Our database now contains whois records of 593 Million (593,673,132) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1575 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [593 Million Domains] $10,000 Details

Keyword: WAF

Reverse Whois » KEYWORD [waf ]  { 26,773 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1waf.it-29 Jan 199626 Jan 202410 Jan 2025
2waf.usGoDaddy.com, LLC28 Jul 201413 Sep 202427 Jul 2025
3waf.netNamesilo, LLC6 Mar 20008 Aug 20236 Mar 2030
4waf.coGoDaddy.com, LLC21 Jul 201028 Jul 202420 Jul 2025
5waf.asiaDNSPod, Inc.2 Feb 20247 Feb 20242 Feb 2025
6waf.wangDNSPod, Inc.9 Nov 202010 Sep 20249 Nov 2026
7waf.systemsNameCheap, Inc.27 Feb 20202 Feb 202427 Feb 2025
8waf.tokyoGMO Internet Inc.22 Jul 20142 Nov 202322 Jul 2027
9waf.xyzGMO Internet Inc.15 Jun 201917 May 202415 Jun 2025
10waf.foundationGoDaddy.com, LLC12 Jan 20241 Sep 202412 Jan 2029
11waf.todayGoDaddy.com, LLC22 Apr 202427 Apr 202422 Apr 2025
12waf.expertGoDaddy.com, LLC12 Aug 202224 Aug 202312 Aug 2024
13waf.scienceAlpnames Limited5 Mar 20157 Mar 20154 Mar 2016
14waf.partyNameCheap, Inc.4 Oct 20179 Oct 20174 Oct 2022
15waf.websiteTucows Domains Inc.15 May 201525 Jun 202415 May 2024
16waf.pubAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…26 May 201520 May 202426 May 2025
17waf.worksName.com, Inc.18 Jul 201516 Jul 202418 Jul 2025
18waf.linkOVH sas28 May 20196 May 202428 May 2025
19waf.onePorkbun, LLC1 Sep 202414 Sep 20241 Sep 2025
20waf.blueGandi SAS18 Aug 201518 Aug 201518 Aug 2016
21waf.redDNSPod, Inc.28 Dec 20185 Dec 202428 Dec 2025
22waf.mobiChengdu West Dimension Digital Technology Co., Ltd…19 Mar 202424 Mar 202419 Mar 2025
23waf.winChengdu West Dimension Digital Technology Co., Ltd…24 Sep 201527 Aug 201623 Sep 2017
24waf.orgNetwork Solutions, LLC18 Nov 199721 Aug 202417 Nov 2026
25waf.comDomainRegistry.com, Inc.24 Jan 19997 Feb 202324 Jan 2026
26waf.renChengdu West Dimension Digital Technology Co., Ltd…5 Nov 2015-5 Nov 2016
27waf.xinAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…3 Dec 20243 Dec 20243 Dec 2026
28waf.bidChengdu West Dimension Digital Technology Co., Ltd…9 Nov 20154 Feb 20178 Nov 2017
29waf.siteChengdu West Dimension Digital Technology Co., Ltd…11 Nov 201526 Aug 201711 Nov 2017
30waf.dateChengdu West Dimension Digital Technology Co., Ltd…11 Nov 2015-10 Nov 2016
31waf.loanAlpnames Limited6 Jan 2016-5 Jan 2017
32waf.lolNameCheap, Inc.2 Oct 202414 Oct 20242 Oct 2025
33waf.world1API GmbH28 Jan 201613 Mar 202428 Jan 2025
34waf.kimGoDaddy.com, LLC29 Apr 202310 Jun 202429 Apr 2024
35waf.techWest263 International Limited21 Apr 201721 Apr 201721 Apr 2018
36waf.onlineWest263 International Limited23 Apr 201828 Apr 201823 Apr 2019
37waf.pinkWest263 International Limited29 Feb 2016-28 Feb 2017
38waf.blackWest263 International Limited29 Feb 2016-28 Feb 2017
39waf.cloudNom-iq Ltd. dba COM LAUDE11 Feb 201612 Feb 202411 Feb 2025
40waf.dogPorkbun, LLC27 Jun 20161 Jul 202427 Jun 2025
41waf.companyNetwork Solutions, LLC30 Nov 20156 Jan 201730 Nov 2017
42waf.sexyNameCheap, Inc.1 Apr 201414 Aug 20241 Apr 2028
43waf.bayernunited-domains AG30 Sep 201414 Nov 202430 Sep 2025
44waf.bizAscio Technologies, Inc. Danmark - Filial af Ascio…24 Jan 200230 Jan 202423 Jan 2025
45waf.digitalPSI-USA, Inc. dba Domain Robot19 Sep 20163 Nov 202419 Sep 2025
46waf.rocksPSI-USA, Inc. dba Domain Robot10 Jan 202224 Feb 202410 Jan 2025
47waf.infoDynadot, LLC9 Mar 20188 Sep 20249 Mar 2025
48waf.bzPDR Ltd. d/b/a PublicDomainRegistry.com4 Nov 20124 Nov 20244 Nov 2025
49waf.berlinPSI-USA, Inc. dba Domain Robot21 Mar 201427 Apr 202021 Mar 2025
50waf.club1&1 Internet AG7 May 201428 Jun 20176 May 2018
51waf.fr-1 Jul 202231 Aug 20244 Jul 2025
52waf.pl-24 Jan 201023 Jan 202424 Jan 2025
53waf.li----
54waf.menAlpnames Limited28 Mar 20182 Apr 201828 Mar 2019
55waf.guruOVH sas12 Mar 20238 May 202412 Mar 2024
56waf.spaceAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…22 Dec 201622 Dec 201622 Dec 2017
57waf.saleeNom, Inc.16 Mar 20179 Oct 201716 Mar 2018
58waf.storeeNom, Inc.16 Mar 2017-16 Mar 2018
59waf.life-29 May 202424 Sep 202429 May 2025
60waf.designOVH sas29 Aug 202026 Sep 202429 Aug 2024
61waf.com.cn-14 Aug 2012-14 Aug 2017
62waf.churchGoDaddy.com, LLC8 Aug 20178 Aug 20178 Aug 2018
63waf.ninjaPorkbun, LLC30 Aug 201714 Oct 202430 Aug 2025
64waf.agencyGoDaddy.com, LLC12 Jul 202417 Jul 202412 Jul 2027
65waf.co.uk-9 Feb 20041 Mar 20249 Feb 2025
66waf.org.uk-18 Feb 201828 Apr 202418 Feb 2025
67waf.inkChengdu West Dimension Digital Technology Co., Ltd…5 Jun 202410 Jun 20245 Jun 2025
68waf.networkNameCheap, Inc.26 Aug 20227 Oct 202426 Aug 2024
69waf.landNameCheap, Inc.21 Apr 20232 Jun 202421 Apr 2024
70waf.industries1&1 Internet AG23 Jul 20186 Sep 202423 Jul 2025
71waf.cityName.com, Inc.30 Jul 201825 Sep 201830 Jul 2020
72waf.groupPorkbun, LLC19 Jun 202315 Jun 202419 Jun 2025
73waf.tipsNameCheap, Inc.15 Oct 201815 Oct 201815 Oct 2019
74waf.gmbhTucows Domains Inc.16 Oct 201820 Oct 202416 Oct 2025
75waf.be-20 Jan 2000--
76waf.devNameCheap, Inc.12 Jun 202419 Jun 202412 Jun 2025
77waf.zoneCloudFlare, Inc.6 May 202311 May 20236 May 2033
78waf.services10dencehispahard, S.L.14 Aug 202224 Jul 202414 Aug 2025
79waf.cymru1&1 Internet AG15 Nov 201923 Jun 202015 Nov 2020
80waf.technologyNameCheap, Inc.27 Feb 202021 Feb 202427 Feb 2025
81waf.solutionsNameCheap, Inc.27 Feb 20202 Feb 202427 Feb 2025
82waf.goldDNSPod, Inc.25 Jun 202430 Jun 202425 Jun 2025
83waf.fanName.com, Inc.21 Apr 202021 Apr 202021 Apr 2021
84waf.nrwGlobal Village GmbH9 Jun 201724 Jul 20249 Jun 2025
85waf.plusDNSPod, Inc.10 Dec 202110 Dec 202410 Dec 2025
86waf.wikiAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…19 Mar 201826 Mar 202419 Mar 2025
87waf.moneyNameCheap, Inc.2 Dec 20202 Dec 20202 Dec 2021
88waf.runNamesilo, LLC26 Sep 202310 Nov 202426 Sep 2025
89waf.icuChengdu West Dimension Digital Technology Co., Ltd…5 Jun 202417 Jul 20245 Jun 2025
90waf.directMesh Digital Limited17 Nov 202121 Nov 202417 Nov 2025
91waf.wtfAmazon Registrar, Inc.6 Mar 202411 Mar 20246 Mar 2025
92waf.ccAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…2 Nov 201414 Oct 20242 Nov 2028
93waf.or.id-19 Jan 201810 Mar 202219 Jan 2024
94waf.la-7 Jan 202113 Dec 20237 Jan 2026
95waf.re-29 Sep 201627 Sep 202129 Sep 2022
96waf.questPorkbun, LLC19 Jul 202231 Aug 202319 Jul 2025
97waf.toolsNameCheap, Inc.21 Jul 202221 Jul 202221 Jul 2023
98waf.appNameKing.com Inc.26 Jul 202223 Oct 202426 Jul 2025
99waf.centerNameCheap, Inc.26 Aug 202226 Aug 202226 Aug 2023
100waf.coolDNSPod, Inc.1 Oct 202411 Oct 20241 Oct 2026
101waf.teamOVH sas16 Dec 20226 Dec 202416 Dec 2025
102waf.com.pl-15 May 201824 Apr 202415 May 2025
103waf.autosDynadot, LLC7 Apr 20228 Apr 20237 Apr 2024
104waf.barNameCheap, Inc.8 Aug 202414 Aug 20248 Aug 2025
105waf.cxWest263 International Limited10 Feb 202415 Feb 202410 Feb 2029
106waf.cn-30 Jun 2005-30 Jun 2030
107waf.ltdWild West Domains, LLC12 Feb 202310 Jun 202412 Feb 2025
108waf.fyiAmazon Registrar, Inc.30 Mar 20231 Mar 202430 Mar 2025
109waf.ioNameCheap, Inc.21 Apr 201323 Mar 202021 Apr 2029
110waf.co.in-15 Feb 201631 Mar 202415 Feb 2025
111waf.jp-1 Sep 20221 Oct 202430 Sep 2025
112waf.monsterNameCheap, Inc.26 Aug 202231 Aug 202326 Aug 2024
113waf.nameNameCheap, Inc.---
114waf.org.ng-4 Apr 201914 Apr 20244 Apr 2025
115waf.rip1API GmbH23 Apr 20237 Jun 202423 Apr 2025
116waf.ovhOVH sas30 Aug 202014 Oct 202430 Aug 2025
117waf.uk-5 Jun 20194 Jul 20245 Jun 2025
118waf.abbCSC Corporate Domains, Inc.27 May 20201 Jul 202427 May 2025
119waf.vipGo Montenegro Domains, LLC16 Jun 201728 Jul 202316 Jun 2023
120waf.softwareInternet Invest, Ltd. dba Imena.ua31 Jul 202013 Jul 202431 Jul 2025
121waf.picsNameKing.com Inc.2 Aug 202331 Aug 20232 Aug 2024
122waf.ai----
123waf.studioGoDaddy.com, LLC22 Aug 20236 Oct 202422 Aug 2025
124waf.internationalTucows Domains Inc.4 Sep 20239 Sep 20244 Sep 2025
125waf.socialInterNetworX Ltd. & Co. KG6 Sep 20237 Sep 20246 Sep 2025
126waf.venturesAtak Domain Hosting Internet d/b/a Atak Teknoloji23 Oct 20237 Dec 202423 Oct 2025
127waf.ind.inNamecroc.com LLC31 Dec 20211 Jan 202531 Dec 2024
128waf.beautyDynadot, LLC3 Jan 202424 Jan 20243 Jan 2025
129waf.emailMesh Digital Limited28 Feb 20244 Mar 202428 Feb 2025
130waf.co.nz-29 Aug 20233 Sep 2023-
131waf.best-28 Mar 20241 Aug 202428 Mar 2025
132waf.productions1&1 Internet AG27 Mar 20241 Apr 202427 Mar 2025
133waf.proDNSPod, Inc.29 Mar 202417 Jun 202429 Mar 2025
134waf.ae----
135waf.com.br-19 Mar 202028 Mar 202419 Mar 2025
136waf.im----
137waf.ru-3 Feb 2005-3 Feb 2026
138waf.se-6 Oct 201720 Sep 20246 Oct 2025
139waf.de--28 Oct 2009-
140waf.sk-31 Jan 202218 Jan 202431 Jan 2025
141waf.su-25 Oct 2022-25 Oct 2025
142waf.eu----
143waf.capitalGoDaddy.com, LLC15 May 202420 May 202415 May 2025
144waf.com.au--24 Apr 2024-
145waf.amsterdamRealtime Register B.V.6 Oct 202417 Oct 20246 Oct 2025
146waf.shNamesilo, LLC16 May 20208 Apr 202116 May 2030
147waf.org.cn????????????25 Mar 2022-25 Mar 2025
148waf.latDynadot, LLC15 Nov 202415 Nov 202415 Nov 2025
149waf.reportNameCheap, Inc.18 Nov 202418 Nov 202418 Nov 2025
150waf.net.cn-20 Sep 2020-20 Sep 2025
151waf.meDynadot, LLC3 May 201812 Sep 20243 May 2025
152waffen.netNameCheap, Inc.8 Dec 20008 Nov 20248 Dec 2025
153wafb.comBrandsight, Inc.24 Jan 199726 Jun 202425 Jan 2026
154waffentipp.de--12 Jul 2012-
155wafflehouse.comAmazon Registrar, Inc.9 Apr 19996 Mar 20249 Apr 2025
156waffarha.comeNom, Inc.22 Sep 201110 Apr 202222 Sep 2030
157wafl.netDynadot, LLC23 Apr 202210 May 202423 Apr 2025
158wafstudio.netGoDaddy.com, LLC28 May 201828 May 201828 May 2019
159waff.comBrandsight, Inc.15 May 199626 Jun 202416 May 2025
160waffenschrank24.de--22 Jul 2016-
161wafa.ae----
162waffa.coNameCheap, Inc.18 Jun 201718 Jun 201717 Jun 2018
163waffenostheimer.de--3 May 2023-
164waffleboy.com.cn-19 Jan 2002-19 Jan 2026
165wafflesoftware.netDROPCATCH.COM 750 LLC14 Jan 202422 Jan 202414 Jan 2025
166waffen-centrale.de--26 Sep 2014-
167waffle1999.comGMO Internet Inc.16 Sep 200419 Sep 202316 Sep 2032
168waffles.fmKey-Systems, LLC28 Oct 200712 Jan 201727 Oct 2017
169wafflesatnoon.comDNC Holdings, Inc.3 Mar 200818 Jan 20243 Mar 2025
170waffu.netGoogle, Inc.5 Feb 202326 Apr 20245 Feb 2025
171wafilmz.com1API GmbH27 Jun 202310 Sep 202427 Jun 2024
172wafukeylesslocks.comGoDaddy.com, LLC21 Oct 201422 Oct 202421 Oct 2025
173wafukeylesslock.comGoDaddy.com, LLC21 Oct 201422 Oct 202421 Oct 2025
174wafturetechnology.comGoDaddy.com, LLC21 Oct 201421 Oct 201421 Oct 2015
175wafmb.comWest263 International Limited9 Mar 20199 Mar 20199 Mar 2020
176waffmusic.comNameCheap, Inc.12 Jan 202311 Dec 202312 Jan 2025
177wafflesonly.comGoDaddy.com, LLC26 Nov 20217 Feb 202426 Nov 2023
178wafflewings.comTurnCommerce, Inc. DBA NameBright.com22 Oct 201416 Oct 202022 Oct 2025
179waffledomains.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
180waffledomain.comGoDaddy.com, LLC22 Oct 201422 Oct 201422 Oct 2015
181wafa.ps-24 Jan 200516 Feb 202025 Feb 2025
182wafaimages.ps-19 Mar 201030 Mar 202119 Mar 2024
183wafainfo.ps-4 Apr 201030 Mar 20214 Apr 2024
184wafc.orgNetwork Solutions, LLC20 Sep 199628 Jul 202419 Sep 2029
185wafelsanddinges.comGoDaddy.com, LLC13 Jul 200714 Jul 202413 Jul 2025
186waferlock.comTucows Domains Inc.25 Feb 200311 Mar 202325 Feb 2033
187waferlock.com.tw-26 Mar 2007-27 Mar 2025
188waferwire.comGoDaddy.com, LLC8 Mar 20107 Sep 20228 Mar 2025
189waferwire.in-14 Sep 201216 Sep 201614 Sep 2017
190waff.at--4 Apr 2011-
191waffar.comGoDaddy.com, LLC2 May 20001 May 20232 May 2025
192waffeleisen-ratgeber.de--28 Feb 2015-
193waffen-braun-shop.de--8 Dec 2010-
194waffen-ferkinghoff.de--8 May 2020-
195waffen-online.de--8 Jun 2017-
196waffen-schlottmann.de--23 Jul 2019-
197waffen-welt.de--11 Jan 2021-
198waffenboerse.ch----
199waffenfuzzi.de--12 Mar 2024-
200waffengebraucht.at--18 Jan 2021-
201waffenschrankshop.de--20 Apr 2020-
202waffenschumacher.com1API GmbH15 Nov 20012 Feb 202415 Nov 2025
203waffenzimmi.ch----
204waffiliation.comOnline SAS26 Aug 202325 Sep 202426 Aug 2024
205waffle.ioCSC Corporate Domains, Inc.19 Jun 20138 Oct 202419 Jun 2025
206waffleflower.comregister.com, Inc.23 Nov 201123 Oct 202223 Nov 2025
207wafflegirl.comMoniker Online Services LLC1 Jul 20116 Aug 20241 Jul 2025
208wafflemould.netGoogle, Inc.17 Dec 201316 Dec 202417 Dec 2025
209wafflemouldnigeria.comNamesilo, LLC13 Aug 201824 Nov 202413 Aug 2025
210wafi.comGoDaddy.com, LLC20 Jun 199614 May 202419 Jun 2025
211wafiqfx.comCircle of Domains LLC4 Mar 20165 Mar 20174 Mar 2018
212wafmedia2.comGoDaddy.com, LLC7 Apr 20207 Apr 20207 Apr 2021
213wafooded.comGoDaddy.com, LLC15 Nov 201415 Nov 201415 Nov 2015
214wafrafx.comTucows Domains Inc.16 Aug 20102 Aug 202416 Aug 2025
215waframedia.comGoDaddy.com, LLC12 Jan 201313 Jan 202312 Jan 2025
216waftr.comGoDaddy.com, LLC1 May 201320 Sep 20241 May 2025
217waftureworldwide.comGoDaddy.com, LLC28 Mar 201330 Mar 201528 Mar 2016
218waferbars.comGoDaddy.com, LLC5 Jun 20155 Jun 20155 Jun 2016
219wafmb.orgGoDaddy.com, LLC21 Oct 201422 Oct 201621 Oct 2017
220waffeleisen-test.euRegistryGate GmbH---
221wafflecell.comGMO Internet Inc.28 Dec 20112 Oct 202328 Dec 2028
222wafmedia3.comWeb Commerce Communications Limited dba WebNic.cc18 May 202128 Jul 202218 May 2022
223waframedia1.comHangzhou Best Domain Technology Co., LTD23 Feb 202226 Mar 202323 Feb 2023
224wafmedia5.comGoDaddy.com, LLC18 Jan 201517 Apr 201518 Jan 2016
225wafika.comGoDaddy.com, LLC21 Nov 202322 Nov 202421 Nov 2025
226waffensachkunde-deutschland.com1&1 Internet AG24 Oct 201424 Oct 201624 Oct 2018
227wafl.com.au--1 Jun 2024-
228waffen-ferkinghoff.comRegistryGate GmbH25 May 200026 May 202425 May 2025
229waffleplanet.netNETIM SARL12 Mar 202212 Mar 202212 Mar 2025
230wafx.netRegister.it SPA18 Aug 20067 Jul 202318 Aug 2025
231waffencenter-gotha.de--5 Jan 2016-
232wafzgvkfoaw.biz-24 Oct 2014-23 Oct 2015
233wafu-herb.comGMO Internet Inc.25 Oct 201411 Oct 201625 Oct 2021
234wafishfarmers.comDomeneshop AS dba domainnameshop.com24 Oct 201430 Dec 202424 Oct 2025
235wafdqc.comGMO Internet Inc.25 Feb 20228 May 202325 Feb 2023
236waficsaab.comGoDaddy.com, LLC9 Jan 201428 Dec 20239 Jan 2025
237waffen-teile.de--25 Aug 2022-
238wafilife.comCloudFlare, Inc.4 Dec 201425 Jun 20244 Dec 2025
239wafanli.cnDagnabit, Incorporated14 Nov 2014-14 Nov 2015
240waffenstube-kurus.at--23 Jan 2013-
241wafflemag.comTurnCommerce, Inc. DBA NameBright.com24 Apr 20155 Jun 202424 Apr 2025
242wafacash.comCSC Corporate Domains, Inc.13 Jan 200325 Oct 202413 Jan 2025
243wafflemakershq.comOldTownDomains.com LLC2 Sep 20165 Jan 20172 Sep 2017
244waferstar.comHiChina Zhicheng Technology Limited2 Jun 20054 Jun 20202 Jun 2025
245wafootball.com.au--1 Jun 2024-
246wafj.comGoDaddy.com, LLC20 Jan 200018 Sep 202220 Jan 2026
247waflow.netGoDaddy.com, LLC25 Oct 20244 Nov 202425 Oct 2025
248wafaghnaim.comWild West Domains, LLC24 May 201425 May 201524 May 2016
249waffleonwheels.comGoDaddy.com, LLC16 Apr 202228 Jun 202416 Apr 2024
250wafut.comGoDaddy.com, LLC25 Oct 201426 Oct 202425 Oct 2025
251wafisherinterative.comNameCheap, Inc.27 Oct 202427 Oct 202427 Oct 2025
252waffles.bizGoogle, Inc.7 May 201912 May 20197 May 2020
253waffalikewaffle.comMarcaria.com International, Inc.25 Oct 201425 Oct 201425 Oct 2015
254wafflerito.comGoDaddy.com, LLC8 Mar 20178 Mar 20178 Mar 2018
255wafflegato.comGoDaddy.com, LLC27 May 201427 May 201527 May 2016
256wafgidi.comGoDaddy.com, LLC26 May 201427 May 201526 May 2016
257wafers.infoNameCheap, Inc.25 May 201725 Sep 201725 May 2018
258wafflez.orgGoDaddy.com, LLC28 May 20149 Jun 201528 May 2016
259wafurs.netTucows Domains Inc.21 Oct 201125 Oct 201421 Oct 2015
260waffenrecht.info-25 Dec 202325 Dec 202425 Dec 2025
261wafiyzamree.comPDR Ltd. d/b/a PublicDomainRegistry.com13 Aug 202124 Sep 202313 Aug 2023
262waffleprinters.comeNom, Inc.26 Oct 201426 Oct 201426 Oct 2015
263wafafashion.comTucows Domains Inc.20 Apr 202420 Apr 202420 Apr 2025
264wafertrading.comGoDaddy.com, LLC17 Dec 201818 Dec 202417 Dec 2026
265wafflerealm.comGoDaddy.com, LLC3 Jun 20134 Jun 20153 Jun 2016
266waffleback.comDynadot, LLC9 Mar 20199 Mar 20199 Mar 2020
267wafabec.comGoDaddy.com, LLC23 May 201424 May 201523 May 2016
268wafran.comTucows Domains Inc.27 Oct 201420 Oct 202427 Oct 2025
269wafflebomb.comWix.com Ltd.8 Sep 20209 Aug 20248 Sep 2025
270wafapress.comTurnCommerce, Inc. DBA NameBright.com13 Jan 20167 Jan 202113 Jan 2026
271wafferapp.netGoDaddy.com, LLC5 Jun 20146 Jun 20155 Jun 2016
272waforeclosurehelp.mobiGoDaddy.com, LLC5 Jun 20135 Jun 20155 Jun 2016
273waffe24.comCronon AG6 May 202425 Jun 20246 May 2025
274waffenhandel.net1&1 Internet AG14 Aug 201914 Oct 201914 Aug 2025
275wafbwheels.comGoDaddy.com, LLC11 Apr 200522 Mar 202411 Apr 2025
276wafasultan.comGoDaddy.com, LLC10 Aug 200521 Jul 202410 Aug 2025
277wafarly.comGoDaddy.com, LLC13 Jul 20111 Jul 202413 Jul 2025
278waffclub.comGoDaddy.com, LLC3 Feb 201330 Apr 20153 Feb 2016
279wafang.comeName Technology Co., Ltd.15 Aug 200710 Aug 202415 Aug 2025
280wafb.coChengdu West Dimension Digital Technology Co., Ltd…20 Jul 201720 Jul 201719 Jul 2018
281wafederal.comKey-Systems GmbH8 Apr 201313 May 20248 Apr 2025
282waffleprint.neteNom, Inc.26 Oct 20146 Nov 201626 Oct 2017
283wafapak.orgGoDaddy.com, LLC26 Oct 201426 Oct 201426 Oct 2015
284wafootball.comTurnCommerce, Inc. DBA NameBright.com28 Oct 201422 Oct 202028 Oct 2025
285waffle-iron.comBeijing Lanhai Jiye Technology Co., Ltd4 Jan 20237 Nov 20244 Jan 2025
286wafainternationalsdnbhd.comPDR Ltd. d/b/a PublicDomainRegistry.com28 Oct 201428 Oct 201428 Oct 2015
287wafahourani7.comWild West Domains, LLC28 Oct 201428 Oct 201428 Oct 2015
288wafaacreations.com-29 Oct 201429 Oct 201429 Oct 2017
289waffenfabrik.comOne.com A/S25 Dec 201025 Nov 202425 Dec 2025
290wafflebarn.comeNom, Inc.20 Mar 20117 Mar 202420 Mar 2025
291wafia.comGoDaddy.com, LLC24 Dec 202130 Aug 202424 Dec 2025
292wafrican.comeNom, Inc.8 Apr 20095 Apr 20248 Apr 2025
293wafita.comeNom, Inc.18 Apr 201211 May 201718 Apr 2018
294wafercards.comGoDaddy.com, LLC7 Apr 202419 Nov 20247 Apr 2025
295wafermanufacturers.comeNom, Inc.12 Jun 201213 Jun 202412 Jun 2025
296wafae.comeNom, Inc.19 Sep 200521 Sep 202419 Sep 2025
297wafid.comGoDaddy.com, LLC5 Jul 20126 Jul 20245 Jul 2025
298waffe.info1&1 Internet AG8 Aug 202018 Aug 20238 Aug 2024
299wafered.comDropCatch.com 365 LLC16 May 202417 May 202416 May 2025
300wafflebrothers.usGoDaddy.com, LLC27 Oct 201427 Oct 201426 Oct 2015
301waffly.comGoDaddy.com, LLC24 Mar 200621 Aug 202324 Mar 2028
302wafiq.comGoDaddy.com, LLC25 Dec 20072 Oct 202225 Dec 2025
303wafer.ca----
304wafpanels.comTurnCommerce, Inc. DBA NameBright.com8 Mar 20199 Apr 20197 Mar 2020
305wafflesome.comGoDaddy.com, LLC29 Oct 201425 Oct 202429 Oct 2026
306wafflehouseexperience.comGoDaddy.com, LLC30 Oct 201430 Oct 201430 Oct 2015
307waffenlager.comTurnCommerce, Inc. DBA NameBright.com29 Oct 201411 Dec 202429 Oct 2024
308wafencemakers.comGoDaddy.com, LLC29 Oct 201430 Oct 201429 Oct 2016
309wafamvi.comTucows Domains Inc.26 Oct 201330 Oct 201426 Oct 2015
310waface.comHiChina Zhicheng Technology Limited25 Oct 201218 Oct 202425 Oct 2025
311wafaaherbs.comTucows Domains Inc.26 Oct 200930 Oct 201426 Oct 2015
312wafaaalhusaini.comNetwork Solutions, LLC30 Oct 201430 Sep 202430 Oct 2026
313waf1234.comGabia, Inc.24 Oct 201330 Oct 201424 Oct 2015
314wafflemakers.info1&1 Internet AG29 Sep 201529 Sep 201629 Sep 2017
315wafsecurity.orgPapaki Ltd.23 Nov 201423 Jan 201523 Nov 2015
316waffleconnection.comGoDaddy.com, LLC20 May 201315 May 202420 May 2025
317wafflesorpancakes.comGoDaddy.com, LLC31 May 202431 May 202431 May 2025
318wafon.comPSI-USA, Inc. dba Domain Robot28 Nov 200822 Nov 202428 Nov 2025
319wafal.comPSI-USA, Inc. dba Domain Robot13 Dec 20088 Dec 202413 Dec 2025
320wafis.comPSI-USA, Inc. dba Domain Robot27 May 200916 Jul 202427 May 2025
321wafie.comPSI-USA, Inc. dba Domain Robot4 Jun 200924 Jul 20244 Jun 2025
322waffleology.comGoDaddy.com, LLC19 Nov 201220 Nov 202419 Nov 2025
323waffizza.comWild West Domains, LLC18 Feb 201518 Feb 202418 Feb 2025
324wafah.comPSI-USA, Inc. dba Domain Robot18 Aug 20097 Oct 202418 Aug 2025
325wafts.comPSI-USA, Inc. dba Domain Robot17 Jun 20106 Aug 202417 Jun 2025
326wafee.comPSI-USA, Inc. dba Domain Robot10 May 201029 Jun 202410 May 2025
327wafiz.comPSI-USA, Inc. dba Domain Robot10 Apr 201030 May 202410 Apr 2025
328wafricarelief.comFastDomain Inc.30 Oct 201430 Oct 201430 Oct 2015
329wafitexbd.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Oct 201430 Oct 201430 Oct 2015
330wafidinstitute.comGoDaddy.com, LLC30 Oct 201413 Aug 202330 Oct 2025
331wafidcenter.comGoDaddy.com, LLC30 Oct 201413 Aug 202330 Oct 2025
332waffleswithlulu.comWild West Domains, LLC6 Feb 20166 Feb 20166 Feb 2017
333wafatour.comOnlineNIC, Inc.2 Mar 20172 Mar 20172 Mar 2018
334wafeze.infoGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2015
335waffles.coEdomains LLC26 Jun 202427 Nov 202426 Jun 2025
336wafermachine.comTurnCommerce, Inc. DBA NameBright.com16 Aug 202010 Aug 202116 Aug 2025
337wafflebarnonline.comGoDaddy.com, LLC9 Jun 200720 May 20249 Jun 2025
338wafsco.comTucows Domains Inc.31 Oct 20144 Nov 201531 Oct 2016
339waffleoflife.comDomain.com, LLC31 Oct 201431 Oct 201431 Oct 2015
340wafencemasters.comGoDaddy.com, LLC31 Oct 201431 Oct 201431 Oct 2016
341wafaaonline.comGoDaddy.com, LLC1 Nov 20141 Nov 20161 Nov 2017
342waffle-house.comGoDaddy.com, LLC14 May 201015 May 202414 May 2025
343wafflethins.comGoDaddy.com, LLC2 Jun 20153 Jun 20152 Jun 2016
344wafflebark.comGoDaddy.com, LLC3 Jun 20154 Jun 20153 Jun 2016
345waferpro.comTucows Domains Inc.17 Jun 201613 Jun 202417 Jun 2025
346wafiyat.comGoDaddy.com, LLC31 Dec 20055 Nov 202431 Dec 2026
347wafflerecipe.comGoDaddy.com, LLC24 Jan 200218 Oct 202324 Jan 2026
348wafersupply.comGoDaddy.com, LLC28 Apr 199929 Apr 201528 Apr 2016
349wafflestomp.comGoDaddy.com, LLC13 Apr 200814 Apr 202413 Apr 2025
350wafdam.comPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 201022 Dec 202422 Dec 2024
351wafuvinumaq.comTLD Registrar Solutions Ltd.9 Nov 20149 Nov 20149 Nov 2015
352waftick.comDynadot6 LLC8 Sep 202218 Nov 20238 Sep 2023
353waftrix.comTucows Domains Inc.31 Jul 202031 Jul 202031 Jul 2021
354wafrick.comMedia Elite Holdings Limited1 Nov 20221 Nov 20221 Nov 2023
355waff48news.comGoDaddy.com, LLC4 Mar 200314 Apr 20244 Mar 2024
356wafking.comeNom659, Inc.21 May 201722 May 201721 May 2018
357waftik.comHangzhou Dianshang Internet Technology Co., Ltd25 Nov 202025 Nov 202025 Nov 2021
358waferscale.comNameCheap, Inc.8 Nov 200111 Oct 20248 Nov 2025
359wafflehousemenu.comSnappyregistrar.com LLC28 Apr 202424 Oct 202428 Apr 2025
360wafc.netAnnulet LLC26 Jan 201514 Mar 202426 Jan 2025
361wafers.bizGoDaddy.com, LLC19 Jan 200427 Jun 201518 Jan 2016
362wafbmuseum.orgeNom, Inc.10 Jul 20088 Nov 202410 Jul 2025
363waffra.comDropCatch.com 1483 LLC15 Jan 201927 Mar 202415 Jan 2025
364wafflestheunicorgi.comGoDaddy.com, LLC2 Nov 20142 Nov 20142 Nov 2015
365waf007.comGoDaddy.com, LLC1 Nov 20141 Nov 20141 Nov 2015
366wafkid.comTucows Domains Inc.31 Oct 201931 Oct 201931 Oct 2020
367wafever.comeNom1010, Inc.13 Nov 201614 Nov 201613 Nov 2017
368wafu-living.comMvpdomainnames.com LLC29 Sep 20191 Oct 201929 Sep 2020
369waflehouse.comPDR Ltd. d/b/a PublicDomainRegistry.com27 Feb 200530 Aug 202427 Feb 2026
370wafj.orgPDR Ltd. d/b/a PublicDomainRegistry.com10 Jan 200021 Feb 202410 Jan 2025
371waffle.tvDynadot, LLC5 May 20072 Jun 20175 May 2018
372wafrost.comGoDaddy.com, LLC22 Jun 199830 Oct 202221 Jun 2026
373wafflekitchen.comGoDaddy.com, LLC26 Apr 20145 Apr 202426 Apr 2025
374wafflems.netTucows Domains Inc.18 Aug 201929 Oct 202218 Aug 2022
375waferking.comDiaMatrix C.C.11 Apr 201911 Apr 201911 Apr 2029
376waffletruck.comGoDaddy.com, LLC28 Jun 201827 Aug 202428 Jun 2026
377waffleplace.comGoDaddy.com, LLC29 Jan 200729 Jan 202429 Jan 2025
378wafergard.comGoDaddy.com, LLC10 May 201710 May 201710 May 2018
379waffra.netTucows Domains Inc.29 Oct 20102 Nov 201829 Oct 2018
380wafiqa.com-22 Jun 202318 Jun 202422 Jun 2025
381wafaahmad.comeNom, Inc.2 Nov 20142 Nov 20142 Nov 2015
382wafusa.orgGoDaddy.com, LLC18 Aug 20052 Oct 202418 Aug 2025
383wafarmersmarkets.comFastDomain Inc.9 Mar 199923 Feb 20249 Mar 2025
384wafercookies.comDynadot, LLC14 Sep 200527 Aug 202414 Sep 2025
385wafuqi.comGoDaddy.com, LLC8 Jun 20129 Jun 20158 Jun 2016
386wafbhomes.comGoDaddy.com, LLC19 Jun 200720 Jun 202419 Jun 2025
387wafflechicks.comTurnCommerce, Inc. DBA NameBright.com20 Jun 201612 Nov 20243 Oct 2024
388wafflehouserewards.comGoDaddy.com, LLC27 May 201428 May 202427 May 2025
389wafricarelief.orgFastDomain Inc.1 Nov 201414 Jan 20161 Nov 2017
390wafop18.comBrandon Gray Internet Services, Inc. (dba NameJuic…21 Nov 20037 Dec 202121 Nov 2026
391waffleandchicken.comGoDaddy.com, LLC8 Jun 20199 Jun 20248 Jun 2025
392wafflehaus.meGoDaddy.com, LLC10 Jun 201410 Jun 201510 Jun 2016
393wafflee.comTurnCommerce, Inc. DBA NameBright.com19 Jun 201713 Jun 202019 Jun 2025
394waffentechnik-solingen.de--14 Dec 2016-
395wafsbo.comGoogle, Inc.26 Feb 202228 Apr 202326 Feb 2023
396waffletea.comNameCheap, Inc.23 May 202223 Apr 202423 May 2025
397wafflesyrup.comDNC Holdings, Inc.2 Nov 20151 Oct 20242 Nov 2025
398wafflesapparel.comName.com, Inc.4 Nov 20144 Nov 20144 Nov 2015
399wafflerin.comTucows Domains Inc.3 Nov 20143 Nov 20143 Nov 2015
400waffenobermeier.comMesh Digital Limited30 Jul 200729 Jul 202430 Jul 2025
401wafabar.comBigRock Solutions Ltd.3 Nov 20143 Nov 20143 Nov 2015
402wafelha.usGoDaddy.com, LLC12 Jun 201412 Jun 201411 Jun 2015
403wafflepatterns.comGoDaddy.com, LLC4 Jan 201517 Sep 20224 Jan 2025
404wafamilydentistry.comGoDaddy.com, LLC26 Jul 200322 Dec 202426 Jul 2025
405wafedbank.comGoDaddy.com, LLC15 Jan 200921 Jan 202320 Jan 2025
406wafish.comGoDaddy.com, LLC25 Nov 20089 Nov 202425 Nov 2025
407waffra.orgTucows Domains Inc.29 Oct 201031 Oct 201729 Oct 2018
408wafflesandcream.usGoDaddy.com, LLC2 Nov 20147 Nov 20171 Nov 2018
409wafflemaker-deal.comeNom, Inc.13 Sep 201413 Sep 201413 Sep 2015
410wafnjlaw.comFastDomain Inc.28 Apr 20245 Jun 202428 Apr 2025
411wafugee-realty.comMarcaria.com International, Inc.4 Nov 20144 Nov 20144 Nov 2015
412wafengyu.comBeijing Lanhai Jiye Technology Co., Ltd21 Aug 201922 Aug 202421 Aug 2025
413wafemaleveterans.comregister.com, Inc.4 Nov 20144 Nov 20144 Nov 2015
414wafmca.comFastDomain Inc.5 Dec 200213 Oct 20245 Dec 2025
415wafair.comHangzhou AiMing Network Co., LTD27 Oct 201019 Apr 202427 Oct 2025
416wafow.eueNom, Inc.---
417wafband.orgTucows Domains Inc.3 Dec 19986 Dec 20242 Dec 2025
418waffen-ss.no-1 Oct 20101 Oct 2010-
419wafflescafechicago.comDropCatch.com 1088 LLC13 Jun 202216 Dec 202413 Jun 2025
420wafflichworld.comeNom, Inc.10 Dec 20189 Dec 201810 Dec 2019
421wafwd.comGMO Internet Inc.3 Aug 202029 Sep 20203 Aug 2025
422wafflezen.comGoDaddy.com, LLC5 Nov 201417 Nov 20245 Nov 2025
423wafers-sh.comXin Net Technology Corporation6 Nov 201424 May 20226 Nov 2026
424waffelicious.comTurnCommerce, Inc. DBA NameBright.com2 Feb 202027 Jan 20212 Feb 2026
425waffledesign.comAnnulet LLC17 Aug 20144 Oct 202417 Aug 2025
426wafa127.comGoDaddy.com, LLC13 Jun 201414 Jun 201513 Jun 2016
427wafm-spoknae.comGoDaddy.com, LLC14 Jun 201415 Jun 201514 Jun 2016
428wafy.orgGoDaddy.com, LLC29 Sep 202215 Nov 202429 Sep 2025
429wafasbrowart.netGoDaddy.com, LLC17 Jun 201418 Jun 201517 Jun 2016
430wafflesandwifi.comGoogle, Inc.31 Aug 202331 Oct 202431 Aug 2024
431wafa-blog.comGoDaddy.com, LLC17 Jun 201118 Jun 201517 Jun 2016
432wafastpitch.comGoDaddy.com, LLC29 Jul 202010 Oct 202329 Jul 2023
433waffles4u.comregister.com, Inc.10 Nov 202311 Oct 202410 Nov 2025
434wafikmoustafa.com1&1 Internet AG14 Mar 202314 Mar 202314 Mar 2025
435wafok.comPSI-USA, Inc. dba Domain Robot24 Jul 200212 Sep 202424 Jul 2025
436waftu.comGoDaddy.com, LLC5 Oct 20215 Oct 20215 Oct 2022
437wafpakistan.orgWild West Domains, LLC19 Jun 20141 Jul 201519 Jun 2016
438wafitm.mobiGMO Internet Inc.5 Nov 20145 Nov 20145 Nov 2015
439wafa-int.netPDR Ltd. d/b/a PublicDomainRegistry.com19 Aug 201419 Aug 201419 Aug 2015
440wafacultysenate.orgNetwork Solutions, LLC31 Jul 202312 Sep 202431 Jul 2024
441wafer-tech.comWild West Domains, LLC31 Mar 202331 Mar 202331 Mar 2025
442waffen-haus.comTucows Domains Inc.16 Aug 201220 Aug 201416 Aug 2015
443waffenhouse.comGoDaddy.com, LLC12 Dec 202412 Dec 202412 Dec 2025
444waffenlaw.comGoDaddy.com, LLC19 Aug 201412 Aug 202419 Aug 2028
445wafajet-casablanca.comeNom, Inc.24 Jun 201526 May 201724 Jun 2018
446wafangwang.comHiChina Zhicheng Technology Limited24 Jun 201524 Jun 201524 Jun 2016
447wafaoil.comDynadot, LLC24 Jun 201524 Jun 201524 Jun 2017
448wafflepussy.comGoDaddy.com, LLC14 Feb 202228 Apr 202314 Feb 2023
449wafflingjack.comHosting Concepts B.V. dba Openprovider24 Jun 20152 Aug 201524 Jun 2016
450wafu-photo.comGMO Internet Inc.7 Nov 201427 Nov 20176 Nov 2018
451waftura.comCSC Corporate Domains, Inc.6 Nov 20144 Dec 20166 Nov 2018
452wafterik.comDynadot, LLC24 Jul 201924 Jul 201924 Jul 2020
453waffle-mix.comGoDaddy.com, LLC6 Nov 20146 Nov 20146 Nov 2017
454wafausa.comTurnCommerce, Inc. DBA NameBright.com20 Jan 201514 Jan 202120 Jan 2025
455wafarha.comName.com, Inc.26 Aug 202426 Aug 202426 Aug 2025
456waffen-house.comTucows Domains Inc.16 Aug 201220 Aug 201416 Aug 2015
457wafflensandwich.comGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
458wafflesmiles.comHosting Concepts B.V. dba Openprovider8 Nov 20219 Nov 20218 Nov 2022
459wafflesmiles.infoGoDaddy.com, LLC12 Apr 201825 Apr 202312 Apr 2024
460wafflesmiles.netGandi SAS17 Apr 201817 Apr 201817 Apr 2019
461wafflesmiles.orgGoDaddy.com, LLC20 Aug 201420 Aug 201420 Aug 2015
462wafrika.comPorkbun, LLC14 Jan 202414 Jan 202414 Jan 2025
463waferjel.comTucows Domains Inc.12 Jan 201516 Jan 201612 Jan 2017
464waffenwerke.comGoDaddy.com, LLC12 Jan 201512 Jan 201512 Jan 2016
465wafsra.orgGoDaddy.com, LLC9 Mar 201613 Mar 20179 Mar 2018
466waf-ajk.orgNamesilo, LLC5 Nov 20148 Dec 20175 Nov 2018
467wafbunkers.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2017
468wafflesandsyrup.comMetaregistrar BV Applications2 Oct 20242 Oct 20242 Oct 2025
469wafiadditives.comGoDaddy.com, LLC6 Feb 20156 Feb 20156 Feb 2016
470wafoindustry.comeNom, Inc.6 Feb 201514 Mar 20176 Feb 2018
471wafflelending.comeNom, Inc.21 Aug 201421 Jul 201521 Aug 2017
472waffleloans.comeNom, Inc.21 Aug 201421 Jul 201521 Aug 2017
473wafuasianbistro.neteNom, Inc.21 Aug 20147 Aug 201621 Aug 2017
474wafvbx.comNetwork Solutions, LLC21 Aug 201421 Aug 201421 Aug 2015
475wafausa.netTucows Domains Inc.3 Nov 20087 Nov 20143 Nov 2015
476wafgroup.comeNom, Inc.9 Apr 201711 Mar 20249 Apr 2025
477wafflesonwaffles.comWild West Domains, LLC25 Sep 202325 Sep 202325 Sep 2026
478waffleras.comDattatec.com SRL8 Nov 20143 Dec 20248 Nov 2025
479wafflecraftlp.comeNom, Inc.7 Nov 20147 Nov 20147 Nov 2015
480wafflecorporation.comGoDaddy.com, LLC7 Nov 20147 Nov 20147 Nov 2015
481wafflebrown.comDreamHost, LLC7 Nov 201411 Nov 20197 Nov 2020
482waffen-naegele.comCronon AG7 Nov 20148 Nov 20247 Nov 2025
483wafaico.comregister.com, Inc.7 Nov 20147 Nov 20147 Nov 2015
484wafangdianzx.comChengdu West Dimension Digital Technology Co., Ltd…1 Mar 20151 Mar 20151 Mar 2026
485waffleshot.comGoDaddy.com, LLC17 May 20161 Nov 202217 May 2027
486waffletoddler.comTucows Domains Inc.25 Feb 20141 Mar 201525 Feb 2016
487wafor.netNominalia Internet S.L.25 May 202426 May 202425 May 2025
488wafflehouseegypt.comTucows Domains Inc.19 Aug 200922 Aug 201419 Aug 2015
489waffleport.comGoDaddy.com, LLC22 Feb 201722 Feb 201722 Feb 2022
490wafflero.comGoDaddy.com, LLC23 Nov 201615 Nov 202423 Nov 2025
491waffleshirts.comGoDaddy.com, LLC23 Aug 201423 Aug 201623 Aug 2018
492waffletshirt.comGoDaddy.com, LLC23 Aug 201423 Aug 201623 Aug 2018
493waffletshirts.comGoDaddy.com, LLC23 Aug 201423 Aug 201623 Aug 2018
494wafsolution.comOpen System Ltda - Me22 Aug 201422 Aug 201422 Aug 2015
495wafashop.comNameCheap, Inc.26 Dec 202426 Dec 202426 Dec 2025
496wafflechoco.comIHS Telekom, Inc.14 Apr 20152 May 201714 Apr 2018
497wafflechocosos.comIHS Telekom, Inc.14 Apr 201514 Apr 201514 Apr 2016
498wafflecrepe.comOVH sas3 Oct 20234 Oct 20243 Oct 2025
499wafwip.comAscio Technologies, Inc. Danmark - Filial af Ascio…14 Apr 201514 Apr 201514 Apr 2016
500wafaoil.netDynadot, LLC24 Jun 201524 Jun 201524 Jun 2017
501wafahost.comNameCheap, Inc.6 Jul 20247 Jul 20246 Jul 2025
502wafflesup.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2026
503waffleqwest.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2025
504waffle-qwest.comGoDaddy.com, LLC8 Nov 20149 Nov 20248 Nov 2025
505wafay.comNameCheap, Inc.12 Feb 201915 Feb 202412 Feb 2025
506wafchesjp.comGMO Internet Inc.20 Jan 201820 Jan 201820 Jan 2019
507wafflesdesign.comHostinger, UAB26 Nov 202328 Nov 202426 Nov 2025
508wafasblog.netGoDaddy.com, LLC12 Aug 201412 Aug 201412 Aug 2015
509wafdier.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Aug 201413 Aug 201412 Aug 2015
510wafifurniture.comHetzner Online AG15 Nov 202214 Nov 202415 Nov 2025
511wafzz.comXin Net Technology Corporation12 Aug 201412 Aug 201412 Aug 2015
512waflag.comGoDaddy.com, LLC20 May 202021 May 202420 May 2026
513waffleweiner.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
514waffle-weiner.comGoDaddy.com, LLC9 Nov 20149 Nov 20149 Nov 2015
515waffenschule.com1&1 Internet AG9 Nov 201410 Nov 20219 Nov 2025
516waffenschule-mv.com1&1 Internet AG9 Nov 201410 Nov 20169 Nov 2018
517waffenschule-berlin.com1&1 Internet AG9 Nov 201410 Nov 20219 Nov 2025
518waffle-engine.comFastDomain Inc.2 Jul 202017 Jun 20242 Jul 2025
519wafflesandwhiskey.comSquarespace Domains LLC22 May 202422 May 202422 May 2025
520wafflesncream.netNobel Networks13 Aug 201413 Aug 201413 Aug 2015
521wafrc8787.comGoDaddy.com, LLC14 Aug 201414 Aug 201414 Aug 2015
522waf2014.comWeb Commerce Communications Limited dba WebNic.cc22 Apr 20231 Jun 202422 Apr 2024
523wafamilymedicinejobs.comGoDaddy.com, LLC26 Aug 20147 Oct 202426 Aug 2024
524wafchesjp.bizDynadot, LLC12 Jan 202419 Aug 202412 Jan 2025
525waffelinolawrence.comBrandsight, Inc.25 Aug 201426 Jul 202425 Aug 2025
526waffledeli.comDomain.com, LLC26 Aug 201426 Aug 201426 Aug 2015
527waffledelicious.comDomain.com, LLC26 Aug 201426 Aug 201426 Aug 2015
528wafflehouselex.comNetwork Solutions, LLC26 Aug 201425 Mar 201526 Aug 2017
529waffleyachtproductions.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2016
530wafraid.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
531wafrico.comBeijing Lanhai Jiye Technology Co., Ltd3 Feb 202312 Dec 20243 Feb 2025
532wafsta.comGoDaddy.com, LLC26 Aug 201426 Aug 201426 Aug 2015
533wafuchuanmei.comGuangDong NaiSiNiKe Information Technology Co Ltd.25 Aug 201425 Aug 201425 Aug 2015
534wafufu.comFastDomain Inc.7 Jan 202128 Dec 20237 Jan 2025
535wafukuoteire.comGMO Internet Inc.26 Aug 201411 Aug 202326 Aug 2026
536wafulaadvocates.comOnlineNIC, Inc.27 Aug 201427 Aug 201427 Aug 2015
537waffleqwest.orgregister.com, Inc.8 Nov 20148 Nov 20148 Nov 2015
538waffleqwest.netregister.com, Inc.8 Nov 20148 Nov 20148 Nov 2015
539waf2014.orgNetowl, Inc.8 Nov 20149 Nov 20148 Nov 2015
540waffenschule.net1&1 Internet AG9 Nov 201410 Nov 20219 Nov 2025
541waffenschule.info1&1 Internet AG9 Nov 20149 Nov 20249 Nov 2025
542waffenschule-mv.net1&1 Internet AG9 Nov 201415 Dec 20179 Nov 2018
543waffenschule-mv.info1&1 Internet AG9 Nov 20149 Nov 20179 Nov 2018
544waffenschule-berlin.net1&1 Internet AG9 Nov 201410 Nov 20249 Nov 2025
545waffenschule-berlin.info1&1 Internet AG9 Nov 20149 Nov 20249 Nov 2025
546wafa-creation.com1&1 Internet AG5 Nov 201615 Nov 20245 Nov 2025
547wafaesindh.com1API GmbH18 Jun 20191 Aug 202318 Jun 2023
548waferprocessing.neteNom, Inc.14 Aug 201414 Aug 201414 Aug 2015
549waffaa.comPDR Ltd. d/b/a PublicDomainRegistry.com14 Aug 201413 Aug 202414 Aug 2025
550waffleseverything.comGoDaddy.com, LLC14 Aug 201415 Aug 201614 Aug 2018
551waffletina.comPorkbun, LLC11 Jun 202011 Jun 202011 Jun 2021
552wafflezfactory.com1&1 Internet AG10 Nov 201410 Nov 201410 Nov 2015
553wafflezfactory.biz1&1 Internet AG10 Nov 2014-9 Nov 2015
554wafflez.biz1&1 Internet AG10 Nov 2014-9 Nov 2015
555wafaefennich.comNetwork Solutions, LLC10 Nov 201410 Nov 201410 Nov 2015
556wafamag.comGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
557wafeqz.comNetwork Solutions, LLC27 Aug 201427 Aug 201427 Aug 2015
558wafflesdeluxe.comGoDaddy.com, LLC27 Aug 201411 Jun 202427 Aug 2027
559wafamag.netGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
560waf-asbl.netTucows Domains Inc.12 Aug 201015 Aug 201412 Aug 2015
561wafang0411.comDropCatch.com 898 LLC8 May 202218 Jun 20238 May 2023
562wafasaudi.comGoDaddy.com, LLC15 Aug 201427 Oct 202315 Aug 2023
563wafasaudi.infoGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
564wafasaudi.mobiGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
565wafasaudi.netGoDaddy.com, LLC15 Aug 201415 Aug 201415 Aug 2015
566wafdceo.comGoDaddy.com, LLC15 Aug 201416 Aug 202415 Aug 2029
567wafdceoforum.comGoDaddy.com, LLC15 Aug 201416 Aug 202415 Aug 2029
568wafflellama.comGoogle, Inc.15 Aug 201415 Aug 201415 Aug 2015
569wafflepanda.comCloudFlare, Inc.15 Aug 201416 Jul 202415 Aug 2025
570wafowa.orgKey-Systems GmbH9 Aug 20129 Jul 20249 Aug 2026
571wafree.comTurnCommerce, Inc. DBA NameBright.com20 Oct 201514 Oct 202020 Oct 2025
572waftio.comWild West Domains, LLC15 Aug 20141 Aug 202415 Aug 2025
573wafaire.comGransy s.r.o. d/b/a subreg.cz1 Nov 201524 Oct 20241 Nov 2025
574wafcdn.comGoDaddy.com, LLC17 Aug 201421 Oct 202417 Aug 2026
575wafdr.comChengdu West Dimension Digital Technology Co., Ltd…2 May 20182 May 20182 May 2019
576waffries.comNetwork Solutions, LLC16 Aug 201417 Jul 202416 Aug 2025
577waffries.netName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
578waffries.orgName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
579waffry.comGoDaddy.com, LLC12 Apr 202012 Apr 202012 Apr 2021
580waffry.netName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
581waffry.orgName.com, Inc.16 Aug 201416 Aug 201416 Aug 2015
582waflag.orgeNom, Inc.9 Nov 20149 Nov 20149 Nov 2015
583wafistonebridge.comPDR Ltd. d/b/a PublicDomainRegistry.com19 Jan 20173 Jan 201819 Jan 2018
584wafflesandwine.comTucows Domains Inc.30 Apr 201815 Apr 202430 Apr 2025
585wafernutscom.com----
586wafernuts.comGoDaddy.com, LLC12 Nov 201412 Nov 201412 Nov 2015
587wafjipjncuud.bizGMO Internet Inc.13 Nov 201413 Nov 201412 Nov 2015
588wafflecrisps.comGoDaddy.com, LLC7 Jun 20228 Mar 20247 Jun 2025
589wafamag.infoGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
590wafamag.mobiGoDaddy.com, LLC27 Aug 201427 Aug 201427 Aug 2015
591wafflebottom.comGoDaddy.com, LLC23 Nov 201717 Nov 202423 Nov 2025
592wafflekhan.netKoreacenter.com co., Ltd.28 Aug 201428 Aug 201428 Aug 2015
593wafflesandwings.comGoDaddy.com, LLC6 Feb 20217 Feb 20246 Feb 2025
594wafflesnwings.comGoDaddy.com, LLC6 Feb 20217 Feb 20246 Feb 2025
595waferoptik.comGMO Internet Inc.26 Nov 201526 Nov 201526 Nov 2016
596waffenschrank-a.comPSI-USA, Inc. dba Domain Robot15 Apr 201011 Sep 201415 Apr 2015
597waffenschrank-b.comPSI-USA, Inc. dba Domain Robot15 Apr 201011 Sep 201415 Apr 2015
598waffledrop.comGoDaddy.com, LLC12 Feb 201713 Feb 202312 Feb 2025
599waferlabs.comGoDaddy.com, LLC29 Aug 201422 Aug 202429 Aug 2025
600waffenbesitzer.netDropCatch.com 593 LLC6 Jan 20212 Mar 20216 Jan 2028
601wafflemedia.netCloudFlare, Inc.29 Dec 202229 Nov 202429 Dec 2025
602wafflewebdir.infoGMO Internet Inc.3 Mar 20202 May 20203 Mar 2021
603wafitech.comTurnCommerce, Inc. DBA NameBright.com29 Aug 201415 Jan 202029 Aug 2025
604waffletherapy.comDomainAdministration.com, LLC30 Nov 201715 Jan 202430 Nov 2024
605wafairchancecoalition.orgGoDaddy.com, LLC12 Sep 20148 Oct 201712 Sep 2018
606wafideal.comGMO Internet Inc.22 Feb 202422 Feb 202422 Feb 2025
607waffleclass.comDomainLocal LLC14 Nov 201415 Nov 201614 Nov 2017
608waffenschmiede.comNamesilo, LLC18 Apr 202031 Mar 202418 Apr 2025
609wafak.comTurnCommerce, Inc. DBA NameBright.com14 Nov 20148 Nov 202014 Nov 2025
610waf-u.comGMO Internet Inc.30 Aug 201430 Aug 201430 Aug 2015
611waferpriceindex.comTucows Domains Inc.27 Aug 200830 Aug 201427 Aug 2015
612waferpriceindex.netTucows Domains Inc.27 Aug 200830 Aug 201427 Aug 2015
613wafflblr.comNamesilo, LLC29 Jan 201930 Jan 201929 Jan 2020
614wafakm.comeNom, Inc.13 Sep 20146 Sep 202413 Sep 2025
615waferdigital.com-15 Mar 202418 Dec 202415 Mar 2026
616waffle-licious.comNameCheap, Inc.11 Apr 202412 Apr 202411 Apr 2025
617wafaz.netMarcaria.com International, Inc.13 Sep 201413 Sep 201413 Sep 2015
618wafchildrenscentre.orgeNom, Inc.31 Aug 201431 Aug 201431 Aug 2015
619wafcld.comNetwork Solutions, LLC31 Aug 20141 Sep 201431 Aug 2015
620waffandme.comWild West Domains, LLC31 Aug 201429 Aug 201631 Aug 2017
621waffleandsteak-kw.comNameCheap, Inc.18 May 202330 Jul 202418 May 2024
622wafflecoffee.comGoDaddy.com, LLC31 Aug 20141 Sep 202431 Aug 2026
623wafflescoops.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
624waffoooseverything.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
625waffoooseverything.netGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
626waffoooseverything.orgGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2015
627wafooos.comGoDaddy.com, LLC31 Aug 201431 Aug 201431 Aug 2016
628wafymot.comGoDaddy.com, LLC16 Sep 201417 Sep 201416 Sep 2015
629waferlife.comHiChina Zhicheng Technology Limited1 Sep 201415 May 20241 Sep 2025
630waftblade.bizGMO Internet Inc.1 Sep 2014-31 Aug 2015
631waftsynod.infoGMO Internet Inc.2 Sep 2014-2 Sep 2015
632wafeng.comeName Technology Co., Ltd.11 Sep 201414 Aug 202411 Sep 2025
633wafflecafe.comTurnCommerce, Inc. DBA NameBright.com16 Sep 201413 Nov 202416 Sep 2025
634wafipd.comNetwork Solutions, LLC16 Sep 201416 Sep 201416 Sep 2015
635wafondation.comTucows Domains Inc.16 Sep 201420 Sep 201516 Sep 2016
636wafunny.comHiChina Zhicheng Technology Limited17 Sep 201713 Aug 202417 Sep 2025
637waffelrezept.netHiChina Zhicheng Technology Limited18 May 201918 May 201918 May 2020
638wafer-ic.comXin Net Technology Corporation2 Sep 201430 Jul 20242 Sep 2025
639waffenkammer.comDynadot, LLC18 Dec 202319 Dec 202418 Dec 2025
640waffledots.comWild West Domains, LLC2 Sep 20142 Aug 20242 Sep 2025
641wafflesmx.comNetwork Information Center Mexico, S.C.1 Jul 20143 Jul 20151 Jul 2016
642wafky.comGoDaddy.com, LLC1 Dec 20151 Dec 20151 Dec 2016
643waferia.comGransy s.r.o. d/b/a subreg.cz15 Nov 201428 Nov 202415 Nov 2025
644wafamilyhistory.comPDR Ltd. d/b/a PublicDomainRegistry.com11 Mar 202011 Mar 202011 Mar 2021
645wafaa-ksa.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Sep 201415 Sep 201415 Sep 2015
646waffledelivery.comNameCheap, Inc.3 Aug 2020-3 Aug 2021
647wafuutei.comGMO Internet Inc.16 Sep 20141 Sep 202416 Sep 2025
648wafdylow.us-16 Sep 2014-15 Sep 2015
649wafangdianxing.comeName Technology Co., Ltd.17 Sep 201415 Sep 201717 Sep 2018
650wafantian.comHiChina Zhicheng Technology Limited23 Apr 202012 Jan 202223 Apr 2025
651wafirsttimehomebuyer.comGoDaddy.com, LLC17 Sep 201429 Oct 202417 Sep 2024
652waffen-ssjp.comGMO Internet Inc.3 Sep 201419 Aug 20173 Sep 2018
653waffle-magic.comGoDaddy.com, LLC4 Jul 20204 Jul 20204 Jul 2021
654wafflemakers.orgHostinger, UAB24 Jan 202222 Jan 202424 Jan 2025
655wafi-services.comeNom, Inc.3 Sep 20143 Sep 20143 Sep 2015
656wafsitting.comHiChina Zhicheng Technology Limited28 Nov 201828 Nov 201828 Nov 2019
657wafu-snack.comGMO Internet Inc.3 Sep 20143 Sep 20143 Sep 2015
658wafangdianshuo.comeName Technology Co., Ltd.17 Sep 201415 Sep 201717 Sep 2018
659wafangdianyou.comeName Technology Co., Ltd.17 Sep 201415 Sep 201717 Sep 2018
660waffaz.comeNom, Inc.17 Sep 201417 Sep 201417 Sep 2015
661wafflepress.netGoogle, Inc.17 Sep 201417 Sep 201917 Sep 2020
662waff.info1&1 Internet AG6 Sep 202421 Dec 20246 Sep 2025
663wafea.comNamesilo, LLC4 Sep 201424 Nov 20244 Sep 2025
664wafea.orgNamesilo, LLC5 Sep 201420 Oct 20245 Sep 2025
665wafflenight.comGoDaddy.com, LLC4 Sep 201416 Nov 20244 Sep 2024
666wafts-dev.comGoDaddy.com, LLC4 Sep 20144 Sep 20144 Sep 2015
667waffaz.neteNom, Inc.18 Sep 201418 Sep 201418 Sep 2015
668waffensachkundepruefung-bundesweit.com1&1 Internet AG18 Sep 201413 Apr 201818 Sep 2025
669waffii.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Sep 201418 Sep 201418 Sep 2015
670waffers.comDynadot, LLC17 Sep 201418 Sep 202417 Sep 2025
671waffensachkundepruefung-bundesweit.info1&1 Internet AG18 Sep 20142 Nov 202418 Sep 2025
672waffensachkundepruefung-bundesweit.net1&1 Internet AG18 Sep 201415 Dec 201718 Sep 2025
673waffleskingdom.comOne.com A/S18 Sep 201419 Aug 202418 Sep 2025
674wafiqhachemical.comNetwork Solutions, LLC18 Sep 201418 Sep 201418 Sep 2015
675wafidacademy.comGoDaddy.com, LLC17 Nov 201413 Aug 202317 Nov 2025
676wafflewiener.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2015
677waffle3pie.comKey-Systems GmbH17 Nov 201417 Nov 201417 Nov 2015
678waffle-wiener.comGoDaddy.com, LLC18 Nov 201418 Nov 201418 Nov 2015
679waffgrenandsonspatiocovers.comGoDaddy.com, LLC17 Nov 201417 Nov 201417 Nov 2015
680wafdugfgfsd.bizGMO Internet Inc.17 Nov 201419 Nov 201416 Nov 2015
681wafastprofits.netPDR Ltd. d/b/a PublicDomainRegistry.com5 Sep 20145 Sep 20145 Sep 2015
682wafiapp.comInstra Corporation Pty Ltd.19 Jan 20246 May 202419 Jan 2025
683wafmzc.comNetwork Solutions, LLC5 Sep 20145 Sep 20145 Sep 2015
684wafutech.comXin Net Technology Corporation18 Aug 201819 Jul 202418 Aug 2025
685wafe-women.orgGMO Internet Inc.22 Nov 201523 Nov 201622 Nov 2017
686wafflechoice.comDomain.com, LLC6 Sep 20146 Sep 20146 Sep 2015
687wafflemania.netNetwork Solutions, LLC5 Jan 20173 Jan 20185 Jan 2019
688wafnews.comNamesilo, LLC9 Jul 202218 Jul 20249 Jul 2025
689wafund.orgGoDaddy.com, LLC1 Dec 20241 Dec 20241 Dec 2025
690wafu.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…23 Nov 202324 Nov 202423 Nov 2025
691wafzwc.mobiGMO Internet Inc.16 Nov 201416 Nov 201416 Nov 2015
692wafainc.comTurnCommerce, Inc. DBA NameBright.com21 Jun 201415 Jun 202021 Jun 2025
693wafelshop.comTucows Domains Inc.4 Sep 20138 Sep 20144 Sep 2015
694waferfabsolutions.comGoDaddy.com, LLC7 Sep 201431 Aug 20247 Sep 2025
695waferfabsupport.comeNom, Inc.7 Sep 20147 Sep 20147 Sep 2015
696wafflebuzz.comGoDaddy.com, LLC8 Jan 20199 Jan 20238 Jan 2025
697wafra-eg.comNameCheap, Inc.7 Sep 20148 Sep 20247 Sep 2025
698wafed-nepal.orgGMO Internet Inc.17 Nov 201428 Dec 201717 Nov 2018
699waftishow.comTucows Domains Inc.18 Nov 201422 Nov 202418 Nov 2025
700wafflewaffles.comGoDaddy.com, LLC18 Nov 201419 Nov 202418 Nov 2026
701wafflearabasi.comFBS Inc.16 Feb 201616 Feb 201616 Feb 2017
702waffelatti.comAscio Technologies, Inc. Danmark - Filial af Ascio…18 Nov 201418 Nov 201418 Nov 2015
703wafevents.comAnnulet LLC8 Oct 201325 Nov 20248 Oct 2025
704waferstepper.comHosting Concepts B.V. dba Openprovider18 Nov 201410 Feb 201718 Nov 2017
705wafamekail.comGoDaddy.com, LLC1 Feb 20191 Feb 20191 Feb 2020
706waf8uq.comTucows Domains Inc.15 Nov 201319 Nov 201415 Nov 2015
707waffledreams.comNamePal.com #801120 Apr 202424 Oct 202420 Apr 2025
708waffletrees.comNameCheap, Inc.29 Sep 201411 Jan 201829 Sep 2018
709wafiqmusallam.comTucows Domains Inc.30 Sep 20144 Oct 201530 Sep 2016
710wafersiltron.comGabia, Inc.26 Sep 200519 Sep 201726 Sep 2018
711wafersmonteverde.comPDR Ltd. d/b/a PublicDomainRegistry.com29 Sep 201426 Sep 201729 Sep 2018
712wafflesonsticks.comGoDaddy.com, LLC11 Apr 202112 Apr 202411 Apr 2025
713wafaigroup.comregister.com, Inc.8 Sep 20148 Sep 20148 Sep 2015
714wafanyakazi.comLaunchpad, Inc.22 Aug 20234 Oct 202422 Aug 2024
715wafelek.comPDR Ltd. d/b/a PublicDomainRegistry.com3 Apr 20213 Apr 20213 Apr 2022
716waffling.comDNC Holdings, Inc.25 Aug 200018 Jul 202425 Aug 2025
717wafaawakf.comGoDaddy.com, LLC10 Sep 201411 Sep 201610 Sep 2017
718wafersale.bizMesh Digital Limited9 Sep 201412 Sep 20198 Sep 2020
719waffrha.comGoDaddy.com, LLC23 Apr 202121 Apr 202423 Apr 2025
720wafindia.comGoDaddy.com, LLC29 Nov 20184 Dec 202429 Nov 2027
721wafnjt.comNetwork Solutions, LLC19 Jul 20149 Sep 201419 Jul 2015
722wafuz.comGoDaddy.com, LLC28 Apr 202229 Apr 202428 Apr 2026
723wafilmcaucus.orgLaunchpad, Inc.2 Oct 20143 Oct 20142 Oct 2015
724wafaawakf.infoGoDaddy.com, LLC10 Sep 201425 Oct 202410 Sep 2025
725waffleroga.comNameCheap, Inc.19 Nov 201411 Jan 201819 Nov 2018
726wafaawakf.netGoDaddy.com, LLC10 Sep 201411 Sep 201610 Sep 2017
727waf888.comGabia, Inc.28 Sep 20134 Oct 201428 Sep 2015
728wafflemilly.com1API GmbH4 Oct 201417 Nov 20244 Oct 2024
729wafinvestments.comGoogle, Inc.26 Nov 202126 Nov 202126 Nov 2022
730wafseattle.orgNetwork Solutions, LLC3 Oct 20143 Oct 20143 Oct 2015
731wafyfair.comGransy s.r.o. d/b/a subreg.cz3 Oct 201425 Sep 20243 Oct 2025
732wafona-online.comGMO Internet Inc.3 Oct 20144 Sep 20173 Oct 2018
733wafens.com-11 Jul 201611 Jul 201611 Jul 2017
734waffle-bar.comGoDaddy.com, LLC21 May 202421 May 202421 May 2025
735wafso.comPDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 201410 Sep 201410 Sep 2015
736wafaawakf.orgGoDaddy.com, LLC10 Sep 201411 Sep 201710 Sep 2018
737wafalliance.orgDomain.com, LLC10 Sep 2014-10 Sep 2015
738waferoptic.orgPDR Ltd. d/b/a PublicDomainRegistry.com10 Sep 201410 Sep 201410 Sep 2015
739waftweb.com-14 Jul 201614 Jul 201614 Jul 2017
740waffles4dinner.comGoDaddy.com, LLC1 Oct 20141 Oct 20141 Oct 2015
741wafaasemaan.comGoDaddy.com, LLC21 Sep 201421 Sep 201421 Sep 2015
742wafflemakerstore.comNameCheap, Inc.9 May 202321 Jul 20249 May 2025
743wafflesmania.comGoDaddy.com, LLC10 Apr 202322 Apr 202410 Apr 2025
744wafuasp.orgeNom, Inc.19 Nov 201419 Nov 201419 Nov 2015
745wafture.netregister.com, Inc.19 Nov 201421 Nov 201419 Nov 2015
746waft-armpit.netGMO Internet Inc.20 Nov 201420 Nov 201420 Nov 2015
747wafra-me.comChengdu West Dimension Digital Technology Co., Ltd…8 Feb 20198 Feb 20198 Feb 2020
748wafoof.net1&1 Internet AG20 Nov 201420 Nov 201420 Nov 2015
749wafasgh.comregister.com, Inc.21 Nov 201421 Nov 201421 Nov 2015
750waffledog.netAmazon Registrar, Inc.14 Mar 202414 Mar 202414 Mar 2025
751wafet.comPSI-USA, Inc. dba Domain Robot3 Sep 200923 Oct 20243 Sep 2025
752wafffar.comGoDaddy.com, LLC4 Oct 20145 Oct 20154 Oct 2016
753waffleolicious.comGoDaddy.com, LLC19 Jun 201819 Jun 202419 Jun 2025
754wafemyanmarengineeringservices.comOnlineNIC, Inc.23 Sep 201415 Sep 201723 Sep 2018
755waf3bsgs.comGMO Internet Inc.22 Sep 201423 Sep 201422 Sep 2015
756waffenkammer.netKey-Systems GmbH22 Sep 201422 Sep 201722 Sep 2018
757wafelsenzo.comKey-Systems GmbH22 Sep 201427 Oct 201722 Sep 2018
758wafarmersfirst.comSynergy Wholesale Pty Ltd6 Oct 201421 Sep 20246 Oct 2025
759wafelen.comTucows Domains Inc.5 Oct 20149 Oct 20155 Oct 2016
760wafflebuswifi.infoNETIM SARL5 Oct 20145 Oct 20145 Oct 2015
761waffledogg.comGoDaddy.com, LLC7 Dec 20207 Dec 20207 Dec 2021
762waffledoggie.comGoDaddy.com, LLC5 Oct 20145 Oct 20145 Oct 2015
763waffrnalk.comNameCheap, Inc.13 Mar 202324 Apr 202413 Mar 2024
764wafuk.comTurnCommerce, Inc. DBA NameBright.com23 Sep 201417 Sep 202023 Sep 2025
765waf21.comTop Pick Names LLC9 Feb 202225 Apr 20239 Feb 2023
766wafai.biz-15 Sep 20059 Sep 202414 Sep 2025
767wafawcett.comTucows Domains Inc.6 Oct 201417 Dec 20246 Oct 2024
768wafg.orgNameKing.com Inc.26 Jan 202218 Apr 202426 Jan 2025
769wafricanhairbraiding.comTucows Domains Inc.3 Oct 20047 Oct 20143 Oct 2015
770wafuyi.comShanghai Meicheng Technology Information Co., Ltd21 Nov 201422 Nov 202421 Nov 2025
771wafiyhz.comGoDaddy.com, LLC21 Nov 201421 Nov 201421 Nov 2015
772waf-transport.comBeijing Innovative Linkage Technology Ltd. dba dns…18 Nov 201021 Nov 201418 Nov 2015
773wafa-cliorscup.comNETIM SARL7 Oct 20146 Oct 20217 Oct 2025
774wafa-cliorscup.netNETIM SARL7 Oct 20146 Oct 20217 Oct 2025
775wafflingon.comWebfusion Ltd.7 Oct 20148 Oct 20247 Oct 2025
776wafflingon.orgNetwork Solutions, LLC8 Oct 201420 Dec 20248 Oct 2024
777wafi.infoWild West Domains, LLC15 Apr 202010 Jun 202415 Apr 2025
778waffenss.orgGoDaddy.com, LLC14 Jun 20205 Aug 202414 Jun 2025
779wafflefryclothing.comGoDaddy.com, LLC24 Sep 201424 Sep 201424 Sep 2017
780wafcclinics.infoGoDaddy.com, LLC25 Sep 20144 Jul 202425 Sep 2025
781wafcclinics.netGoDaddy.com, LLC25 Sep 201417 Sep 202225 Sep 2025
782wafflemakermart.comGoDaddy.com, LLC25 Sep 201425 Sep 201625 Sep 2017
783wafzdi.orgGMO Internet Inc.20 Nov 201420 Nov 201420 Nov 2015
784wafoof.org1&1 Internet AG20 Nov 2014-20 Nov 2015
785wafajamil.netTucows Domains Inc.17 Nov 201112 Sep 202417 Nov 2025
786wafcclinics.orgGoDaddy.com, LLC25 Sep 20146 Jul 202425 Sep 2025
787waflightplan.orgFastDomain Inc.25 Sep 201425 Sep 201425 Sep 2015
788waffiler.comGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
789wafflelust.comNameCheap, Inc.25 Nov 202326 Oct 202425 Nov 2025
790wafiler.comGoDaddy.com, LLC8 Oct 20148 Oct 20148 Oct 2015
791wafsy.orgPDR Ltd. d/b/a PublicDomainRegistry.com8 Oct 20148 Oct 20148 Oct 2015
792waffookies.bizGoDaddy.com, LLC9 Oct 20149 Oct 20148 Oct 2015
793waferstrategiesllc.comDropCatch.com 1252 LLC9 Feb 201711 Feb 20179 Feb 2018
794wafgzic.comNetwork Solutions, LLC28 Sep 201429 Sep 201428 Sep 2015
795wafbjl.comNetwork Solutions, LLC28 Sep 201428 Sep 201428 Sep 2015
796waffor.comGoDaddy.com, LLC28 Sep 201410 Sep 202428 Sep 2025
797waferstrategiesllc.infoGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2016
798wafetmow.comOVH sas15 Oct 201415 Oct 201415 Oct 2015
799waftsguild.comeNom, Inc.15 Oct 201415 Oct 201415 Oct 2015
800wafizie.comGoDaddy.com, LLC24 Nov 201424 Nov 201424 Nov 2015
801wafiqhachemicals.comNetwork Solutions, LLC23 Nov 201423 Nov 201423 Nov 2015
802wafflledesign.comTucows Domains Inc.23 Nov 201422 Nov 202423 Nov 2025
803waffleos.comTurnCommerce, Inc. DBA NameBright.com10 Feb 20174 Feb 202110 Feb 2025
804wafflemenu.comName.com, Inc.24 Mar 202431 Aug 202424 Mar 2025
805wafer-li.comeNom, Inc.23 Nov 201423 Nov 201423 Nov 2015
806wafdxw.comHangzhou AiMing Network Co., LTD24 Nov 201424 Nov 201424 Nov 2015
807wafflessmp.netGoDaddy.com, LLC22 Nov 201422 Nov 201422 Nov 2015
808waferstrategiesllc.netGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2016
809wafus.comPSI-USA, Inc. dba Domain Robot18 Sep 20087 Nov 202418 Sep 2025
810wafflecim.comBeijing Lanhai Jiye Technology Co., Ltd3 Nov 20224 Jan 20253 Nov 2024
811wafflebuano.comTurnCommerce, Inc. DBA NameBright.com6 Feb 20196 Feb 20196 Feb 2020
812waferss.com-20 Jul 201620 Jul 201620 Jul 2017
813wafangzi.comBeijing Innovative Linkage Technology Ltd. dba dns…10 Oct 20147 Aug 201710 Oct 2017
814wafatours.comGoDaddy.com, LLC19 Aug 201919 Aug 201919 Aug 2020
815wafeldag.comTucows Domains Inc.10 Oct 201414 Oct 201510 Oct 2016
816waffen.proPorkbun, LLC1 Dec 20241 Dec 20241 Dec 2029
817waffiller.comGoDaddy.com, LLC11 Oct 201411 Oct 201411 Oct 2015
818wafforum.netKey-Systems GmbH10 Oct 201410 Oct 201410 Oct 2015
819wafforum.orgKey-Systems GmbH10 Oct 201410 Oct 201410 Oct 2015
820wafiller.comGoDaddy.com, LLC11 Oct 201411 Oct 201411 Oct 2015
821wafoot.netXin Net Technology Corporation12 May 201712 May 201712 May 2018
822waforum.netHostinger, UAB26 Jan 202218 Mar 202326 Jan 2025
823wafsfzpa.orgGMO Internet Inc.10 Oct 2014-10 Oct 2015
824wafubing.comNamesilo, LLC23 Jul 201924 Jul 201923 Jul 2020
825wafricalogistics.comGoDaddy.com, LLC17 Oct 201417 Oct 202217 Oct 2025
826wafflewasted.comregister.com, Inc.16 Oct 201416 Oct 201416 Oct 2015
827wafaindonesia.comHostinger, UAB16 Oct 201416 Oct 201416 Oct 2015
828wafablush.comGoDaddy.com, LLC16 Oct 201417 Oct 201416 Oct 2015
829waflightplan.comGoDaddy.com, LLC19 Dec 201619 Dec 201619 Dec 2017
830wafflecraft.comTurnCommerce, Inc. DBA NameBright.com25 Sep 201413 Nov 202425 Sep 2025
831waffle-innovators.comChengdu West Dimension Digital Technology Co., Ltd…14 Dec 201914 Dec 201914 Dec 2020
832wafcclinics.comGoDaddy.com, LLC25 Sep 201417 Sep 202225 Sep 2025
833waf3.comGoDaddy.com, LLC25 Sep 201426 Sep 202425 Sep 2025
834waftbox.comeNom, Inc.27 Sep 201427 Sep 201427 Sep 2015
835waffen-forum.neteNom, Inc.11 Oct 201412 Oct 201411 Oct 2015
836wafflesandvodka.comGoDaddy.com, LLC12 Oct 201414 Jun 202414 Jun 2025
837waffleos.netPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 201423 Nov 201423 Nov 2015
838wafirtravel.comHostinger, UAB3 Nov 202213 Dec 20233 Nov 2023
839wafiftytwoeighty.comGoDaddy.com, LLC25 Nov 201425 Nov 202425 Nov 2025
840waferspring.comNetraCorp LLC dba Global Internet24 Sep 200514 Oct 201524 Sep 2016
841waferinspectors.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
842waferinspector.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
843waferinspectiontools.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
844waferinspectiontool.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
845waferdefectdetection.comeNom, Inc.24 Nov 201424 Nov 201424 Nov 2015
846wafabeauty.comGoDaddy.com, LLC23 Jul 20232 Sep 202423 Jul 2024
847waffle-studio-designs.comGoDaddy.com, LLC12 Oct 201413 Oct 201612 Oct 2018
848wafflesepeti.comGoDaddy.com, LLC20 Mar 201720 Mar 201720 Mar 2018
849waffleorawful.comGoDaddy.com, LLC17 Oct 201429 Oct 201617 Oct 2017
850wafflebreakfast.comFastDomain Inc.18 Oct 20141 Dec 202418 Oct 2024
851waferstrategiesllc.orgGoDaddy.com, LLC23 Nov 201423 Nov 201423 Nov 2016
852wafpsm.comWild West Domains, LLC25 Nov 201426 Nov 202425 Nov 2025
853waffivibes.comTucows Domains Inc.17 Mar 20237 Mar 202417 Mar 2025
854wafacars.comOVH sas25 Nov 201425 Nov 201425 Nov 2015
855waffleorawffle.comGoDaddy.com, LLC18 Oct 201418 Oct 201418 Oct 2015
856waffalafel.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Oct 201418 Oct 201418 Oct 2015
857wafeeqa-realestate.comPDR Ltd. d/b/a PublicDomainRegistry.com15 Oct 201411 Sep 202415 Oct 2025
858waffableweed.comGoDaddy.com, LLC15 Oct 201415 Oct 201415 Oct 2016
859wafflenut.comregister.com, Inc.2 Jun 20162 Jun 20162 Jun 2017
860wafflesbar.comGoDaddy.com, LLC14 Oct 201415 Oct 202414 Oct 2025
861wafiqmitrateknik.comTrunkoz Technologies Pvt Ltd. d/b/a OwnRegistrar.c…26 Oct 202226 Oct 202226 Oct 2023
862wafujian.orgCrazy Domains FZ-LLC14 Oct 201428 Nov 202414 Oct 2026
863waffenfuerrojava.orgGMO Internet Inc.3 Jan 20174 Jan 20183 Jan 2019
864wafoministries.netOVH sas24 Nov 201425 Nov 202424 Nov 2025
865wafiftytwoeighty.netGoDaddy.com, LLC25 Nov 201425 Nov 202425 Nov 2025
866wafgin.comGoDaddy.com, LLC20 Oct 201420 Oct 201420 Oct 2015
867wafersliver.comGoDaddy.com, LLC19 Oct 201419 Oct 201419 Oct 2015
868wafacosmetica.comeNom, Inc.19 Oct 201425 Jan 201719 Oct 2019
869wafflems.orgName.com, Inc.25 Nov 201425 Nov 201425 Nov 2015
870wafoundation.comTurnCommerce, Inc. DBA NameBright.com25 Nov 201419 Nov 202025 Nov 2025
871waforcerealty.com1&1 Internet AG3 May 20173 May 20173 May 2018
872waffleworkscatering.comNetwork Solutions, LLC26 Nov 201424 Nov 201626 Nov 2017
873wafflelolly.comAmazon Registrar, Inc.11 Jan 20207 Dec 202411 Jan 2026
874wafflecomic.comNetpia.com, Inc.26 Nov 201427 Dec 201526 Nov 2015
875waffleandpancakehouse.comGoDaddy.com, LLC28 Apr 20213 Aug 202328 Apr 2026
876waferhandlingsupplier.comThe Registrar Company B.V.26 Nov 201421 Mar 201726 Nov 2017
877waftular.infoCrazy Domains FZ-LLC19 Oct 201420 Oct 201419 Oct 2015
878wafml.comDropCatch.com 1279 LLC7 Jun 20207 Jun 20207 Jun 2021
879waffleheater.comHosting Concepts B.V. dba Openprovider27 Nov 201427 Nov 202427 Nov 2025
880wafflaki.com1&1 Internet AG16 Sep 202316 Sep 202316 Sep 2025
881waftinginternational.comGoDaddy.com, LLC28 Nov 20148 Nov 202428 Nov 2025
882wafstudy.comHiChina Zhicheng Technology Limited28 Nov 201428 Nov 201428 Nov 2015
883wafiya.comGoDaddy.com, LLC10 Jul 201611 Jul 202410 Jul 2025
884wafflecloud.comMegazone Corp., dba HOSTING.KR29 Nov 201429 Aug 202429 Nov 2025
885wafermessenger.comNetwork Solutions, LLC28 Nov 201429 Oct 202428 Nov 2025
886wafobel.comBeijing Lanhai Jiye Technology Co., Ltd17 Aug 202218 Aug 202417 Aug 2025
887wafflemakercorner.comDOMAIN NAME NETWORK PTY LTD2 May 20242 May 20242 May 2025
888wafflehotdog.comGoDaddy.com, LLC1 May 202312 May 20241 May 2025
889wafflehigh.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
890wafflehi.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
891waffesforbreakfast.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2016
892waffercard.comeNom, Inc.29 Nov 201430 Nov 201429 Nov 2015
893waferlabuga.comregister.com, Inc.30 Nov 201430 Nov 201430 Nov 2016
894wafflecloud.netMegazone Corp., dba HOSTING.KR29 Nov 201421 Nov 202429 Nov 2025
895wafflenarlidere.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 20141 Dec 201430 Nov 2015
896wafflecitynarlidere.comPDR Ltd. d/b/a PublicDomainRegistry.com30 Nov 20141 Dec 201430 Nov 2015
897waffleanime.comGoDaddy.com, LLC1 Dec 20141 Dec 20141 Dec 2015
898wafar-dmo3k.comGoDaddy.com, LLC30 Nov 201430 Nov 201430 Nov 2015
899wafobel.orgAscio Technologies, Inc. Danmark - Filial af Ascio…29 Nov 2014-29 Nov 2015
900wafobel.netAscio Technologies, Inc. Danmark - Filial af Ascio…29 Nov 201429 Nov 201429 Nov 2015
901wafflesandwedges.com-22 Aug 201622 Aug 201622 Aug 2017
902wafhqxsylzq.bizPDR Ltd. d/b/a PublicDomainRegistry.com2 Dec 20142 Dec 20141 Dec 2015
903wafflesinterviewprep.comHebei Guoji Maoyi (Shanghai) LTD dba HebeiDomains.…2 Dec 20142 Dec 20142 Dec 2015
904wafflertruck.comGoDaddy.com, LLC3 Dec 20143 Dec 20163 Dec 2017
905waffleci.comTurnCommerce, Inc. DBA NameBright.com6 May 201730 Apr 20206 May 2025
906waferlab.orgGMO Internet Inc.18 Feb 202423 Feb 202418 Feb 2025
907waffleman.netGoDaddy.com, LLC27 Jun 20228 Sep 202427 Jun 2024
908wafling.comCrazy Domains FZ-LLC3 Dec 20143 Dec 20143 Dec 2015
909wafarmers.comGoDaddy.com, LLC9 Jan 20218 Aug 20249 Jan 2026
910wafajamil.comNameKing.com Inc.8 May 20208 May 20208 May 2021
911wafa-benromdan.comOVH sas3 Dec 20146 Dec 20153 Dec 2016
912waftersbenefitsnow.comPDR Ltd. d/b/a PublicDomainRegistry.com4 Dec 20144 Dec 20144 Dec 2015
913wafflesincaffeinated.comNetwork Solutions, LLC4 Dec 20144 Nov 20244 Dec 2025
914wafesoftware.comGandi SAS4 Dec 20144 Dec 20144 Dec 2015
915wafarmers.orgeNom, Inc.3 Dec 201420 Mar 20173 Dec 2017
916waffleshop.netGoogle, Inc.7 Feb 20238 Apr 20247 Feb 2024
917waffengesetz.info1&1 Internet AG11 Jan 202325 Feb 202411 Jan 2025
918wafolicious.comWild West Domains, LLC5 Dec 20145 Dec 20145 Dec 2015
919wafflelafel.comGoDaddy.com, LLC5 Dec 20145 Dec 20145 Dec 2015
920waffenschmitz.com1&1 Internet AG5 Dec 20145 Dec 20145 Dec 2015
921wafdbmfu9ih.comGMO Internet Inc.5 Dec 20146 Dec 20145 Dec 2015
922wafd300.comGoDaddy.com, LLC5 Dec 20145 Dec 20145 Dec 2016
923wafalafel.com1&1 Internet AG27 Feb 201727 Feb 202427 Feb 2025
924waffle-crete.comDNC Holdings, Inc.28 Oct 19979 Dec 202427 Oct 2025
925waffleheart.orgTucows Domains Inc.1 Dec 20105 Dec 20141 Dec 2015
926wafmarketing.comNameCheap, Inc.10 Apr 202425 Jun 202410 Apr 2025
927wafholdings.comGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
928wafgcwrouzlm.comGMO Internet Inc.8 Dec 20148 Dec 20148 Dec 2015
929waffle-kitchen.com1&1 Internet AG10 Jun 201711 Jun 202410 Jun 2025
930wafeekpor.comAscio Technologies, Inc. Danmark - Filial af Ascio…8 Dec 20148 Dec 20148 Dec 2015
931waffhbd.orgPDR Ltd. d/b/a PublicDomainRegistry.com7 Dec 20147 Dec 20147 Dec 2015
932wafmarketing.infoGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
933wafholdings.infoGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
934wafflehousediary.comGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2016
935wafw.netGoDaddy.com, LLC14 May 201714 May 201714 May 2018
936wafmarketing.netGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
937wafholdings.netGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
938wafflepress.orgGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
939wafycollege.comGoDaddy.com, LLC7 Feb 20177 Feb 20177 Feb 2019
940wafflelo.comGabia, Inc.5 Dec 200810 Dec 20145 Dec 2015
941wafangdianxw.comChengdu West Dimension Digital Technology Co., Ltd…29 May 201929 May 201929 May 2020
942wafmarketing.orgGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
943wafholdings.orgGoDaddy.com, LLC9 Dec 20149 Dec 20149 Dec 2015
944waffenschrank-heunert.infounited-domains AG11 Dec 201411 Dec 202411 Dec 2025
945waffar.infoNameCheap, Inc.20 Dec 20221 Mar 202420 Dec 2023
946wafuelmandate.comGoDaddy.com, LLC11 Dec 201411 Dec 201411 Dec 2015
947waffletalks.comGoDaddy.com, LLC12 Dec 201412 Dec 201412 Dec 2016
948waffenschrank-heunert.comunited-domains AG11 Dec 201414 Dec 202411 Dec 2025
949waffenschrank-heunert.bizunited-domains AG11 Dec 20144 Dec 202410 Dec 2024
950wafer-it.comTucows Domains Inc.11 Dec 201415 Dec 201911 Dec 2019
951wafsh.com-25 Nov 201330 Oct 202425 Nov 2028
952waffleton.comGoDaddy.com, LLC12 Dec 201421 Nov 202412 Dec 2033
953wafflecraze.comTurnCommerce, Inc. DBA NameBright.com12 Dec 201413 Nov 202412 Dec 2024
954waffenschrank-heunert.netunited-domains AG11 Dec 20149 Dec 202411 Dec 2025
955wafupdates.comKey-Systems GmbH13 Dec 201414 Dec 201413 Dec 2015
956wafflejam.comSquarespace Domains LLC20 Nov 20235 Nov 202420 Nov 2025
957waffle123.comDOMAIN NAME NETWORK PTY LTD23 Oct 202423 Oct 202423 Oct 2025
958waffenfuzzi.comGoDaddy.com, LLC15 Dec 201415 Dec 201415 Dec 2015
959wafaflowers.comDropCatch.com 425 LLC14 Dec 201415 Dec 201614 Dec 2017
960wafaa.netGoDaddy.com, LLC14 Dec 201424 Nov 202414 Dec 2025
961wafukuaishan.comXin Net Technology Corporation15 Dec 201415 Dec 201415 Dec 2015
962waflcolts.comeNom, Inc.16 Dec 201416 Dec 201416 Dec 2015
963wafcw.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…15 Dec 201429 Nov 202415 Dec 2025
964wafrost.bizNetwork Solutions, LLC16 Dec 201422 Oct 201915 Dec 2020
965wafriconline.comGoogle, Inc.10 Dec 200711 Dec 201710 Dec 2018
966waffrewards.comLaunchpad, Inc.16 Dec 201416 Dec 201416 Dec 2015
967wafflesquadron.comTucows Domains Inc.13 Dec 200517 Dec 201413 Dec 2015
968wafflerestaurantchicago.comGoDaddy.com, LLC16 Dec 201416 Dec 201416 Dec 2015
969wafeel.comHiChina Zhicheng Technology Limited15 Jun 201817 Jun 202115 Jun 2025
970wafrost.infoNetwork Solutions, LLC16 Dec 201417 Oct 201916 Dec 2020
971wafrost.us-16 Dec 201417 Oct 201615 Dec 2017
972wafrost.orgNetwork Solutions, LLC16 Dec 201417 Oct 201616 Dec 2017
973wafrost.netNetwork Solutions, LLC16 Dec 20145 Mar 201716 Dec 2017
974wafeel.netHiChina Zhicheng Technology Limited16 Dec 201416 Dec 201416 Dec 2017
975wafflezandwings.comGoDaddy.com, LLC18 Dec 201418 Dec 201418 Dec 2015
976wafios-wpt.comDeutsche Telekom AG19 Dec 201427 Dec 201619 Dec 2017
977wafios-wpt.bizDeutsche Telekom AG19 Dec 20142 Feb 202018 Dec 2020
978wafexusa.comGoDaddy.com, LLC19 Dec 201421 Dec 202419 Dec 2025
979wafestivaloflaughs.comMarcaria.com International, Inc.19 Dec 201419 Dec 201419 Dec 2016
980wafricandevelopmentministries.orgregister.com, Inc.18 Dec 20143 Dec 201618 Dec 2018
981waflayer.comAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…3 Nov 20204 Nov 20243 Nov 2024
982wafiazizsattar.comGoDaddy.com, LLC20 Dec 201420 Dec 201420 Dec 2015
983wafflecouple.comHiChina Zhicheng Technology Limited20 Dec 201420 Dec 201420 Dec 2015
984wafiazizsattar.netGoDaddy.com, LLC20 Dec 201420 Dec 201420 Dec 2015
985waffleandmore.comNameCheap, Inc.15 Feb 202117 Jan 202415 Feb 2025
986waffelpool.comGoDaddy.com, LLC22 Dec 201422 Dec 201422 Dec 2015
987wafdgeca.comDynadot16 LLC2 Jun 202213 Jul 20232 Jun 2023
988wafbtv9.comTucows Domains Inc.18 Dec 201122 Dec 201418 Dec 2015
989waftinternational.comDropCatch.com 704 LLC11 Mar 201716 Mar 201711 Mar 2018
990waffarle.comGoDaddy.com, LLC5 Jun 20245 Jun 20245 Jun 2025
991wafaaaaco.orgGMO Internet Inc.21 Dec 2014-21 Dec 2015
992wafu.mobiGMO Internet Inc.23 Dec 20143 Feb 202423 Dec 2023
993wafflesavenue.comeNom, Inc.23 Dec 201423 Dec 201423 Dec 2015
994wafflemakerschoice.comGoDaddy.com, LLC24 Dec 201424 Dec 201424 Dec 2015
995waf10086.comXin Net Technology Corporation23 Dec 201423 Dec 201423 Dec 2015
996waftinternational.netPDR Ltd. d/b/a PublicDomainRegistry.com22 Dec 201422 Dec 201422 Dec 2015
997wafuu.info1&1 Internet AG23 Sep 201722 May 202023 Sep 2020
998waffling.netWild West Domains, LLC31 Oct 202031 Oct 202031 Oct 2021
999waftbakery.comTucows Domains Inc.24 Dec 201415 Dec 202424 Dec 2025
1000wafiasgar.comGoDaddy.com, LLC18 Mar 201919 Mar 202418 Mar 2025

Displaying 1,000 out of 26,773 domains starting with the keyword "WAF". To see all the results, kindly use our Reverse WHOIS API.


Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=waf

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now