240valentineschools.comGoDaddy.com, LLC17 Mar 202117 Mar 202117 Mar 2022
241valentinni.comPDR Ltd. d/b/a PublicDomainRegistry.com31 May 202431 May 202431 May 2025
242valentno.comBarbero & Associates Limited28 Apr 202329 Apr 202428 Apr 2025
243valentinoristorante.comGoDaddy.com, LLC20 Dec 202323 Jun 202420 Dec 2028
244valentique.comTucows Domains Inc.5 Aug 20248 Sep 20245 Aug 2025
245valentinetx.comGoDaddy.com, LLC4 Mar 201413 Feb 20244 Mar 2025
246valentinorossi46.netTucows Domains Inc.1 Feb 20075 Feb 20181 Feb 2018
247valentinapan.neteNom, Inc.27 Oct 201427 Oct 201427 Oct 2015
248valentinesdaygiftstore.comeNom, Inc.27 Jan 201123 Jan 201727 Jan 2018
249valentineflorists.comGoDaddy.com, LLC31 Jan 20221 Feb 202531 Jan 2026
250valentinesday411.comGoDaddy.com, LLC15 Feb 201016 Jun 201515 Feb 2016
251valentia.netGMO Internet Inc.3 Oct 201718 Sep 20243 Oct 2025
252valentinesday2016.comGoDaddy.com, LLC1 Mar 201515 Apr 20151 Mar 2016
253valentineyachts.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
254valentinewebsite.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
255valentinesupplements.comGoDaddy.com, LLC30 Oct 201412 Dec 201615 Jan 2018
256valentinesnacks.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
257valentinesite.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
258valentinesauces.comGoDaddy.com, LLC30 Oct 201412 Dec 201615 Jan 2018
259valentinesauce.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
260valentines-day-gifts-4u.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
261valentinerub.comBeijing Lanhai Jiye Technology Co., Ltd24 Apr 202225 Apr 202324 Apr 2024
262valentinerocks.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
263valentineranchhelotes.comGoDaddy.com, LLC29 Oct 201424 Oct 201629 Oct 2017
264valentinepop.comPorkbun, LLC31 Jan 20241 Feb 202531 Jan 2026
265valentinepepper.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
266valentineorganic.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
267valentineinparis.comGoDaddy.com, LLC29 Oct 20146 Nov 202429 Oct 2027
268valentinefund.comNetwork Solutions, LLC22 Nov 201923 Sep 202422 Nov 2025
269valentinedressing.comGoDaddy.com, LLC30 Oct 201412 Dec 201615 Jan 2018
270valentinechips.comDynadot, LLC30 Oct 20145 Jan 202515 Jan 2027
271valentinecereal.comGoDaddy.com, LLC30 Oct 201412 Dec 201615 Jan 2018
272valentineatmidtown.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
273valentinarthurdubois.comTucows Domains Inc.29 Oct 20142 Nov 202029 Oct 2020
274valentinanessicollection.comRegistryGate GmbH29 Oct 20143 Dec 202429 Oct 2025
275valentinaegoshkina.com1&1 Internet AG29 Oct 201430 Oct 201629 Oct 2017
276valentinadimartino.comSquarespace Domains LLC16 Feb 202416 Feb 202516 Feb 2025
277valentifitnesscompetitionprep.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
278valentifitness.comGoDaddy.com, LLC29 Oct 201429 Oct 201429 Oct 2015
279valentinesdaymassacre.comGoDaddy.com, LLC24 Jun 201725 Jun 202424 Jun 2025
280valentinerings.comDropCatch.com 1326 LLC8 Mar 20248 Mar 20248 Mar 2025
281valentinabonariva.comGoDaddy.com, LLC23 Jan 201523 Jan 201523 Jan 2016
282valentinedinner.comDynadot, LLC2 Apr 20223 Apr 20232 Apr 2024
283valentineflowerarrangements.comGoDaddy.com, LLC16 Nov 20134 May 201516 Nov 2015
284valentinesecard.comGoDaddy.com, LLC2 Dec 20106 May 20152 Dec 2015
285valentinelawfirm.comGoDaddy.com, LLC4 Oct 20015 Oct 20244 Oct 2025
286valente.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…1 Mar 20245 Dec 20241 Mar 2025
287valentinia.comUniregistrar Corp26 Mar 201426 Sep 202426 Mar 2025
288valentinecityschools.orgGo Australia Domains, LLC1 Feb 201512 Jan 20171 Feb 2018
289valentinocuts.comGoDaddy.com, LLC20 Apr 201518 Sep 202220 Apr 2025
290valentinasrestaurant.netregister.com, Inc.21 Jan 202021 Jan 202021 Jan 2021
291valentinesdayplanner.com1&1 Internet AG22 May 200726 Mar 201522 May 2016
292valentinesdaypartyguide.com1&1 Internet AG3 Oct 20074 Oct 20143 Oct 2015
293valentinesdaycoupon.netDomain.com, LLC18 Oct 200628 Sep 201718 Oct 2018
294valentinescoupon.netAnessia Inc.7 Jan 20209 Jan 20207 Jan 2021
295valentinedaycoupons.netDomain.com, LLC18 Oct 200628 Sep 201718 Oct 2018
296valentinecoupons.netNamesilo, LLC26 Apr 201926 Apr 202026 Apr 2020
297valentinecoupon.netDomain.com, LLC18 Oct 200628 Sep 201718 Oct 2018
298valentinoflooring.comGoDaddy.com, LLC13 Oct 200416 Oct 202413 Oct 2025
299valentineonline.comAnnulet LLC9 Dec 200326 Jan 20259 Dec 2025
300valentine-ideas.comGoDaddy.com, LLC19 Jan 202330 Jan 202419 Jan 2025
301valentiniclothing.comGoDaddy.com, LLC15 Mar 201014 Dec 202415 Mar 2025
302valentiniusa.comGoDaddy.com, LLC3 Oct 20093 Oct 20243 Oct 2025
303valentinoclothing.comGoDaddy.com, LLC15 Mar 201029 Feb 202415 Mar 2025
304valentine59.comTucows Domains Inc.2 Jan 20252 Jan 20252 Jan 2026
305valentinedecorations.comGoDaddy.com, LLC22 Nov 202422 Nov 202422 Nov 2025
306valentineplanner.comGoDaddy.com, LLC30 Dec 201130 Dec 202430 Dec 2025
307valentinetodos.comGoDaddy.com, LLC19 Dec 201120 Dec 202419 Dec 2025
308valentineplan.comGoDaddy.com, LLC30 Dec 201130 Dec 202430 Dec 2025
309valentinetodo.comGoDaddy.com, LLC19 Dec 201120 Dec 201419 Dec 2015
310valentinecoach.comGoDaddy.com, LLC19 Dec 201120 Dec 202419 Dec 2025
311valentinelists.comGoDaddy.com, LLC19 Dec 201120 Dec 202419 Dec 2025
312valentinetutor.comGoDaddy.com, LLC19 Dec 201120 Dec 201419 Dec 2015
313valentinelist.comGoDaddy.com, LLC19 Dec 201120 Dec 201419 Dec 2015
314valentinepal.comGoDaddy.com, LLC8 Jan 20129 Jan 20258 Jan 2026
315valentinehelp.comGoDaddy.com, LLC19 Dec 201120 Dec 202419 Dec 2025
316valentineplans.comGoDaddy.com, LLC30 Dec 201130 Dec 202430 Dec 2025
317valentinomusic.infoNameCheap, Inc.3 Jun 202215 Jul 20233 Jun 2023
318valentinecakes.comDynadot, LLC1 May 202223 Sep 20241 May 2026
319valentinaworks.comWix.com Ltd.15 May 202415 May 202415 May 2025
320valentinavelagiraldo.comTucows Domains Inc.30 Oct 20143 Nov 202330 Oct 2024
321valentinapachecofernandes.comTucows Domains Inc.30 Oct 20143 Nov 201730 Oct 2017
322valentinaboutiquestore.comTucows Domains Inc.27 Oct 201331 Oct 201427 Oct 2015
323valentimanagementconsulting.comName.com, Inc.31 Oct 201431 Oct 201431 Oct 2015
324valentinecabins.comGoDaddy.com, LLC11 Jun 20029 May 202411 Jun 2025
325valentinedate.comNamesilo, LLC24 Oct 202415 Jan 202524 Oct 2026
326valentinabrickoven.comGoDaddy.com, LLC11 Jun 20142 Jul 201511 Jun 2016
327valentine.netGoDaddy.com, LLC2 Nov 19965 Dec 20241 Nov 2025
328valentinesdaycards2014.comGoDaddy.com, LLC5 Jan 201418 Feb 20155 Jan 2016
329valentinesdaygiftforher.comGoDaddy.com, LLC11 Sep 202325 Sep 202411 Sep 2025
330valentinesdaysexygifts.comGoDaddy.com, LLC28 Dec 200925 Apr 201528 Dec 2015
331valentinephoto.comGoDaddy.com, LLC26 May 20106 May 202426 May 2025
332valentstudy.comeNom, Inc.31 Oct 20142 Oct 201631 Oct 2017
333valentinovillarreal.comGoDaddy.com, LLC31 Oct 20147 Nov 202331 Oct 2028
334valentineleloup.com-25 Jun 202327 Aug 202425 Jun 2024
335valentinegray.comRegister.it SPA26 Jul 202226 Jul 202226 Jul 2032
336valentine4us.comeNom, Inc.31 Oct 201431 Oct 201431 Oct 2015
337valentinasiciliani.comRegister.it SPA31 Oct 20146 Sep 202431 Oct 2025
338valentinalexeev.comWebfusion Ltd.31 Oct 201424 Oct 201631 Oct 2018
339valentinaheightsbansko.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2015
340valentinabilancierimusic.comTucows Domains Inc.29 Oct 20131 Nov 201429 Oct 2015
341valentinesdaygift.net-26 Jan 202310 Sep 202426 Jan 2026
342valentineappliques.comGoDaddy.com, LLC5 Jan 20136 Jan 20155 Jan 2016
343valentineapplique.comGoDaddy.com, LLC5 Jan 20136 Jan 20155 Jan 2016
344valentinedistrict.comGoDaddy.com, LLC2 Dec 201418 Apr 20152 Dec 2015
345valentinlawfirm.comNameCheap, Inc.19 Mar 201819 Mar 201819 Mar 2019
346valentinafeula.comDynadot, LLC9 Jul 201810 Jul 20189 Jul 2019
347valentinegiftsets.comNameCheap, Inc.1 Dec 202212 Jan 20241 Dec 2023
348valentinesushko.comFastDomain Inc.15 Oct 201230 Oct 201615 Oct 2017
349valentinewigs.co.uk-16 Sep 200521 Sep 202316 Sep 2025
350valentinesdaystore.comGoDaddy.com, LLC28 Jun 20069 Aug 202428 Jun 2025
351valentinedaywallpapers.orgGoDaddy.com, LLC20 Jan 20145 Mar 201520 Jan 2016
352valentinecraftsforkids.comGoDaddy.com, LLC17 Dec 201917 Dec 201917 Dec 2020
353valentinavitols.comGoDaddy.com, LLC9 Dec 200920 Feb 20249 Dec 2023
354valentinohandbag.comBarbero & Associates Limited6 Sep 20165 Sep 20236 Sep 2025
355valenticlassics.com-25 Jul 20245 Feb 202519 Aug 2025
356valentinamodel.comDropCatch.com 703 LLC28 Jan 202429 Jan 202428 Jan 2026
357valentine-a-gram.orgWild West Domains, LLC26 Sep 200810 Nov 202426 Sep 2026
358valentirestaurants.comNetwork Solutions, LLC8 Jul 20089 May 20218 Jul 2026
359valentinohandbags.comGoDaddy.com, LLC8 Nov 200523 Dec 20248 Nov 2025
360valentineweekend.com1&1 Internet AG9 Jul 20189 Jul 20189 Jul 2019
361valentinemahjongg.orgGoDaddy.com, LLC13 Jan 201214 Jan 202513 Jan 2026
362valentinesdaycards.orgGoDaddy.com, LLC6 Jan 20177 Jan 20186 Jan 2019
363valentinegiftsforhim.orgPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201430 Oct 201430 Oct 2015
364valentinamazza.netGoDaddy.com, LLC30 Oct 201431 Oct 201630 Oct 2017
365valentineboutique.comGoDaddy.com, LLC29 May 202220 May 202429 May 2025
366valentinetattoo.comGoogle, Inc.31 Jan 202316 Jan 202531 Jan 2026
367valentinetattoos.comGoDaddy.com, LLC18 Apr 20189 Dec 202418 Apr 2026
368valentesdeli.comGoDaddy.com, LLC18 Jun 200719 Jun 202418 Jun 2025
369valentines-day-2015.comTreasure Trove Domains LLC29 Feb 201629 Feb 201628 Feb 2017
370valentaplumbingandheating.comPDR Ltd. d/b/a PublicDomainRegistry.com21 Jan 20115 Jan 201521 Jan 2016
371valentinalisitsa.comGoDaddy.com, LLC15 Feb 200119 Feb 202315 Feb 2033
372valentineeyecare.comGoDaddy.com, LLC5 Aug 200428 Nov 20245 Aug 2025
373valentinetrucks.comGoDaddy.com, LLC1 Nov 20141 Nov 20141 Nov 2015
374valentinebread.comNamePal.com #80236 Apr 202212 Apr 20236 Apr 2024
375valentine-hearts.comGoDaddy.com, LLC1 Nov 20141 Nov 20141 Nov 2019
376valentinasl.com-9 Jun 202315 Aug 20249 Jun 2024
377valentinasaida.comGoDaddy.com, LLC2 Nov 20143 Nov 20242 Nov 2034
378valentinalandivar.comTucows Domains Inc.2 Nov 20142 Nov 20232 Nov 2025
379valentina-boudoir.comVautron Rechenzentrum AG1 Nov 20141 Nov 20141 Nov 2015
380valentinossurfside.com-9 Sep 20249 Sep 20249 Sep 2025
381valentinecardsfree.comGoDaddy.com, LLC9 Dec 201418 Apr 20159 Dec 2015
382valentinavaughn.comGoDaddy.com, LLC25 Mar 20057 Mar 202425 Mar 2025
383valentiargenti.it-27 Oct 200515 Oct 202429 Sep 2025
384valentinesdaybuzz.comGoDaddy.com, LLC31 Jan 201731 Jan 201731 Jan 2018
385valentineimages.infoGoDaddy.com, LLC30 Jan 201420 Mar 201530 Jan 2016
386valentinesvideomessage.comGoDaddy.com, LLC2 Feb 201120 Mar 20152 Feb 2016
387valentinesgiftsselections.com----
388valentineshugs.comGoDaddy.com, LLC6 Apr 20116 Apr 20246 Apr 2025
389valentineteddygrams.comGoDaddy.com, LLC6 Apr 20116 Apr 20246 Apr 2025
390valentinevisuals.com1&1 Internet AG6 Jun 20246 Jun 20246 Jun 2025
391valentinesearcher4u.ru----
392valentins.netGoogle, Inc.16 Aug 20191 Aug 202416 Aug 2025
393valentinorossi46.infoNetwork Solutions, LLC31 Oct 2017-31 Oct 2018
394valentinesdayjewelry.infoGoDaddy.com, LLC1 Nov 20141 Nov 20141 Nov 2015
395valentinesmorning.comGoDaddy.com, LLC4 Feb 20141 Mar 20174 Feb 2018
396valentitur.comGoDaddy.com, LLC8 Jun 200712 Jun 20158 Jun 2016
397valentinesdance.comTurnCommerce, Inc. DBA NameBright.com7 Jul 20156 Aug 20247 Jul 2024
398valentinesdaysales.comGoDaddy.com, LLC4 Jan 20215 Jan 20254 Jan 2026
399valentinepoint.comGoDaddy.com, LLC28 Jan 201517 Jun 201528 Jan 2016
400valentinequote.comDropCatch.com 1475 LLC14 Sep 201814 Sep 201814 Sep 2019
401valentinefairy.comGoDaddy.com, LLC28 Jun 201528 Jun 201528 Jun 2016
402valentinabridal.comGoDaddy.com, LLC21 Aug 200221 Aug 202421 Aug 2025
403valentino-ua.comGoDaddy.com, LLC14 Nov 201515 Nov 201514 Nov 2016
404valentinifarm.comTucows Domains Inc.5 Jun 20099 Jun 20155 Jun 2016
405valentinadanciu.comTucows Domains Inc.5 Jun 20129 Jun 20155 Jun 2016
406valentinesflowerswinnipeg.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2017
407valentineflowerswinnipeg.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2017
408valentinedaywallpaperspc.comGoDaddy.com, LLC16 Nov 201616 Nov 201616 Nov 2017
409valentinavont.comeNom, Inc.2 Nov 20142 Nov 20142 Nov 2015
410valentinevessels.comeNom, Inc.12 Jun 201412 Jun 201512 Jun 2016
411valentinamatteucci.meName To Fame, Inc.11 Jun 20147 Jul 201511 Jun 2016
412valentusopportunity.comGoDaddy.com, LLC25 Nov 201925 Nov 201925 Nov 2020
413valentinestreats.comGoDaddy.com, LLC1 May 202127 Oct 20241 May 2025
414valentinachernenkova.infoWild West Domains, LLC8 Jun 20149 Jun 20158 Jun 2016
415valentifiatusa.comGoDaddy.com, LLC16 Sep 201310 Sep 202416 Sep 2025
416valentinnyc.comGoDaddy.com, LLC30 Aug 201314 Sep 202230 Aug 2025
417valentown.orgGoDaddy.com, LLC10 Jan 200311 Jan 202510 Jan 2026
418valentincard.comeNom, Inc.29 May 20135 May 201529 May 2016
419valentinosantamonica.comGoDaddy.com, LLC23 Mar 201126 Dec 202423 Mar 2025
420valentinreview.comGoDaddy.com, LLC6 Jun 20117 Jun 20156 Jun 2016
421valentine-clipart.comNameCheap, Inc.3 Jan 20024 Dec 20243 Jan 2026
422valentinesday24365.comGoDaddy.com, LLC8 Jun 20139 Jun 20158 Jun 2016
423valentinedesigns.usTucows Domains Inc.1 Nov 20144 Nov 201531 Oct 2015
424valentinovelac.comGoDaddy.com, LLC11 Jun 201412 Jun 201511 Jun 2016
425valentineedwards.comGoDaddy.com, LLC10 Jun 201311 Jun 201510 Jun 2016
426valentinehalloffame.comGoDaddy.com, LLC10 Jun 201111 Jun 201510 Jun 2016
427valentinilaw.comNetwork Solutions, LLC9 Oct 200010 Aug 20249 Oct 2027
428valentinefonts.comGoDaddy.com, LLC11 Jun 201412 Jun 201511 Jun 2016
429valentinedaygifts.orgDynadot, LLC29 Dec 201523 Dec 201629 Dec 2017
430valentingaral.comGoDaddy.com, LLC11 Jun 201412 Jun 201511 Jun 2016
431valentico.comTucows Domains Inc.17 Oct 201318 Sep 202417 Oct 2025
432valentynassecret.comMarcaria.com International, Inc.3 Nov 20143 Nov 20143 Nov 2015
433valentinprades.com-3 Nov 20143 Nov 20143 Nov 2017
434valentinovets.comNetwork Solutions, LLC4 Nov 20144 Nov 20144 Nov 2015
435valentinodeotti.comTucows Domains Inc.10 Dec 201914 Dec 202010 Dec 2020
436valentinnavalihin.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 20144 Nov 20144 Nov 2015
437valentinmaskow.comAscio Technologies, Inc. Danmark - Filial af Ascio…3 Nov 20144 Oct 20173 Nov 2018
438valentinesweddinginparis.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2015
439valentine-knight.comGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2015
440valentincika.comOnlineNIC, Inc.3 Nov 20143 Nov 20143 Nov 2015
441valentinacornero.comDynadot, LLC3 Nov 20144 Nov 20243 Nov 2025
442valentinaaura.comeNom, Inc.4 Nov 20144 Nov 20144 Nov 2016
443valenteatime.com1API GmbH4 Nov 201422 Sep 20154 Nov 2018
444valentinefavre.comGMO Internet Inc.26 Feb 20229 May 202326 Feb 2023
445valentinosnypizzeria.comFastDomain Inc.30 Apr 201216 Apr 202430 Apr 2025
446valentineday.coGoDaddy.com, LLC17 Dec 201317 Dec 201616 Dec 2017
447valentinesearchersite.ru----
448valentinos-restaurant-freehold.comNetwork Solutions, LLC30 Jul 20161 Aug 202030 Jul 2021
449valentelumber.comTucows Domains Inc.2 May 201018 Apr 20242 May 2025
450valentiautocenter.comNetwork Solutions, LLC12 Nov 20034 Aug 202312 Nov 2025
451valentinipizza.comGoDaddy.com, LLC5 Apr 200717 Mar 20245 Apr 2025
452valentinipizzads.comTucows Domains Inc.14 Feb 201218 Feb 201614 Feb 2017
453valentinotailors.comNetwork Solutions, LLC3 Oct 200626 Dec 202425 Jan 2027
454valentinesdayimagesquotes.comGoDaddy.com, LLC7 Nov 20187 Nov 20187 Nov 2019
455valentinositalianrestaurant.comGoDaddy.com, LLC30 Oct 201711 Dec 202430 Oct 2024
456valentineflorist.net1&1 Internet AG23 Apr 201421 Jan 201923 Apr 2025
457valentisubaru.comNetwork Solutions, LLC18 Sep 200820 Jul 202418 Sep 2025
458valentinositaliancuisine.comGoDaddy.com, LLC21 Jul 20212 Oct 202421 Jul 2024
459valentinesdaycardss.comGoDaddy.com, LLC1 Feb 20171 Feb 20171 Feb 2018
460valentine-lawfirm.comGoDaddy.com, LLC8 Apr 20198 Apr 20198 Apr 2020
461valentinovamp.com1&1 Internet AG4 Dec 201113 Apr 20184 Dec 2025
462valentinehearts.netGoDaddy.com, LLC26 Jan 201412 Mar 201526 Jan 2016
463valentineteam.comGoDaddy.com, LLC8 Jun 20007 Aug 202411 Jun 2025
464valentina-sydneyseer.com.au--25 Aug 2024-
465valenticadillac.comNetwork Solutions, LLC14 Apr 200829 Jan 202514 Apr 2026
466valentinesearcher.ru----
467valentinedaystuff.comGoDaddy.com, LLC31 Dec 201410 Jan 202531 Dec 2025
468valentinesnails.comNameKing.com Inc.26 Aug 202327 Jul 202426 Aug 2025
469valentineva.comTurnCommerce, Inc. DBA NameBright.com21 Apr 202015 Apr 202121 Apr 2025
470valentinesdayidea-s.comGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2015
471valentineschooltypingclub.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 20144 Nov 20144 Nov 2015
472valentinastrattoria.comGoDaddy.com, LLC4 Nov 20144 Nov 20144 Nov 2016
473valentineauto.com1&1 Internet AG16 Apr 201225 Oct 202116 Apr 2025
474valentusoverview.comGoDaddy.com, LLC21 Feb 201521 Feb 201521 Feb 2016
475valentineflowersprescott.comGoDaddy.com, LLC22 Jan 201418 Jul 20241 Jan 2026
476valentinelandandtimber.comGoDaddy.com, LLC19 Jun 200319 Jun 202419 Jun 2025
477valentesrestaurant.comGoDaddy.com, LLC30 Nov 200330 Nov 202430 Nov 2025
478valentinesday.ninjaeNom, Inc.6 Dec 201415 Dec 20146 Dec 2015
479valentinooutlets.orgXin Net Technology Corporation3 Nov 2014-3 Nov 2015
480valentine-knight.orgGoDaddy.com, LLC3 Nov 20143 Nov 20143 Nov 2015
481valentebrothersperu.comGoDaddy.com, LLC14 Jun 201214 Jun 201514 Jun 2016
482valentinako.comDynadot, LLC17 Aug 20143 Jan 202517 Aug 2026
483valentinehypnotherapy.comregister.com, Inc.31 Jan 202231 Jan 202231 Jan 2023
484valentinim.comGoDaddy.com, LLC18 Aug 201418 Aug 201418 Aug 2015
485valentinosalescheap.comBarbero & Associates Limited17 Dec 20155 Sep 202317 Dec 2025
486valentisrelentless.comNetwork Solutions, LLC5 Nov 20145 Mar 20175 Nov 2017
487valentinobardino.comTucows Domains Inc.5 Nov 20149 Nov 20215 Nov 2021
488valentinfontaine.comOVH sas5 Nov 20146 Nov 20245 Nov 2025
489valentinetoulemonde.comPaknic (Private) Limited2 Feb 202328 Feb 20232 Feb 2024
490valentinelovestango.comAscio Technologies, Inc. Danmark - Filial af Ascio…5 Nov 20145 Nov 20145 Nov 2015
491valentinehomeimprovement.comeNom, Inc.5 Nov 201427 Oct 20245 Nov 2025
492valentineexchange.comAnnulet LLC23 Jan 201611 Mar 201723 Jan 2018
493valentine-urbschat.comCronon AG5 Nov 201425 Dec 20245 Nov 2025
494valentinachepiga.comGoDaddy.com, LLC5 Nov 20145 Nov 20145 Nov 2019
495valentimimoveis.comPDR Ltd. d/b/a PublicDomainRegistry.com5 Nov 20145 Nov 20245 Nov 2026
496valentichevrolet.comeNom, Inc.4 Nov 20146 Oct 20174 Nov 2018
497valentineholdinggroup.comGoDaddy.com, LLC13 Jun 201314 Jun 201513 Jun 2016
498valentineimage.comGoDaddy.com, LLC24 Mar 201625 Mar 202424 Mar 2025
499valentinebuilders.comTurnCommerce, Inc. DBA NameBright.com2 Sep 201527 Aug 20202 Sep 2025
500valentinav.infoGoDaddy.com, LLC15 Jun 201315 Jun 201515 Jun 2016
501valentinavelasques.infoGoDaddy.com, LLC15 Jun 201315 Jun 201515 Jun 2016
502valentinapresidente.comWild West Domains, LLC16 Jun 201117 Jun 201516 Jun 2016
503valentinflorea.comGoDaddy.com, LLC16 Jun 201217 Jun 201516 Jun 2016
504valentinoslosalamitos.comWild West Domains, LLC17 Jun 201018 Jun 201517 Jun 2016
505valentinejoe.comGoDaddy.com, LLC19 Jun 201319 Jun 201519 Jun 2016
506valentimusic.comCrazy Domains FZ-LLC18 Aug 201410 Aug 202418 Aug 2025
507valentin-jachmann.infoCronon AG18 Aug 2014-18 Aug 2015
508valentin-traen.comELB Group Inc.18 Aug 20149 Oct 202418 Aug 2024
509valentinafrugiuele.comTucows Domains Inc.8 Nov 200510 Oct 20248 Nov 2025
510valentinagaribay.comWix.com Ltd.3 Oct 20207 Oct 20233 Oct 2024
511valentinaluppino.comNetwork Solutions, LLC19 Aug 201420 Jul 202419 Aug 2026
512valentine-dynalifes.comTucows Domains Inc.18 Aug 201422 Aug 201518 Aug 2016
513valentinerealtygroup.comGoDaddy.com, LLC2 Jun 20203 Jun 20242 Jun 2025
514valentinevalentine.usGoDaddy.com, LLC18 Aug 20143 Aug 201517 Aug 2017
515valentinospizza.infoWild West Domains, LLC18 Jun 200918 Jun 201518 Jun 2016
516valentineagencyddc.comGoDaddy.com, LLC19 Jun 200920 Jun 201519 Jun 2016
517valentinedayimages.comDropCatch.com 514 LLC11 Feb 201713 Feb 201711 Feb 2018
518valentinedaypicture.comGoDaddy.com, LLC20 Jun 201420 Jun 201520 Jun 2016
519valentinedayimage.comTucows Domains Inc.31 Mar 201931 Mar 201931 Mar 2020
520valentetuxedos.netDreamHost, LLC31 Oct 20125 Nov 201431 Oct 2015
521valentineandthomasbarthel.comeNom, Inc.19 Aug 201419 Aug 201419 Aug 2015
522valentinescupcakes.comGoDaddy.com, LLC19 Aug 201419 Aug 201419 Aug 2015
523valentinesluckycoinshop.comTucows Domains Inc.16 Aug 201319 Aug 201416 Aug 2015
524valentino-favre-conti.com-18 Aug 200618 Aug 200618 Aug 2017
525valentinointerlandi.comTucows Domains Inc.19 Aug 201414 Dec 202419 Aug 2026
526valentinphotographe.comNetwork Solutions, LLC19 Aug 201419 Aug 201419 Aug 2016
527valentown.netGandi SAS19 Aug 20148 Sep 201519 Aug 2016
528valenta-simeiz.comNetwork Solutions, LLC24 Jun 201524 Jun 201524 Jun 2016
529valentebenefits.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
530valentinabaluyk.comInternet Invest, Ltd. dba Imena.ua24 Jun 20155 Jul 201724 Jun 2018
531valentine-handmade.comGoDaddy.com, LLC24 Jun 201524 Jun 201524 Jun 2016
532valentinejewelery.comTucows Domains Inc.21 Jun 201425 Jun 201521 Jun 2016
533valentinolegend.comTucows Domains Inc.24 Jun 201520 Nov 202424 Jun 2026
534valentinocheapsshop.comBarbero & Associates Limited28 Dec 20155 Sep 202328 Dec 2025
535valentineyear.comGoDaddy.com, LLC1 Nov 20191 Nov 20191 Nov 2020
536valentinesyear.comWix.com Ltd.13 Feb 202125 Apr 202313 Feb 2023
537valentinematchmaking.comGoDaddy.com, LLC14 Apr 202123 Jun 202414 Apr 2025
538valentine-setdesign.comOVH sas6 Nov 20147 Nov 20246 Nov 2025
539valentinahotelbansko.comGoDaddy.com, LLC6 Nov 201426 Oct 20166 Nov 2018
540valentinacoutinho.comCronon AG10 Jun 202010 Aug 202410 Jun 2024
541valentinaalexandrovna.comAscio Technologies, Inc. Danmark - Filial af Ascio…6 Nov 20146 Nov 20146 Nov 2015
542valentijnfotografie.comNetwork Solutions, LLC3 Oct 20183 Oct 20183 Oct 2020
543valentinagalimberti.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
544valentinamassaro.comInfomaniak Network SA20 Aug 20146 Aug 202420 Aug 2025
545valentine2.comTurnCommerce, Inc. DBA NameBright.com20 Aug 201414 Aug 202020 Aug 2025
546valentinecoget.comTucows Domains Inc.20 Aug 201424 Aug 201820 Aug 2018
547valentinelovecraftfalcon.comGoDaddy.com, LLC29 May 20189 Jul 202429 May 2024
548valentino-outlet.netBarbero & Associates Limited1 Jul 20195 Sep 20231 Jul 2025
549valentinoshoesale.comBarbero & Associates Limited21 Aug 201413 Mar 202421 Aug 2025
550valent80s.comNameCheap, Inc.13 Jan 201514 Dec 202413 Jan 2026
551valentinaloren.comGoDaddy.com, LLC13 Jan 201514 Jan 202413 Jan 2026
552valentinasweet.comGoDaddy.com, LLC15 Nov 202215 Nov 202215 Nov 2023
553valentine-images.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
554valentinegarig.comDeluxe Small Business Sales, Inc. d/b/a Aplus.net12 Jan 201512 Jan 201712 Jan 2018
555valentineluminaries.comDNC Holdings, Inc.12 Jan 201528 Nov 202412 Jan 2026
556valentinepm.comNetwork Solutions, LLC12 Jan 201524 Feb 201712 Jan 2018
557valentinequotes.netNameCheap, Inc.7 Jan 20187 Jan 20187 Jan 2019
558valentines-day-images.comKey-Systems GmbH4 Mar 202420 Sep 20244 Mar 2025
559valentinesdatesheet.comGMO Internet Inc.26 Aug 20226 Nov 202326 Aug 2023
560valentinesday2015images.netPDR Ltd. d/b/a PublicDomainRegistry.com8 Jan 201513 Jan 20158 Jan 2016
561valentinesdayweek.comHostinger, UAB10 Dec 202219 Feb 202410 Dec 2023
562valentinesforsequoia.comTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
563valentinesinnewbraunfels.comNameCheap, Inc.12 Jan 201523 Feb 202412 Jan 2024
564valentinetopia.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
565valentinreflexologie.comTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
566valentinschuetz.comRegistryGate GmbH12 Jan 201513 Jan 202512 Jan 2026
567valentinafoto.comeNom, Inc.21 Aug 201421 Aug 201421 Aug 2015
568valentinaramacciotti.comTucows Domains Inc.22 Nov 200918 Nov 202422 Nov 2025
569valentino-family.comGoDaddy.com, LLC21 Aug 201425 Sep 202421 Aug 2025
570valentinofamily.comGoDaddy.com, LLC21 Aug 201425 Sep 202421 Aug 2025
571valentifinehome.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2017
572valentinaferroli.com1&1 Internet AG6 Feb 20157 Feb 20176 Feb 2018
573valentinamantovani-blog.comregister.com, Inc.6 Feb 20156 Feb 20156 Feb 2017
574valentinasmobilebeauty.comTucows Domains Inc.6 Feb 201510 Feb 20166 Feb 2017
575valentineherbs.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2020
576valentinetaxservices.comFastDomain Inc.6 Feb 20156 Feb 20176 Feb 2018
577valentineweeklists.com1&1 Internet AG24 Mar 202124 Mar 202124 Mar 2022
578valentinovibes.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016
579valentusallstars.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016
580valentinskupchenko.comCJSC Registrar R017 Nov 20147 Nov 20147 Nov 2015
581valentinesdaygiftidea.comTurnCommerce, Inc. DBA NameBright.com25 Jan 201619 Jan 202125 Jan 2025
582valentine7.comNetowl, Inc.7 Nov 201419 Sep 20247 Nov 2025
583valentaa.comAscio Technologies, Inc. Danmark - Filial af Ascio…28 Feb 201528 Feb 201528 Feb 2016
584valentijn-vanmeir.comNetwork Solutions, LLC1 Mar 201510 Mar 20221 Mar 2025
585valentinacastiblanco.com1&1 Internet AG28 Feb 201528 Feb 201528 Feb 2016
586valentinealfaro.comGoDaddy.com, LLC11 Nov 201811 Nov 201811 Nov 2019
587valentinegliders.comGoDaddy.com, LLC1 Mar 20151 Mar 20151 Mar 2016
588valentineplate.comGoDaddy.com, LLC28 Feb 201528 Feb 201528 Feb 2016
589valentineracing.orgName.com, Inc.28 Feb 201513 Apr 202428 Feb 2025
590valentineracinginc.orgName.com, Inc.28 Feb 201526 Feb 201728 Feb 2018
591valentemobilya.comIHS Telekom, Inc.22 Nov 201622 Nov 201722 Nov 2018
592valentinacuriosea.comTucows Domains Inc.30 Nov 202030 Nov 202030 Nov 2021
593valentinamarketiana.comGoDaddy.com, LLC22 Aug 201422 Aug 201422 Aug 2015
594valentinazelyaeva.comTucows Domains Inc.27 Nov 201712 Nov 202427 Nov 2025
595valentific.netregister.com, Inc.14 Apr 201514 Apr 201514 Apr 2016
596valentinaderosa.com1API GmbH14 Apr 20156 Apr 202314 Apr 2025
597valentinbyhrnordic.orgAscio Technologies, Inc. Danmark - Filial af Ascio…14 Apr 201520 Feb 201714 Apr 2018
598valentisacademy.comWix.com Ltd.20 Jul 202220 Jun 202420 Jul 2025
599valenterprise.comTucows Domains Inc.23 Jan 201822 Jan 202523 Jan 2026
600valentinavalentia.comGoDaddy.com, LLC23 Aug 201424 Aug 202423 Aug 2025
601valentinememo.comGoDaddy.com, LLC23 Aug 201423 Aug 201423 Aug 2015
602valentinememos.comGoDaddy.com, LLC23 Aug 201423 Aug 201423 Aug 2015
603valentinemoment.comNamesilo, LLC23 Aug 201423 Aug 201723 Aug 2017
604valentinepayne.comTucows Domains Inc.23 Aug 201427 Aug 201723 Aug 2017
605valentinpaun.comGoDaddy.com, LLC8 Nov 20148 Nov 20148 Nov 2015
606valentinesgiftsforboyfriend.comGoDaddy.com, LLC8 Nov 20148 Nov 20148 Nov 2015
607valentinesdayquotescards.comUniregistrar Corp---
608valentinastar.comDropCatch.com 421 LLC8 Nov 20149 Nov 20178 Nov 2018
609valentinaslounge.comGoogle, Inc.11 Apr 202218 May 202411 Apr 2025
610valentim.infoGoDaddy.com, LLC9 Dec 20219 Dec 20219 Dec 2022
611valentinaolero.comTucows Domains Inc.24 Aug 201428 Aug 201524 Aug 2016
612valentinatesio.comGMO Internet Inc.24 Aug 201424 Aug 201424 Aug 2015
613valentino.mobiRebel.com Corp.25 Aug 20149 Oct 202425 Aug 2025
614valentinstefanov.comTucows Domains Inc.17 Feb 202321 Feb 202517 Feb 2025
615valentenoticias.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Aug 201412 Aug 201412 Aug 2015
616valentinaquijano.comNetwork Solutions, LLC12 Aug 201410 Aug 201612 Aug 2018
617valentinaraimondi.comTucows Domains Inc.4 May 20158 May 20204 May 2020
618valentineacademia.comGoDaddy.com, LLC12 Aug 201427 Nov 202312 Aug 2026
619valentinochoa.comGMO Internet Inc.1 Oct 20214 Oct 20211 Oct 2022
620valentinochoa.usGoDaddy.com, LLC12 Aug 201412 Aug 201411 Aug 2015
621valentishealth.comTucows Domains Inc.12 Aug 201413 Jul 202312 Aug 2026
622valentinesdayquotes.orgGoDaddy.com, LLC25 Jan 201727 Mar 201725 Jan 2018
623valentinegraphics.orgLaunchpad, Inc.7 Nov 20147 Nov 20147 Nov 2015
624valentinahairstudio.infoNameCheap, Inc.22 Nov 202222 Nov 202322 Nov 2024
625valentinesinjamaica.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2016
626valentinesday2015ideasforhim.comBigRock Solutions Ltd.9 Nov 20149 Nov 20149 Nov 2015
627valentines-present.comTucows Domains Inc.6 Nov 200910 Nov 20146 Nov 2015
628valentinenest.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
629valentastic.comTucows Domains Inc.27 Jan 202331 Jan 202527 Jan 2025
630valentesergio.comTucows Domains Inc.25 Nov 20026 Jul 202425 Nov 2025
631valentiandcompany.comGoDaddy.com, LLC13 Aug 201425 Oct 202413 Aug 2024
632valentiapoloclub.comFastDomain Inc.25 Nov 201614 Dec 201725 Nov 2018
633valentinafredin.comCorehub, S.R.L.5 Aug 201413 Aug 20145 Aug 2015
634valentinelagasse.com1API GmbH13 Aug 201421 Sep 201513 Aug 2018
635valentinevacation.comTucows Domains Inc.30 Nov 202130 Nov 202130 Nov 2022
636valentinsteiner.comDropCatch.com 449 LLC30 Jun 20161 Jul 201730 Jun 2018
637valentinacampos.comHostinger, UAB19 Feb 202519 Feb 202519 Feb 2026
638valentinacasalini.comServer Plan Srl25 Aug 201426 Aug 202425 Aug 2025
639valentinasails.comGoDaddy.com, LLC25 Aug 201425 Aug 201425 Aug 2015
640valentinasbeautystudio.comTucows Domains Inc.23 Aug 201327 Aug 201423 Aug 2015
641valentineslowcostbridal2013.comTucows Domains Inc.22 Aug 201327 Aug 201422 Aug 2015
642valentinocarlotti.comGoDaddy.com, LLC26 Aug 201427 Aug 202426 Aug 2026
643valentinoturcatto.comGMO Internet Inc.25 Aug 201425 Aug 201425 Aug 2015
644valentemarcelo.comGoogle, Inc.14 Aug 201414 Aug 201414 Aug 2015
645valentin-keizerov.comeNom, Inc.14 Aug 201414 Aug 201414 Aug 2015
646valentineday2015.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2015
647valentinkeizerov.comeNom, Inc.14 Aug 201414 Aug 201414 Aug 2015
648valentinocheapshoes.comBarbero & Associates Limited12 Jul 20165 Sep 202312 Jul 2025
649valentinofoodevents.comOVH sas29 Jan 202029 Jan 202029 Jan 2021
650valentinesdaypage.comFabulous.com Pty Ltd.8 Oct 201010 Nov 20158 Oct 2016
651valentinahotz.comGoDaddy.com, LLC10 Nov 201422 Jan 202510 Nov 2024
652valentawedding.comTucows Domains Inc.7 Nov 201311 Nov 20147 Nov 2015
653valentimarquitetura.comTucows Domains Inc.27 Aug 201431 Aug 201527 Aug 2016
654valentinalabellarte.comTucows Domains Inc.27 Aug 201421 Aug 202427 Aug 2025
655valentinasantangelo.comTucows Domains Inc.24 Aug 201027 Aug 201424 Aug 2015
656valentine14.comGoDaddy.com, LLC30 Dec 202212 Mar 202430 Dec 2023
657valentinossalecheap.comBarbero & Associates Limited6 Sep 20165 Sep 20236 Sep 2025
658valentin-decruck.comRegister.it SPA15 Aug 201417 Sep 202415 Aug 2025
659valentinabymk.comNetwork Solutions, LLC15 Aug 201415 Aug 201415 Aug 2015
660valentinbohmer-gmbh.comBizcn.com, Inc.15 Aug 201422 Aug 201515 Aug 2016
661valentindecruck.comRegister.it SPA15 Aug 201417 Sep 202415 Aug 2025
662valentine-mediation.comGoDaddy.com, LLC16 Aug 201422 Nov 201516 Aug 2017
663valentinegiraud.comGoogle, Inc.27 Jan 202529 Jan 202527 Jan 2026
664valentinesjewelry.bizGoDaddy.com, LLC15 Aug 201420 Aug 202414 Aug 2025
665valentinesjewelry.netGoDaddy.com, LLC15 Aug 201416 Aug 202415 Aug 2025
666valentinesmusic.comGoDaddy.com, LLC23 May 201923 May 201923 May 2020
667valentinoruggiero.comBigRock Solutions Ltd.15 Aug 202226 Sep 202315 Aug 2023
668valentusblog.com-19 Jul 201619 Jul 201619 Jul 2019
669valentinajustina.comGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
670valentinajustina.infoGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
671valentinajustina.netGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
672valentinajustina.orgGoDaddy.com, LLC16 Aug 201416 Aug 201416 Aug 2015
673valentinamasse.comregister.com, Inc.16 Aug 201425 Aug 202316 Aug 2026
674valentinaroselli.comRegister.it SPA16 Aug 201418 Sep 201716 Aug 2018
675valentinawazir.comWix.com Ltd.9 Apr 202219 Jun 20249 Apr 2024
676valentinebret.comOVH sas16 Aug 201417 Aug 202416 Aug 2025
677valentonine.comGoDaddy.com, LLC11 Apr 201711 Apr 201711 Apr 2018
678valentinegiftideasforboyfriend.netGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
679valentastic.netGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
680valentinetroll-valentineshomeimprovements.comTucows Domains Inc.8 Nov 201212 Nov 20148 Nov 2015
681valentineswebsitedesign.comTucows Domains Inc.8 Nov 201312 Nov 20148 Nov 2015
682valentineshomeimprovements.comPDR Ltd. d/b/a PublicDomainRegistry.com8 Jun 20158 Jun 20158 Jun 2016
683valentinanoivas.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Nov 201411 Nov 201411 Nov 2015
684valentinanoiva.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Nov 201411 Nov 201411 Nov 2015
685valentinosale.orgBarbero & Associates Limited27 Oct 201611 Dec 202427 Oct 2025
686valentineradio.net-21 Apr 202421 Apr 202421 Apr 2025
687valentinaboutique.netGoDaddy.com, LLC27 Mar 202127 Mar 202127 Mar 2022
688valenttransformation.comGoDaddy.com, LLC13 Nov 201416 Nov 201613 Nov 2018
689valentinpetey.com1&1 Internet AG13 Nov 201414 Nov 201613 Nov 2017
690valentinosweeps.comregister.com, Inc.24 Feb 20171 Apr 201724 Feb 2018
691valentinoclean.comTucows Domains Inc.13 Nov 201417 Nov 201513 Nov 2016
692valentinmalherbe.comOVH sas13 Nov 201413 Nov 201713 Nov 2018
693valentinarts.comWix.com Ltd.4 May 202319 Apr 20244 May 2025
694valentinagrassi.comNameChild LLC13 Nov 201414 Nov 201713 Nov 2018
695valentinabevilacqua.comAcens Technologies, S.L.U.9 Mar 20205 Mar 20249 Mar 2025
696valentinapulcini.comTucows Domains Inc.28 Aug 20148 Nov 202328 Aug 2023
697valentinasgarderob.comWild West Domains, LLC28 Aug 201429 Jul 201628 Aug 2017
698valentinavalentina.comeNom, Inc.22 Aug 20237 Aug 202422 Aug 2025
699valentinesday2014.orgGoDaddy.com, LLC6 Feb 20173 Sep 20176 Feb 2018
700valentinoportrait.comKey-Systems GmbH9 Aug 202322 Oct 20249 Aug 2024
701valentinosaleonline.comBarbero & Associates Limited27 Oct 20165 Sep 202327 Oct 2025
702valentshop.com-16 Apr 202417 Apr 202416 Apr 2025
703valente-pedro.comOVH sas11 Sep 20149 Sep 201711 Sep 2018
704valenteens.comGoDaddy.com, LLC6 Nov 20246 Nov 20246 Nov 2027
705valentinalonghino.comGoDaddy.com, LLC11 Sep 201418 Sep 201611 Sep 2018
706valentinaok.comGMO Internet Inc.19 Oct 201519 Oct 201519 Oct 2016
707valentinasclothing.comWild West Domains, LLC28 Nov 201828 Nov 201828 Nov 2019
708valentinashoes.netWebfusion Ltd.18 Aug 202012 Dec 202418 Aug 2025
709valentine-bingo.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
710valentine-wordsearch.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
711valentineattah.orgGoDaddy.com, LLC11 Sep 201411 Sep 201411 Sep 2015
712valentinebackgammon.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
713valentinebilliards.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
714valentinecheckers.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
715valentinechess.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
716valentinecrosswords.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
717valentineslots.comGoDaddy.com, LLC11 Sep 201412 Sep 202411 Sep 2025
718valentinewed.comOnlineNIC, Inc.11 Sep 201411 Sep 201411 Sep 2015
719valentinojoyas.comBarbero & Associates Limited9 Dec 20215 Sep 20239 Dec 2025
720valentinoscarpe.comBarbero & Associates Limited10 Feb 20165 Sep 202310 Feb 2026
721valentinababystore.netTucows Domains Inc.28 Aug 20141 Sep 201528 Aug 2016
722valentinasorganicbistroandbakery.comGoDaddy.com, LLC29 Aug 201430 Aug 202429 Aug 2025
723valentinayelafinadordepianos.comNetwork Solutions, LLC29 Aug 201429 Aug 201429 Aug 2015
724valentinklimov.comNetwork Solutions, LLC29 Aug 201428 Aug 201729 Aug 2018
725valentinobags.netBarbero & Associates Limited18 Jul 20145 Sep 202318 Jul 2025
726valentinoheavens.comPDR Ltd. d/b/a PublicDomainRegistry.com20 Jan 202121 Jan 202520 Jan 2026
727valentinoslakeorion.comTucows Domains Inc.25 Aug 201129 Aug 201425 Aug 2015
728valentinterpret.netregister.com, Inc.29 Aug 201417 Sep 201529 Aug 2017
729valentismind.com1&1 Internet AG29 Aug 201429 Aug 201429 Aug 2015
730valentususa.comGoogle, Inc.1 Feb 202327 Jan 20251 Feb 2026
731valentincollege1.comregister.com, Inc.12 Sep 201412 Sep 201412 Sep 2015
732valentine2048.comGoDaddy.com, LLC12 Sep 201413 Sep 202412 Sep 2025
733valentineclone.comGoDaddy.com, LLC12 Sep 201412 Sep 201412 Sep 2015
734valentinobootscheap.comBarbero & Associates Limited26 Apr 201713 Mar 202426 Apr 2025
735valentinsbox.com1&1 Internet AG12 Sep 201412 Sep 201412 Sep 2015
736valentsis.comGoDaddy.com, LLC14 Nov 201414 Nov 201414 Nov 2015
737valentino-glueck.comWild West Domains, LLC14 Nov 201414 Nov 201414 Nov 2015
738valentinesfavorites.comAnnulet LLC20 Jan 201625 Aug 201620 Jan 2018
739valentinamarinina.comOnlineNIC, Inc.14 Nov 201414 Nov 201414 Nov 2015
740valentinakhoury.comGoDaddy.com, LLC14 Nov 201417 Sep 202214 Nov 2025
741valentinak.comGoDaddy.com, LLC14 Nov 201417 Sep 202214 Nov 2025
742valentinagui.comeNom, Inc.14 Nov 20144 Nov 201714 Nov 2018
743valentina-reisen.com1API GmbH14 Nov 201410 Aug 201814 Nov 2025
744valentinagorbatenko.comNetwork Solutions, LLC22 Jun 201822 Jun 202422 Jun 2025
745valentine-et-wilhelm.orgeNom, Inc.30 Aug 201430 Aug 201430 Aug 2015
746valentinoheavens.orgDomain.com, LLC30 Aug 201415 Aug 201630 Aug 2017
747valentinoremodeling.comNetwork Solutions, LLC30 Dec 202130 Dec 202130 Dec 2022
748valentisbusinesssolutions.comGoDaddy.com, LLC30 Aug 201411 Oct 202430 Aug 2024
749valentisbusinesssolutions.netGoDaddy.com, LLC30 Aug 201431 Aug 201630 Aug 2018
750valentisllc.comGoDaddy.com, LLC30 Aug 201431 Aug 202430 Aug 2026
751valentisllc.netGoDaddy.com, LLC30 Aug 201430 Aug 201430 Aug 2015
752valentmall.comMegazone Corp., dba HOSTING.KR5 Feb 20155 Feb 20155 Feb 2016
753valentinobottega.comNetwork Solutions, LLC13 Sep 201414 Aug 202413 Sep 2026
754valentinreis.comNameCheap, Inc.13 Sep 201425 Jan 201813 Sep 2018
755valentms.comGoDaddy.com, LLC6 Apr 202318 May 20246 Apr 2024
756valentinagorbatenko.orgTucows Domains Inc.27 Aug 200731 Aug 201527 Aug 2016
757valentinagroup.com-14 Nov 202414 Jan 202514 Nov 2026
758valentinawines.comDropCatch.com 897 LLC27 Dec 202127 Dec 202127 Dec 2022
759valentinspropertymanagement.comTucows Domains Inc.1 Sep 20145 Sep 20151 Sep 2016
760valentin-mercier.comTucows Domains Inc.1 Sep 20145 Sep 20181 Sep 2018
761valentinacarrillo.comeNom, Inc.10 Dec 201925 Nov 202410 Dec 2025
762valentinedulces.comNetwork Solutions, LLC1 Sep 20141 Sep 20141 Sep 2015
763valentinoarredamenti.comTucows Domains Inc.14 Nov 202016 Oct 202414 Nov 2025
764valentinooutlets.netXin Net Technology Corporation1 Sep 20141 Sep 20141 Sep 2015
765valentynalife.comGoDaddy.com, LLC1 Sep 20141 Sep 20141 Sep 2015
766valentiacoaching.comGoDaddy.com, LLC15 Sep 201415 Sep 201615 Sep 2018
767valentina-s.netPDR Ltd. d/b/a PublicDomainRegistry.com14 Sep 201426 Nov 202314 Sep 2023
768valentinaent.comDropCatch.com 367 LLC14 Sep 201415 Sep 201714 Sep 2018
769valentinafilmsinc.comDropCatch.com 373 LLC14 Sep 201415 Sep 201714 Sep 2018
770valentinamannucci.comRegister.it SPA14 Dec 201816 Jan 202514 Dec 2025
771valentinasdolls.comTucows Domains Inc.11 Sep 201315 Sep 201411 Sep 2015
772valentinedesigns.orgGoogle, Inc.27 Nov 202318 Nov 202427 Nov 2025
773valentineorganics.comNameCheap, Inc.14 Sep 201413 Mar 202414 Sep 2025
774valentines2048.comGoDaddy.com, LLC14 Sep 201415 Sep 202414 Sep 2025
775valentink.comTurnCommerce, Inc. DBA NameBright.com26 Jan 202126 Aug 202126 Jan 2025
776valentinosonthepark.comGoDaddy.com, LLC24 Jan 202024 Jan 202024 Jan 2021
777valentinatapia.comGoDaddy.com, LLC16 Sep 201417 Sep 201616 Sep 2017
778valentiaevents.comAcens Technologies, S.L.U.14 Sep 202318 Oct 202314 Sep 2025
779valentinaekstenzije.comDropCatch.com 1390 LLC4 Dec 20184 Dec 20184 Dec 2019
780valentinalafemmina.comInternet Domain Services BS Corp30 Nov 201620 Nov 202430 Nov 2025
781valentina-ekstenzije.comGoDaddy.com, LLC16 Sep 201417 Sep 201616 Sep 2018
782valentecollection.comTucows Domains Inc.14 Nov 201919 Nov 202014 Nov 2020
783valentin-radulescu.comGoDaddy.com, LLC2 Sep 20142 Sep 20142 Sep 2015
784valentinacorti.comDropCatch.com 596 LLC22 Nov 201623 Nov 201722 Nov 2018
785valentinegruwez.comTucows Domains Inc.1 Aug 20145 Aug 20181 Aug 2018
786valentinesells.comGoDaddy.com, LLC2 Sep 20143 Sep 20162 Sep 2018
787valentinestephanie.comNetwork Solutions, LLC3 Sep 20144 Aug 20243 Sep 2026
788valentinmaillot.comNameCheap, Inc.2 Mar 202431 Jan 20252 Mar 2026
789valentixmt2.comNetwork Solutions, LLC2 Sep 20142 Sep 20142 Sep 2015
790valentinesday2015.comDropCatch.com 639 LLC2 Feb 20163 Feb 20172 Feb 2018
791valentines-catering.comGoDaddy.com, LLC15 Nov 201415 Nov 201415 Nov 2015
792valentinamatteo.comGoDaddy.com, LLC15 Nov 201415 Nov 201415 Nov 2015
793valentinaguseva.comDropCatch.com 1392 LLC3 Feb 20183 Feb 20183 Feb 2019
794valentina-romero.comGoDaddy.com, LLC15 Nov 201427 Nov 202415 Nov 2025
795valentdesigns.comCloudFlare, Inc.25 Jan 202426 Dec 202425 Jan 2026
796valentinaacompanhantes.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Sep 201415 Sep 201415 Sep 2015
797valentinagari.com-21 Nov 202421 Nov 202421 Nov 2025
798valentinanieli.comNamesilo, LLC15 Sep 201415 Sep 201415 Sep 2016
799valentinchargy.comGandi SAS15 Sep 201415 Sep 201415 Sep 2015
800valentine-et-audrey.comGoDaddy.com, LLC9 Dec 20159 Dec 20159 Dec 2016
801valentinesfamily.comWild West Domains, LLC15 Sep 201415 Sep 201415 Sep 2015
802valentinfezza.comeNom, Inc.16 Sep 201415 Aug 201516 Sep 2018
803valentingabutan.comGoDaddy.com, LLC15 Sep 201416 Sep 201415 Sep 2015
804valentinglass.comGoDaddy.com, LLC15 Sep 201416 Sep 201615 Sep 2017
805valentinmendez.comOne.com A/S15 Sep 201416 Aug 202415 Sep 2025
806valentinoshoecheap.comBarbero & Associates Limited21 Nov 20155 Sep 202321 Nov 2025
807valentinaelsayed.comGoDaddy.com, LLC16 Sep 201416 Sep 201416 Sep 2019
808valentinasecasa.comWild West Domains, LLC16 Sep 201416 Sep 201416 Sep 2015
809valentinegifts.infoGKG.NET, INC.15 Sep 200118 Sep 202015 Sep 2021
810valentiniracing.comTucows Domains Inc.13 Sep 201317 Sep 201413 Sep 2015
811valentinodesigns.bizDomain.com, LLC17 Sep 20146 Sep 202416 Sep 2025
812valentinablanca.comEstrategias WebSite S.L.2 Sep 20103 Jul 20242 Sep 2026
813valentinapastrychef.comNetwork Solutions, LLC3 Sep 20143 Sep 20143 Sep 2015
814valentinesdayshop.com-13 Jan 20248 Feb 202513 Jan 2026
815valentinesshow.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Sep 20144 Sep 20143 Sep 2015
816valentinoscuracao.comGMO Internet Inc.20 Nov 201520 Nov 201520 Nov 2016
817valentinsuarez.comCloudFlare, Inc.16 Nov 201424 Jul 202416 Nov 2025
818valentinsfavouritetoystore.comeNom, Inc.16 Nov 201416 Nov 201416 Nov 2015
819valentinscleaning.comTucows Domains Inc.12 Nov 201317 Nov 201412 Nov 2015
820valentinewafer.comTucows Domains Inc.16 Nov 201415 Nov 202416 Nov 2025
821valentinesdaygiftshub.comeNom, Inc.16 Nov 201416 Nov 201416 Nov 2015
822valentinesdaydecorations.comHostinger, UAB11 Oct 202326 Nov 202411 Oct 2025
823valentinestreeservice.com-17 Sep 201417 Sep 201417 Sep 2017
824valentjewel.comTucows Domains Inc.14 Sep 201017 Sep 201414 Sep 2015
825valentinahomesforsale.com1&1 Internet AG17 Sep 201418 Sep 201617 Sep 2018
826valentodrinks.comDomain.com, LLC17 Sep 201417 Sep 201417 Sep 2015
827valentinalinda.comGoDaddy.com, LLC25 Nov 201625 Nov 201625 Nov 2017
828valentinayon.comGoDaddy.com, LLC17 Sep 201429 Oct 202417 Sep 2024
829valentinaelt.comTucows Domains Inc.17 Sep 201428 Nov 202317 Sep 2023
830valentineantenni.comELB Group Inc.17 Sep 201417 Sep 202417 Sep 2025
831valentin-schmuck.comCronon AG4 Sep 20144 Sep 20144 Sep 2015
832valentinasalvi.comCNOBIN INFORMATION TECHNOLOGY LIMITED24 Nov 202227 Dec 202324 Nov 2023
833valentinelihtc.comGoDaddy.com, LLC4 Sep 20145 Sep 20164 Sep 2017
834valentinesday-2015.comGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2015
835valentinevapors.comWild West Domains, LLC4 Sep 20149 Oct 20154 Sep 2017
836valentinsayavedra.comNetwork Solutions, LLC5 Sep 20147 Aug 20245 Sep 2025
837valentinseban.com1&1 Internet AG4 Sep 20144 Sep 20144 Sep 2015
838valentinetees.usGoDaddy.com, LLC15 Nov 201415 Nov 201414 Nov 2015
839valentinestees.usGoDaddy.com, LLC15 Nov 201415 Nov 201414 Nov 2015
840valentinavolpi.comGoDaddy.com, LLC17 Aug 202218 Aug 202417 Aug 2025
841valentincomanphotography.comAscio Technologies, Inc. Danmark - Filial af Ascio…17 Jan 201618 Jan 201717 Jan 2018
842valentinenutrition.netregister.com, Inc.19 Sep 20146 Sep 202419 Sep 2026
843valentinabattortidesign.comPSI-USA, Inc. dba Domain Robot3 Dec 20203 Dec 20203 Dec 2021
844valentinemalta.comGoDaddy.com, LLC29 Apr 201729 Apr 201729 Apr 2019
845valentinabattorti.comAscio Technologies, Inc. Danmark - Filial af Ascio…18 Sep 201419 Sep 201818 Sep 2019
846valentinaygustavo.comeNom, Inc.18 Sep 201418 Sep 201418 Sep 2015
847valentinoratkajec.comCSL Computer Service Langenbach GmbH d/b/a joker.c…10 Aug 202216 Aug 202410 Aug 2025
848valentinorachel.comNetwork Solutions, LLC17 Nov 201417 Nov 201417 Nov 2015
849valentinesdayusa.comTucows Domains Inc.12 Jan 202416 Jan 202512 Jan 2026
850valentinesdaygiftsales.comGoDaddy.com, LLC17 Nov 201417 Nov 201417 Nov 2016
851valentineplacese1.comTucows Domains Inc.17 Nov 201421 Nov 202017 Nov 2020
852valentinaskitchen.comGoDaddy.com, LLC20 Oct 202321 Oct 202420 Oct 2025
853valentinascooking.com1&1 Internet AG30 Jul 201630 Jul 201630 Jul 2017
854valentinamaragnani.com1&1 Internet AG17 Nov 201418 Nov 201617 Nov 2018
855valentinaimportados.comHostinger, UAB31 Oct 20243 Jan 202531 Oct 2025
856valentarchitect.comGoDaddy.com, LLC17 Nov 20144 Dec 202317 Nov 2028
857valentemoda.comGoDaddy.com, LLC7 Sep 20247 Sep 20247 Sep 2025
858valentinagoni.comNetwork Solutions, LLC5 Sep 20143 Sep 20165 Sep 2018
859valentinapilates.comGoDaddy.com, LLC17 Feb 202118 Feb 202517 Feb 2027
860valentinarabanne.comNetwork Solutions, LLC5 Sep 20145 Sep 20145 Sep 2015
861valentineontheroad.comWild West Domains, LLC5 Sep 20145 Sep 20145 Sep 2015
862valentinesfarms.comGoDaddy.com, LLC11 Aug 202216 Aug 202411 Aug 2025
863valentinoheels.comBarbero & Associates Limited10 Aug 20185 Sep 202310 Aug 2025
864valentinorosephotog.comregister.com, Inc.6 Sep 201421 Aug 20176 Sep 2018
865valentiprat.comGoDaddy.com, LLC28 May 202428 May 202428 May 2025
866valentusworldwide.comTucows Domains Inc.27 Jul 202031 Jul 202227 Jul 2023
867valentinodixongallery.comGoDaddy.com, LLC19 Sep 201420 Sep 202419 Sep 2025
868valentinanyc.comGoDaddy.com, LLC25 Oct 202225 Oct 202225 Oct 2025
869valentinastammelluti.com-16 Sep 200816 Sep 200816 Sep 2017
870valentinnguyen.comOVH sas19 Sep 201411 Aug 202219 Sep 2025
871valentinodixon.comGoDaddy.com, LLC19 Sep 201424 Nov 202419 Sep 2028
872valentinodixongolfart.comGoDaddy.com, LLC19 Sep 201420 Sep 202419 Sep 2025
873valentinarossi86.comTucows Domains Inc.19 Sep 201423 Sep 201519 Sep 2016
874valentinesarrow.comTucows Domains Inc.1 Jan 20205 Jan 20211 Jan 2021
875valentipratpons.comLaunchpad, Inc.20 Sep 201420 Sep 201420 Sep 2015
876valentineorchard.comDropCatch.com 1409 LLC25 Nov 201825 Nov 201825 Nov 2019
877valentinetennis.comGoDaddy.com, LLC22 Feb 202123 Feb 202422 Feb 2025
878valentinsjewelry.comTucows Domains Inc.23 Sep 201627 Sep 201823 Sep 2018
879valentusliving.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2016
880valentinohomecollection.comTucows Domains Inc.15 Nov 200919 Nov 201415 Nov 2015
881valentinkorte.com1&1 Internet AG18 Nov 201419 Nov 201618 Nov 2018
882valentinesafternoon.comeNom, Inc.18 Nov 201418 Nov 201418 Nov 2015
883valentinefarmmd.comGoDaddy.com, LLC19 Nov 201419 Nov 201419 Nov 2016
884valentinedesigns.bizDomain.com, LLC18 Nov 201420 Nov 201717 Nov 2017
885valentine-gift-guide.comGoDaddy.com, LLC17 May 201617 May 201617 May 2017
886valentindelluc.com1&1 Internet AG18 Nov 201418 Nov 201418 Nov 2015
887valentinamodels.com1&1 Internet AG25 Feb 202425 Feb 202425 Feb 2025
888valentiluce.comChengdu West Dimension Digital Technology Co., Ltd…26 Sep 201926 Sep 201926 Sep 2020
889valentesegurosmg.comeNom, Inc.19 Nov 201423 Jan 202519 Nov 2025
890valentinabarbaresi.comTucows Domains Inc.29 Sep 20143 Oct 202129 Sep 2021
891valentine-street.comTucows Domains Inc.14 Jan 202514 Jan 202514 Jan 2026
892valentinesday-2015.netBigRock Solutions Ltd.29 Sep 201429 Sep 201429 Sep 2015
893valentinsavin.comLimited Liability Company "Registrar of domain nam…19 Dec 20224 Dec 202419 Dec 2025
894valentescatering.comGoDaddy.com, LLC8 Sep 20149 Sep 20238 Sep 2026
895valentinabalintjones.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
896valentinafebres.comWix.com Ltd.23 Jul 202123 Jun 202423 Jul 2025
897valentinamahira.comTucows Domains Inc.8 Sep 20145 Sep 20248 Sep 2025
898valentinasclosetstore.comGoDaddy.com, LLC8 Sep 201420 Sep 20168 Sep 2017
899valentincollections.comGoDaddy.com, LLC7 Dec 20217 Dec 20217 Dec 2022
900valentineblues.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
901valentinedayblues.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
902valentinedaybluesdance.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
903valentinesblues.comTucows Domains Inc.7 Dec 201811 Dec 20197 Dec 2019
904valentinesdayblues.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
905valentinesdaybluesdance.comGoDaddy.com, LLC8 Sep 20148 Sep 20148 Sep 2015
906valentinesfoods.comName.com, Inc.8 Sep 20148 Sep 20148 Sep 2015
907valentinoshandymanservice.comeNom, Inc.8 Sep 20147 Aug 20158 Sep 2017
908valentinotesta.comSquarespace Domains LLC19 Feb 202519 Feb 202519 Feb 2028
909valentinalepore.comTucows Domains Inc.27 Sep 20121 Oct 201427 Sep 2015
910valentin-schachinger.com1&1 Internet AG30 Sep 201413 Apr 201830 Sep 2025
911valentinsarabia.comSoluciones Corporativas IP, SLU1 Oct 201414 Sep 20241 Oct 2025
912valentisubaru.mobiGMO Internet Inc.3 Oct 2014-3 Oct 2015
913valentinecharm.com1&1 Internet AG10 Jan 202510 Jan 202510 Jan 2026
914valentesdejerusalem.comPDR Ltd. d/b/a PublicDomainRegistry.com9 Sep 20149 Sep 20149 Sep 2015
915valentinagonzalez.comGoDaddy.com, LLC2 Feb 20203 Feb 20242 Feb 2026
916valentinahorisberger.comNetwork Solutions, LLC9 Sep 20149 Sep 20149 Sep 2015
917valentinosvapors.comGoDaddy.com, LLC9 Sep 20149 Sep 20149 Sep 2015
918valenthusband.netName.com, Inc.9 Sep 20148 Sep 20169 Sep 2017
919valentinesdancect.comTucows Domains Inc.19 Nov 20145 Nov 202419 Nov 2025
920valentines-day-quotes.comDropCatch.com 901 LLC28 Dec 201928 Dec 201928 Dec 2020
921valentiamedia.com1&1 Internet AG31 May 202431 May 202431 May 2025
922valentinatereshkova4real.comEveryones Internet, Ltd. dba SoftLayer3 Oct 201429 Sep 20173 Oct 2018
923valentinaintroductionagency.comNetwork Solutions, LLC3 Oct 20143 Oct 20143 Oct 2015
924valentinesresortreservations.comTucows Domains Inc.3 Oct 20147 Oct 20153 Oct 2016
925valentinphuket.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Oct 201415 Sep 20173 Oct 2018
926valentinebereanfellowship.comFastDomain Inc.10 Sep 20142 Sep 201710 Sep 2018
927valentinlures.comAbove.com Pty Ltd.25 Feb 202125 Feb 202125 Feb 2022
928valentinovoice.comGoDaddy.com, LLC10 Sep 201410 Sep 201410 Sep 2015
929valentinaparisse.comInternet Domain Services BS Corp19 Nov 201417 Nov 202419 Nov 2025
930valentinaaustin.comAscio Technologies, Inc. Danmark - Filial af Ascio…1 Oct 20141 Oct 20141 Oct 2015
931valentinoco.comWild West Domains, LLC24 Sep 202424 Sep 202424 Sep 2025
932valentinolombardi.comTucows Domains Inc.8 Sep 201912 Sep 20208 Sep 2020
933valentusforyourhealth.comeNom, Inc.2 Oct 20142 Oct 20142 Oct 2015
934valentiagin.comGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2015
935valentinabuitrago.comTucows Domains Inc.1 Oct 201424 Sep 20241 Oct 2025
936valentinafruits.comArsys Internet, S.L. dba NICLINE.COM1 Oct 20142 Oct 20171 Oct 2018
937valentinemobileinc.comCSC Corporate Domains, Inc.1 Oct 201419 Aug 20241 Oct 2025
938valentinveguillas.net1&1 Internet AG1 Oct 20141 Oct 20141 Oct 2015
939valentinoking.netGMO Internet Inc.1 Oct 20142 Oct 20141 Oct 2015
940valentinegroupe.comGoDaddy.com, LLC21 Sep 201421 Sep 201421 Sep 2015
941valentino5.comWixi Incorporated15 Oct 202416 Nov 202415 Oct 2025
942valentinesbridal-formals.comTucows Domains Inc.22 Sep 201426 Sep 201922 Sep 2019
943valentinedentalcare.comGoDaddy.com, LLC21 Sep 201422 Sep 202221 Sep 2025
944valentispizza.netLaunchpad, Inc.21 Sep 20146 Sep 202421 Sep 2025
945valentinapangia.comWild West Domains, LLC21 Sep 201421 Aug 202421 Sep 2025
946valentinedental.comGoDaddy.com, LLC21 Sep 201422 Sep 202421 Sep 2025
947valentinacortez.com-18 Aug 202219 Aug 202318 Aug 2024
948valentinghita.comVitalwerks Internet Solutions, LLC DBA No-IP6 Jan 20236 Jan 20236 Jan 2024
949valentine-shoes.comPSI-USA, Inc. dba Domain Robot2 Oct 201420 Dec 201620 Dec 2018
950valentz.comCloudFlare, Inc.18 May 202425 May 202418 May 2025
951valentinocheapssale.comBarbero & Associates Limited23 Feb 20165 Sep 202323 Feb 2025
952valentinmoser.comOwn Identity, Inc.20 Nov 201422 Oct 201820 Nov 2024
953valentineuniversityreview.comeNom, Inc.20 Nov 201420 Nov 201420 Nov 2015
954valentinelunacleaningservices.comregister.com, Inc.20 Nov 201420 Nov 201420 Nov 2015
955valentinamintah.com1&1 Internet AG20 Nov 201421 Nov 202420 Nov 2025
956valentesitalianrestaurant.comInterweb Advertising D.B.A. Profile Builder4 Oct 20144 Oct 20144 Oct 2015
957valentineparewa.comNetwork Solutions, LLC10 Jan 201610 Jan 201610 Jan 2018
958valentebakery.comHiChina Zhicheng Technology Limited22 Dec 201922 Dec 201922 Dec 2020
959valentinarussotti.comEveryones Internet, Ltd. dba SoftLayer22 Sep 20148 Sep 201722 Sep 2018
960valentinestreetproductions.com-22 Sep 201422 Sep 201422 Sep 2017
961valentusnevada.comGoDaddy.com, LLC22 Sep 201422 Sep 201422 Sep 2015
962valentinovaschetto.comeNom, Inc.22 Sep 201422 Sep 201422 Sep 2015
963valentusnevada.usNameCheap, Inc.8 Dec 20168 Dec 20177 Dec 2017
964valentinamander.comGoDaddy.com, LLC5 Oct 20146 Oct 20165 Oct 2018
965valentinofinejewelry.comBarbero & Associates Limited23 Dec 20165 Sep 202323 Dec 2025
966valentynskedarky.comTucows Domains Inc.2 Oct 20126 Oct 20142 Oct 2015
967valentinofinediamond.comBarbero & Associates Limited29 Jan 20155 Sep 202329 Jan 2026
968valentynskedarky.netTucows Domains Inc.2 Oct 20126 Oct 20142 Oct 2015
969valentinospizzafl.orgFastDomain Inc.23 Sep 201421 Oct 201723 Sep 2018
970valentine-magendie.comNetwork Solutions, LLC14 Feb 201614 Feb 201614 Feb 2017
971valentinesdaywedding.com-8 Sep 20168 Sep 20168 Sep 2017
972valentinasgroup.comeNom, Inc.24 Jan 201923 Jan 201924 Jan 2020
973valentinacastro.comWix.com Ltd.27 Mar 202026 Feb 202427 Mar 2025
974valentineisd.comTucows Domains Inc.5 Jan 20096 Sep 20245 Jan 2027
975valentinospizzafl.comFastDomain Inc.23 Sep 20148 Sep 202423 Sep 2025
976valentinospizzafl.netFastDomain Inc.23 Sep 201421 Oct 201723 Sep 2018
977valentesbakery.comGoDaddy.com, LLC6 Oct 20147 Oct 20166 Oct 2017
978valentinadimarco.comAutomattic Inc.10 Jul 202120 Jun 202410 Jul 2025
979valentinagelosi.comTucows Domains Inc.30 Apr 202023 Apr 202430 Apr 2025
980valentinasanna.netTucows Domains Inc.3 Oct 20137 Oct 20143 Oct 2015
981valentinul.infoGoDaddy.com, LLC6 Oct 20097 Oct 20176 Oct 2019
982valentinrossi.comWild West Domains, LLC21 Nov 201421 Nov 201421 Nov 2015
983valentinomusic.comGoDaddy.com, LLC21 Nov 201427 Dec 202426 Dec 2025
984valentino-outlets.comBarbero & Associates Limited27 Oct 20165 Sep 202327 Oct 2025
985valentinelovegifts.com-24 Mar 20227 May 202424 Mar 2024
986valentineandflowers.comGoDaddy.com, LLC21 Nov 201421 Nov 201421 Nov 2015
987valentinassalon.comTierraNet Inc. d/b/a DomainDiscover20 Apr 202027 Mar 202420 Apr 2025
988valentinasavina.comGoDaddy.com, LLC22 Nov 201422 Nov 201422 Nov 2016
989valentinotv.comMoniker Online Services LLC25 Sep 201925 Sep 201925 Sep 2020
990valentijnopticiens.comDropCatch.com 1088 LLC7 Sep 20187 Sep 20187 Sep 2019
991valentin-guillot.comeNom, Inc.7 Oct 20147 Oct 20147 Oct 2015
992valentinaacessorios.comFastDomain Inc.15 Apr 202415 Apr 202415 Apr 2025
993valentinesdayideas.usNameCheap, Inc.11 Jul 201713 Jul 201710 Jul 2018
994valentinesdaylove2015.comBigRock Solutions Ltd.7 Oct 20147 Oct 20147 Oct 2015
995valentinesdaywishesz.comBigRock Solutions Ltd.7 Oct 20147 Oct 20147 Oct 2015
996valentexport.neteNom, Inc.24 Sep 201425 Sep 201424 Sep 2015
997valentinaextencils.comOVH sas24 Sep 201425 Sep 202424 Sep 2025
998valentinecameron.comregister.com, Inc.24 Sep 201424 Sep 201424 Sep 2015
999valentinocapri.comTucows Domains Inc.21 Sep 201325 Sep 201421 Sep 2015
1000valentia-fashion.comCSL Computer Service Langenbach GmbH d/b/a joker.c…24 Sep 201424 Sep 201424 Sep 2015

Displaying 1,000 out of 42,978 domains starting with the keyword "VALENT". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=valent

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now