Our database now contains whois records of 612 Million (612,994,365) domain names.
Login / Password / Signup
Low Price Guarantee

Whois API / Whois History / Reverse Whois

Our WHOIS API returns consistent and well-structured WHOIS data in XML & JSON format. Returned data contain parsed WHOIS fields that can be easily understood by your application. Along with WHOIS API, we also offer WHOIS History API and Reverse WHOIS API.

Powered by Amazon Web Services With support for 1576 TLDs, our cloud-based API lets you quickly access any domain's WHOIS data through Bulk Whois Lookup, Newly Registered Domains, Dropped Deleted Domains, Expiring Domains and Whois Database Download.
Our Services Price Order
1000 WHOIS Lookup API Queries $2 Details
1000 WHOIS History API Queries $5 Details
1000 Reverse WHOIS API Queries $10 Details
Newly Registered Domains Database $495 Details
Whois Database [612 Million Domains] $10,000 Details

Keyword: WELLSPA

Reverse Whois » KEYWORD [wellspa ]  { 697 domain names }


NumDomain NameRegistrarCreatedUpdatedExpiry
1wellspa.comName.com, Inc.28 Mar 200330 Mar 202528 Mar 2025
2wellspa.infoGoDaddy.com, LLC25 Sep 202125 Sep 202125 Sep 2022
3wellspa.netDynadot, LLC14 Sep 201910 Aug 202314 Sep 2025
4wellspa.orgNameKing.com Inc.25 May 201828 May 202425 May 2025
5wellspa.co.uk-17 Oct 20175 Jan 202517 Oct 2025
6wellspa.digitalCronon AG17 Nov 20211 Jan 202517 Nov 2025
7wellspa.onlineCrazy Domains FZ-LLC2 Jan 20222 Jan 20222 Jan 2023
8wellspa.lifeGoDaddy.com, LLC3 Nov 202318 Dec 20243 Nov 2025
9wellspa.nl-17 Apr 200721 Nov 2024-
10wellspa.usNameKing.com Inc.16 Aug 202215 Sep 202316 Aug 2023
11wellspa.xyzAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…18 Feb 20251 Mar 202518 Feb 2026
12wellspa.ca-27 Apr 200428 Apr 202227 Apr 2031
13wellspa.in-24 Aug 202324 Aug 202424 Aug 2024
14wellspa.ro-15 Aug 2023-14 Aug 2025
15wellspa.shopGoDaddy.com, LLC3 Nov 202310 Jan 20253 Nov 2025
16wellspa.frOVH sas6 May 202128 Feb 20256 May 2025
17wellspa.sk-26 Nov 201810 Dec 202426 Nov 2025
18wellspa.ru-26 Sep 2006-26 Sep 2025
19wellspan.orgCSC Corporate Domains, Inc.18 Apr 200019 Apr 202518 Apr 2026
20wellspa-portal.de--29 Oct 2010-
21wellspayroll.comRegister.it SPA24 Apr 201824 Apr 201824 Apr 2019
22wellspay.comMegazone Corp., dba HOSTING.KR27 Jul 201713 Aug 202427 Jul 2025
23wellspanked.neteNom, Inc.4 Aug 20095 Sep 20244 Aug 2025
24wellspanlabs.orgCSC Corporate Domains, Inc.12 Aug 201023 May 202312 Aug 2025
25wellsparetreat.comTucows Domains Inc.1 Sep 201427 Mar 20251 Sep 2025
26wellspaceheater.comGoDaddy.com, LLC3 Oct 20143 Oct 20143 Oct 2015
27wellspacerx.comNetwork Solutions, LLC10 Apr 202430 Mar 202510 Apr 2026
28wellspatricia.comMarcaria.com International, Inc.13 Oct 201413 Oct 201413 Oct 2015
29wellspalstics.comTucows Domains Inc.3 Dec 20137 Dec 20143 Dec 2015
30wellspaving.comAnnulet LLC15 Dec 20141 Feb 202515 Dec 2025
31wellspavinglynchburg.comGoDaddy.com, LLC19 Dec 201419 Dec 201419 Dec 2015
32wellsparkyoga.comWild West Domains, LLC29 Dec 201429 Dec 201429 Dec 2015
33wellspace.net-3 Sep 202428 Feb 20253 Sep 2025
34wellspainreclaimrubber.comInfocom Network Ltd.13 Feb 201513 Feb 201513 Feb 2016
35wellspabooker.comPDR Ltd. d/b/a PublicDomainRegistry.com4 May 20154 May 20154 May 2016
36wellspatexas.comTucows Domains Inc.9 May 201413 May 20159 May 2016
37wellspan9.comAscio Technologies, Inc. Danmark - Filial af Ascio…15 May 201515 May 201515 May 2016
38wellspanhealthintl.comTucows Domains Inc.1 Jul 20151 Jul 20151 Jul 2017
39wellsparkstudio.comGoDaddy.com, LLC7 Jul 20158 Jul 20237 Jul 2025
40wellsparkstudio.orgGoDaddy.com, LLC7 Jul 201512 Jul 20177 Jul 2019
41wellsparkstudio.netGoDaddy.com, LLC7 Jul 20157 Jul 20157 Jul 2017
42wellsparkstudio.infoGoDaddy.com, LLC7 Jul 201512 Jul 20177 Jul 2019
43wellspacegallery.comXin Net Technology Corporation22 Feb 202127 May 202122 Feb 2022
44wellspaintingcompany.comPDR Ltd. d/b/a PublicDomainRegistry.com1 Oct 20151 Oct 20161 Oct 2017
45wellspacandle.comTucows Domains Inc.16 Nov 201520 Nov 201616 Nov 2016
46wellspacesf.comGoDaddy.com, LLC21 Nov 201520 Sep 202221 Nov 2025
47wellspacegroup.comDynadot, LLC25 Oct 202111 Feb 202525 Oct 2025
48wellspacecoaching.comGoDaddy.com, LLC21 Nov 201521 Nov 201521 Nov 2020
49wellspark.orgMarkMonitor Inc.17 Apr 201927 Feb 202517 Apr 2027
50wellspayment.comPDR Ltd. d/b/a PublicDomainRegistry.com16 Jan 201616 Jan 201616 Jan 2017
51wellspartners.comTurnCommerce, Inc. DBA NameBright.com7 Mar 20171 Mar 20217 Mar 2025
52wellspays.com----
53wellspacehealth.orgGoDaddy.com, LLC14 Nov 201229 Dec 202414 Nov 2025
54wellspaintingco.comGoogle, Inc.24 Mar 20229 Mar 202524 Mar 2026
55wellspamassage.comMedia Elite Holdings Limited19 May 202131 Aug 202319 May 2025
56wellspansaving.comAbove.com Pty Ltd.11 Oct 201621 Apr 202311 Oct 2025
57wellspark.solutionsGoDaddy.com, LLC14 Mar 20166 Jan 201714 Mar 2018
58wellspacecollective.comSquarespace Domains LLC22 Mar 202522 Mar 202522 Mar 2026
59wellspay.top-31 Mar 201631 Mar 201631 Mar 2017
60wellspansurgery.orgCSC Corporate Domains, Inc.4 May 201623 May 20234 May 2025
61wellspansurgery.comCSC Corporate Domains, Inc.10 Jun 201618 May 202310 Jun 2026
62wellspaandfitness.comGoDaddy.com, LLC28 Jun 201622 Sep 202228 Jun 2026
63wellspafitness.comGoDaddy.com, LLC28 Jun 201622 Sep 202228 Jun 2026
64wellspatent.bizGoDaddy.com, LLC25 Jun 201325 Jun 201724 Jun 2018
65wellspargo.comMedia Elite Holdings Limited27 Aug 20248 Dec 202427 Aug 2025
66wellspargobank.comGoDaddy.com, LLC23 Dec 202123 Dec 202123 Dec 2022
67wellspacefitness.comregister.com, Inc.14 Dec 201215 Dec 202414 Dec 2025
68wellspavingandsealcoating.comTucows Domains Inc.10 Sep 200412 Aug 202410 Sep 2025
69wellspashop.comGransy s.r.o. d/b/a subreg.cz11 Apr 202310 Apr 202411 Apr 2025
70wellspacearchitecture.comGoDaddy.com, LLC2 Sep 20162 Sep 20242 Sep 2026
71wellspacecounseling.comTucows Domains Inc.25 Sep 201611 Sep 202425 Sep 2025
72wellspankedbottom.comWebfusion Ltd.30 Mar 201410 Apr 202530 Mar 2027
73wellspanhealth.comCSC Corporate Domains, Inc.1 Nov 199928 Oct 20241 Nov 2025
74wellspankmyassandcallmecharlie.comGoDaddy.com, LLC10 Feb 200010 Feb 201610 Feb 2017
75wellspandesign.comGoDaddy.com, LLC12 Jan 202512 Jan 202512 Jan 2026
76wellspansavings.comCSC Corporate Domains, Inc.3 Aug 20073 Sep 20243 Aug 2025
77wellspavingspecialists.comTucows Domains Inc.17 Oct 201321 Oct 201717 Oct 2017
78wellspacestudio.comGoDaddy.com, LLC15 Oct 201316 Oct 202415 Oct 2025
79wellspavingmd.comNameCheap, Inc.22 May 201322 Apr 202422 May 2025
80wellspacedesign.comSquarespace Domains LLC26 Sep 202426 Sep 202426 Sep 2025
81wellspainting.comGoDaddy.com, LLC21 May 200929 Sep 202221 May 2026
82wellspatservices.com1&1 Internet AG12 Jan 201013 Jan 201712 Jan 2018
83wellspalon.comGoDaddy.com, LLC4 Apr 20105 Apr 20164 Apr 2018
84wellspainrubber.com-29 May 202429 May 202429 May 2025
85wellspatent.comGoDaddy.com, LLC17 Jul 200018 Jul 202417 Jul 2025
86wellspagroup.comGoDaddy.com, LLC4 Jan 20065 Jan 20254 Jan 2026
87wellspamn.comNetwork Solutions, LLC5 Apr 201318 Jun 20245 Apr 2024
88wellspac.comDynadot12 LLC19 May 202220 May 202319 May 2024
89wellspancare.comCSC Corporate Domains, Inc.10 Mar 20006 Mar 202510 Mar 2026
90wellspaintingandpressurewashing.comCloudFlare, Inc.2 Aug 201220 Sep 20242 Aug 2025
91wellspartnership.comeNom, Inc.21 Aug 200123 Jul 202421 Aug 2025
92wellspacing.comGoDaddy.com, LLC26 Sep 201327 Sep 202326 Sep 2025
93wellspaul.comNameCheap, Inc.8 Jan 201211 Jan 20258 Jan 2028
94wellspamag.comDotRoll Kft.15 Oct 20131 Oct 201715 Oct 2018
95wellspacetoronto.comTucows Domains Inc.13 Oct 200928 Sep 202413 Oct 2025
96wellspaintservice.comGoDaddy.com, LLC14 Feb 20095 Sep 202214 Feb 2026
97wellspacerooms.comregister.com, Inc.24 Jun 201225 May 202324 Jun 2025
98wellspannursing.comCSC Corporate Domains, Inc.2 May 200618 May 20232 May 2026
99wellspanlab.comCSC Corporate Domains, Inc.17 May 201013 May 202417 May 2025
100wellspaandsalon.comDomain.com, LLC7 Dec 200917 Nov 20247 Dec 2025
101wellspacenh.comGoDaddy.com, LLC14 Apr 202314 Apr 202314 Apr 2024
102wellspa-beauty.comHetzner Online AG27 Apr 20108 Feb 202527 Apr 2025
103wellspaclinic.comregister.com, Inc.5 Nov 20045 Nov 20045 Nov 2017
104wellspaces.comGoDaddy.com, LLC30 Jun 202113 Jul 202430 Jun 2025
105wellspacific.comGoDaddy.com, LLC13 Jan 201113 Jan 202413 Jan 2026
106wellspacehealth.comGoDaddy.com, LLC14 Nov 201211 Dec 202410 Dec 2025
107wellspanwellness.comCSC Corporate Domains, Inc.27 Mar 201423 Mar 202527 Mar 2026
108wellspanked.comTurnCommerce, Inc. DBA NameBright.com2 Jan 201727 Dec 20202 Jan 2025
109wellspaceonline.comGoDaddy.com, LLC22 Jan 201122 Jan 202522 Jan 2026
110wellspanlabs.comCSC Corporate Domains, Inc.12 Aug 201018 May 202312 Aug 2025
111wellspacontest.comDomain.com, LLC22 Mar 20072 Mar 202522 Mar 2026
112wellspackard.comGoDaddy.com, LLC9 Dec 199910 Dec 20249 Dec 2025
113wellspasuites.comGoDaddy.com, LLC28 Mar 20079 Mar 202528 Mar 2026
114wellspace.comGoDaddy.com, LLC25 Sep 199624 Sep 202424 Sep 2025
115wellspacedtrees.comRegister.ca Inc.24 Dec 201018 Nov 202424 Dec 2025
116wellspauc.comGoDaddy.com, LLC27 Apr 201328 Apr 201627 Apr 2017
117wellspacela.comGoDaddy.com, LLC26 Sep 201226 Sep 201626 Sep 2018
118wellspaceroanoke.comGoDaddy.com, LLC17 May 201018 May 202417 May 2029
119wellspaced.comTucows Domains Inc.31 Mar 200816 Mar 202531 Mar 2026
120wellspalv.comDomain.com, LLC6 Sep 200617 Aug 20246 Sep 2025
121wellspaus.com-5 Sep 20236 Sep 20245 Sep 2025
122wellspanlabservices.comCSC Corporate Domains, Inc.13 May 201018 May 202313 May 2025
123wellsparalegal.comGoDaddy.com, LLC4 Apr 20115 Apr 20254 Apr 2026
124wellspackaging.comDropCatch.com 1237 LLC2 Nov 20172 Nov 20172 Nov 2018
125wellspacenow.comGoogle, Inc.13 Feb 202222 Mar 202413 Feb 2024
126wellspan.comCSC Corporate Domains, Inc.11 Apr 200030 Mar 202311 Apr 2027
127wellspanadams.comDropCatch.com 734 LLC6 Oct 20186 Oct 20186 Oct 2019
128wellspamadrid.comInterdominios, Inc.15 Jan 20101 Jan 201715 Jan 2018
129wellspacesacramento.comGoDaddy.com, LLC13 Dec 201211 Dec 202410 Dec 2025
130wellspaintings.comGoDaddy.com, LLC29 Oct 200430 Oct 202429 Oct 2025
131wellspankedman.comDynadot, LLC13 Sep 202223 Nov 202313 Sep 2023
132wellsparts.comNom-iq Ltd. dba COM LAUDE26 Oct 20109 Mar 202526 Oct 2026
133wellspark.comMarkMonitor Inc.24 Nov 202027 Feb 202524 Nov 2027
134wellspankyou.com1&1 Internet AG26 Aug 200926 Aug 201626 Aug 2018
135wellspavingservices.comGoDaddy.com, LLC24 Oct 201316 Jan 202524 Oct 2025
136wellspas.com-17 Jul 200721 Dec 202417 Jul 2026
137wellspansportsmedicine.comCSC Corporate Domains, Inc.15 Dec 201018 May 202315 Dec 2025
138wellspancare.infoNetwork Solutions, LLC8 Apr 201416 Feb 20168 Apr 2018
139wellspace.infoAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…1 Mar 20241 Mar 20251 Mar 2026
140wellspatent.infoGoDaddy.com, LLC25 Jun 201326 Jun 201725 Jun 2018
141wellspace.mobiGoDaddy.com, LLC13 Jan 201127 Feb 202513 Jan 2026
142wellspaformen.comJiangsu Bangning Science and technology Co. Ltd.19 Dec 201919 Dec 201919 Dec 2020
143wellspanadams.netNetwork Solutions, LLC18 Jul 200728 Jun 201718 Jul 2018
144wellspackaging.netGoDaddy.com, LLC15 Aug 201227 Sep 201315 Aug 2017
145wellspacesacramento.netGoDaddy.com, LLC13 Dec 201211 Dec 202410 Dec 2025
146wellspacehealth.netGoDaddy.com, LLC13 Dec 201211 Dec 202410 Dec 2025
147wellspancare.netCSC Corporate Domains, Inc.10 Mar 20006 Mar 202510 Mar 2026
148wellspatent.netGoDaddy.com, LLC25 Jun 201326 Jun 201625 Jun 2017
149wellspan.netCSC Corporate Domains, Inc.18 Apr 200030 Mar 202318 Apr 2025
150wellspanwellness.orgCSC Corporate Domains, Inc.27 Mar 201428 Mar 202527 Mar 2026
151wellspace.orgGoDaddy.com, LLC13 Dec 201216 Dec 202413 Dec 2025
152wellspainting.orgTucows Domains Inc.9 May 201410 Apr 20259 May 2026
153wellspannursing.orgCSC Corporate Domains, Inc.2 May 200623 May 20232 May 2025
154wellspancommunity.orgCSC Corporate Domains, Inc.14 Nov 201115 Nov 202414 Nov 2025
155wellspacesacramento.orgGoDaddy.com, LLC14 Jan 201328 Feb 202514 Jan 2026
156wellspaneap.orgCSC Corporate Domains, Inc.13 Feb 200214 Feb 202513 Feb 2026
157wellspancareers.orgCSC Corporate Domains, Inc.8 Jul 200323 May 20238 Jul 2025
158wellspancare.orgCSC Corporate Domains, Inc.10 Mar 200011 Mar 202510 Mar 2026
159wellspansecure.orgCSC Corporate Domains, Inc.28 Dec 200029 Dec 202428 Dec 2025
160wellspanhealth.orgCSC Corporate Domains, Inc.1 Nov 19992 Nov 20241 Nov 2025
161wellspacesuicideprevention.orgGoDaddy.com, LLC25 Feb 201326 Feb 202525 Feb 2026
162wellspanftp.org1&1 Internet AG17 Sep 200720 Oct 201717 Sep 2018
163wellspanlab.orgCSC Corporate Domains, Inc.17 May 201018 May 202417 May 2025
164wellspanadams.orgNetwork Solutions, LLC18 Jul 200728 Jun 201718 Jul 2018
165wellspatent.orgGoDaddy.com, LLC25 Jun 201326 Jun 201725 Jun 2018
166wellspansportsmedicine.orgCSC Corporate Domains, Inc.15 Dec 201023 May 202315 Dec 2025
167wellspan-secure.orgSafeNames Ltd.7 May 200410 Jul 20237 May 2026
168wellspanlabservices.orgCSC Corporate Domains, Inc.13 May 201023 May 202313 May 2025
169wellspanhealth.xyzNameCheap, Inc.3 Jun 201629 Jun 20163 Jun 2017
170wellspacandle.eu----
171wellspainting.netSquarespace Domains LLC21 Feb 20234 Apr 202521 Feb 2025
172wellspainting.bizGoDaddy.com, LLC29 Aug 202310 Oct 202429 Aug 2024
173wellspaevents.com-2 Nov 20162 Nov 20162 Nov 2019
174wellspartnerportal.comCloudFlare, Inc.8 Nov 201618 Oct 20248 Nov 2025
175wellspacetherapies.comGoDaddy.com, LLC7 Nov 20167 Nov 20167 Nov 2018
176wellsparker.comInfomaniak Network SA14 Nov 20164 Nov 202414 Nov 2025
177wellspacefoundation.comPromo People inc.24 Nov 201617 Nov 201724 Nov 2018
178wellspainters.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Nov 201620 Nov 201723 Nov 2018
179wellspacehealth.infoNameCheap, Inc.30 Nov 201630 Nov 201730 Nov 2018
180wellspanphilhaven.orgCSC Corporate Domains, Inc.10 Dec 201620 Aug 202315 Aug 2033
181wellspaccehealth.orgTucows Domains Inc.19 Dec 201623 Dec 201719 Dec 2018
182wellspacetravel.comGoDaddy.com, LLC15 Jan 201715 Jan 201715 Jan 2019
183wellsparkplace.comTucows Domains Inc.17 Jan 201719 Dec 202417 Jan 2026
184wellspanportal.orgGoDaddy.com, LLC24 Jan 20175 Sep 201724 Jan 2018
185wellspace-co.comGoDaddy.com, LLC7 Feb 20177 Feb 20177 Feb 2019
186wellspancarelink.orgCSC Corporate Domains, Inc.8 Feb 20179 Feb 20258 Feb 2026
187wellspancarelink.comCSC Corporate Domains, Inc.7 Feb 20174 Feb 20258 Feb 2026
188wellspayfargo.comeNom, Inc.12 Feb 201717 Jan 201812 Feb 2018
189wellsparks.comTurnCommerce, Inc. DBA NameBright.com4 May 201912 Feb 20254 May 2025
190wellspangme.orgCSC Corporate Domains, Inc.28 Mar 201729 Mar 202528 Mar 2026
191wellspangme.comCSC Corporate Domains, Inc.28 Mar 201724 Mar 202528 Mar 2026
192wellspace.spaceNameCheap, Inc.3 Dec 202412 Dec 20243 Dec 2025
193wellspaces.netGoDaddy.com, LLC3 Apr 20172 Oct 20223 Apr 2027
194wellspaces.orgGoDaddy.com, LLC3 Apr 201718 Jul 20243 Apr 2027
195wellspace.liveAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…7 Apr 20179 Oct 20177 Apr 2018
196wellspanephrata.orgGoDaddy.com, LLC11 Apr 201711 Apr 201711 Apr 2018
197wellspark.coNameCheap, Inc.22 Jul 202227 Jun 202422 Jul 2025
198wellspanphilhaven.comNetwork Solutions, LLC21 Apr 20179 Dec 201721 Apr 2018
199wellspacemarin.comWild West Domains, LLC26 May 201726 May 201726 May 2018
200wellspacio.comGoDaddy.com, LLC5 Jun 20175 Jun 20175 Jun 2018
201wellspacedayton.comGoDaddy.com, LLC7 Jun 20177 Jun 20177 Jun 2019
202wellsparadise.comGoDaddy.com, LLC8 Jun 20179 Jun 20238 Jun 2025
203wellspanmedicaleducation.comCSC Corporate Domains, Inc.12 Jun 201730 May 202312 Jun 2028
204wellspanmedicaleducation.orgCSC Corporate Domains, Inc.12 Jun 20175 Jun 202312 Jun 2028
205wellspavingpa.comGoDaddy.com, LLC16 Jun 201728 Jul 202316 Jun 2023
206wellspanretirement.comGoDaddy.com, LLC27 Mar 202010 Apr 202527 Mar 2026
207wellspanpophealth.orgCSC Corporate Domains, Inc.3 Jul 201723 May 20233 Jul 2025
208wellspanonlineurgentcare.comCSC Corporate Domains, Inc.6 Jul 201718 May 20236 Jul 2025
209wellspanurgentcare.comCSC Corporate Domains, Inc.6 Jul 201718 May 20236 Jul 2025
210wellspanonlineurgentcare.orgCSC Corporate Domains, Inc.6 Jul 201723 May 20236 Jul 2025
211wellspanurgentcare.orgCSC Corporate Domains, Inc.6 Jul 201723 May 20236 Jul 2025
212wellspaceholistic.comHostinger, UAB25 Jul 201726 Nov 202325 Jul 2025
213wellspacecenter.comDomain.com, LLC25 Jul 201725 Jul 201725 Jul 2018
214wellspaceholistichealth.comHostinger, UAB25 Jul 201728 Jun 202425 Jul 2025
215wellspaceacupuncture.comDomain.com, LLC25 Jul 201725 Jul 201725 Jul 2018
216wellspamn.netNetwork Solutions, LLC17 Aug 201717 Aug 201716 Aug 2018
217wellspam.orgDynadot, LLC28 Aug 20171 Sep 202428 Aug 2025
218wellspanpophealth.comCSC Corporate Domains, Inc.31 Aug 201718 May 202331 Aug 2026
219wellsparts.netNom-iq Ltd. dba COM LAUDE1 Sep 20179 Mar 20251 Sep 2026
220wellspanphilhaven.netNetwork Solutions, LLC6 Sep 20176 Sep 20176 Sep 2018
221wellspacehr.comTucows Domains Inc.19 Sep 201723 Sep 201919 Sep 2019
222wellspana.comTucows Domains Inc.21 Sep 201725 Sep 201821 Sep 2018
223wellspaan.orgDynadot, LLC30 Sep 201730 Sep 201730 Sep 2018
224wellspaph.comHostinger, UAB7 Oct 20177 Oct 20177 Oct 2018
225wellspanemployerservices.orgCSC Corporate Domains, Inc.6 Nov 20177 Nov 20246 Nov 2025
226wellspanemployerservices.comCSC Corporate Domains, Inc.6 Nov 20172 Nov 20246 Nov 2025
227wellspacebodywork.comPDR Ltd. d/b/a PublicDomainRegistry.com12 Dec 201712 Dec 202412 Dec 2025
228wellspain.comTurnCommerce, Inc. DBA NameBright.com7 Feb 202021 Mar 20257 Feb 2025
229wellspark.org.ukReserved19 Aug 200919 Aug 201719 Aug 2019
230wellspacetherapies.uk-7 Nov 201623 Oct 20177 Nov 2018
231wellspages.co.uk-16 Nov 200016 Nov 202416 Nov 2025
232wellspacecommunications.co.ukYour Domain LLC28 Jun 201730 Nov 201728 Jun 2018
233wellspark.co.uk-19 Nov 20016 Dec 201719 Nov 2018
234wellsparkprimary-sch.org.ukeNom, Inc.27 Apr 201322 Sep 201627 Apr 2020
235wellsparky.co.uk-11 Jul 201327 Jun 201611 Jul 2019
236wellsparkpractice.co.uk-18 Jan 200619 Dec 202418 Jan 2026
237wellspages.ukFreeparking Domain Registrars, Inc.21 Aug 201721 Aug 201721 Aug 2019
238wellspartners.co.uk-4 Nov 202420 Nov 20244 Nov 2025
239wellspatservices.co.ukReserved12 Jan 20102 Mar 201712 Jan 2018
240wellsparkplace.co.uk-17 Jan 201722 Mar 201717 Jan 2019
241wellsparetreat.co.uk-1 Sep 201430 Aug 20161 Sep 2018
242wellspace.co.uk-9 Aug 201110 Jul 20179 Aug 2018
243wellspace.onlineHostinger, UAB17 Oct 202419 Nov 202417 Oct 2026
244wellspacemd.comPromo People inc.25 Feb 201818 Feb 202525 Feb 2026
245wellspaceutah.comNameCheap, Inc.1 Mar 20181 Feb 20241 Mar 2027
246wellspace.org.ukLCN.COM Ltd.13 Jan 202126 Jan 202513 Jan 2026
247wellspaced.netTucows Domains Inc.22 Mar 201826 Mar 202522 Mar 2026
248wellspanway.comNetwork Solutions, LLC28 Mar 201828 Mar 201828 Mar 2020
249wellsparkboutique.comTucows Domains Inc.7 Apr 20187 Apr 20187 Apr 2019
250wellspanspecialists.comNetwork Solutions, LLC13 Apr 201813 Apr 201813 Apr 2020
251wellspartyof2.lifeAutomattic Inc.23 Apr 201828 Apr 201823 Apr 2019
252wellspacenyc.comGoogle, Inc.4 May 20184 May 20184 May 2019
253wellspartyof5.comAutomattic Inc.15 May 201827 Jun 202415 May 2024
254wellspaceretreats.comTucows Domains Inc.26 May 201822 May 202426 May 2025
255wellspa305.comGoDaddy.com, LLC15 Jun 201815 Jun 202415 Jun 2026
256wellspavingnj.com-5 Dec 202228 Dec 20245 Dec 2024
257wellspacestatic.comNameCheap, Inc.13 Jul 201813 Jul 201813 Jul 2019
258wellspacemail.comNameCheap, Inc.13 Jul 201813 Jul 201813 Jul 2019
259wellspanephratahospital.comCloud Yuqu LLC12 Apr 202012 Apr 202012 Apr 2021
260wellspaonline.comWebfusion Ltd.30 Jul 201830 Jul 201830 Jul 2020
261wellspacexd.comGoDaddy.com, LLC8 Aug 20188 Aug 20188 Aug 2019
262wellspacebydelos.comDynadot, LLC24 Aug 201824 Aug 201824 Aug 2019
263wellspainting.infoGoDaddy.com, LLC21 Sep 201821 Sep 201821 Sep 2019
264wellspanforlife.comTucows Domains Inc.23 Sep 20188 Sep 202423 Sep 2025
265wellspacetx.comGoogle, Inc.4 Oct 20184 Oct 20184 Oct 2019
266wellspanheartfulness.comGoDaddy.com, LLC1 Nov 20181 Nov 20181 Nov 2019
267wellspaper.comGoDaddy.com, LLC6 Sep 202318 Oct 20246 Sep 2024
268wellspayoga.com1&1 Internet AG21 Nov 201821 Nov 201821 Nov 2019
269wellspamn.infoNetwork Solutions, LLC30 Dec 201830 Dec 201830 Dec 2019
270wellspang.de--15 Dec 2010-
271wellspan360.comGoogle, Inc.23 Jan 20199 Jan 202523 Jan 2026
272wellsparkhealth.comMarkMonitor Inc.25 Jan 201921 Feb 202525 Jan 2028
273wellsparkhealth.netMarkMonitor Inc.25 Jan 201927 Feb 202525 Jan 2027
274wellsparkhealth.bizMarkMonitor Inc.25 Jan 201927 Feb 202525 Jan 2027
275wellspago.comGabia, Inc.1 Feb 201925 Jan 20231 Feb 2026
276wellspandna.comTucows Domains Inc.13 Feb 201917 Feb 202013 Feb 2020
277wellsparlor.comCloudFlare, Inc.18 Feb 201917 Mar 202518 Feb 2026
278wellsparkorthodontics.comeNom, Inc.22 Feb 201924 Jan 202522 Feb 2026
279wellspamarketing.comGoDaddy.com, LLC15 Aug 202415 Aug 202415 Aug 2025
280wellspaconnect.comGoDaddy.com, LLC4 Apr 20195 Apr 20254 Apr 2026
281wellspaceacademy.comGoDaddy.com, LLC5 Apr 20195 Apr 20195 Apr 2020
282wellsparkhealthcare.comMarkMonitor Inc.18 Apr 201927 Feb 202518 Apr 2027
283wellspark.netMarkMonitor Inc.4 Jul 202027 Feb 20254 Jul 2027
284wellsparkheathcare.comMarkMonitor Inc.28 Jun 202027 Feb 202528 Jun 2027
285wellspark.bizMarkMonitor Inc.17 Apr 201927 Feb 202517 Apr 2027
286wellspacebehavioralhealth.comGoDaddy.com, LLC2 May 20192 May 20242 May 2025
287wellspacecommunity.comGoDaddy.com, LLC3 May 20193 May 20193 May 2020
288wellspanmedicalequipment.comCSC Corporate Domains, Inc.21 Feb 201817 Feb 202521 Feb 2026
289wellspacenters.comGoDaddy.com, LLC14 May 20197 Sep 202414 May 2025
290wellspaceuk.comWebfusion Ltd.14 Jun 201914 Jun 201914 Jun 2021
291wellspawellspa.comDynadot, LLC4 Jul 20194 Jul 20194 Jul 2020
292wellspanmd.comGoDaddy.com, LLC8 Jul 20198 Jul 20198 Jul 2021
293wellspaceproperty.comTucows Domains Inc.13 Jul 201913 Jul 201913 Jul 2020
294wellspaceproperties.comGoDaddy.com, LLC13 Apr 202513 Apr 202513 Apr 2026
295wellspass.comBigRock Solutions Ltd.24 Jul 201924 Jul 201924 Jul 2020
296wellspankb.comGoDaddy.com, LLC11 Aug 201911 Aug 201911 Aug 2020
297wellspankb.netGoDaddy.com, LLC11 Aug 201911 Aug 201911 Aug 2020
298wellspanccmloan.comGoDaddy.com, LLC15 Aug 201916 Aug 202415 Aug 2025
299wellspanmedical.comNetwork Solutions, LLC20 Aug 201920 Jun 202420 Aug 2029
300wellspacecafe.comGoDaddy.com, LLC6 Sep 20196 Sep 20196 Sep 2020
301wellspacetherapy.comGoDaddy.com, LLC27 Sep 20191 Oct 202327 Sep 2025
302wellspacemaine.comGoDaddy.com, LLC28 Sep 20191 Sep 202428 Sep 2025
303wellspade.comGoDaddy.com, LLC2 Oct 20192 Oct 20192 Oct 2020
304wellspabox.comTurnCommerce, Inc. DBA NameBright.com30 Jan 202324 Jan 202430 Jan 2025
305wellspabox.netGoDaddy.com, LLC12 Nov 201912 Nov 201912 Nov 2021
306wellspanbeingwell.comGoDaddy.com, LLC12 Nov 201913 Nov 202412 Nov 2025
307wellspacecounselling.comGoDaddy.com, LLC8 Dec 20199 Dec 20238 Dec 2025
308wellspacetherapeutics.comWix.com Ltd.10 Jan 202023 Jun 202410 Jan 2026
309wellspacema.comGoogle, Inc.15 Jan 202015 Jan 202015 Jan 2021
310wellspajax.comGoDaddy.com, LLC18 Jan 202019 Jan 202518 Jan 2026
311wellspaceottawa.comGoogle, Inc.22 Jan 202022 Jan 202022 Jan 2021
312wellspamagazine.comDreamHost, LLC22 Jan 202022 Dec 202422 Jan 2026
313wellspam.comDropCatch.com 953 LLC28 Apr 202329 Apr 202328 Apr 2025
314wellspacearchitects.comTucows Domains Inc.27 Jan 20206 Jan 202527 Jan 2026
315wellspace.companyGoDaddy.com, LLC29 Jan 202011 Mar 202429 Jan 2024
316wellspaceco.comGoDaddy.com, LLC2 Feb 202015 Apr 20232 Feb 2023
317wellspans.comGoDaddy.com, LLC12 Apr 202312 Apr 202312 Apr 2024
318wellspannr.comDreamHost, LLC11 Feb 202011 Feb 202011 Feb 2021
319wellspanner.comDreamHost, LLC11 Feb 202025 Mar 202411 Feb 2024
320wellspavingservices1.comName.com, Inc.13 Feb 202013 Feb 202013 Feb 2021
321wellspavingservices2.comName.com, Inc.13 Feb 202013 Feb 202013 Feb 2021
322wellspacepdx.comTucows Domains Inc.7 Mar 20206 Mar 20257 Mar 2026
323wellspan401k.comGoDaddy.com, LLC27 Mar 202010 Apr 202527 Mar 2026
324wellspantogether.comCSC Corporate Domains, Inc.31 Mar 202016 Apr 202331 Mar 2026
325wellspacesd.comGoDaddy.com, LLC31 Mar 202031 Mar 202031 Mar 2021
326wellspanlove.comCSC Corporate Domains, Inc.31 Mar 20201 May 202331 Mar 2026
327wellspanoptions.comPDR Ltd. d/b/a PublicDomainRegistry.com2 Apr 202027 Mar 20242 Apr 2026
328wellspanheros.comCSC Corporate Domains, Inc.8 Apr 20201 May 20238 Apr 2026
329wellspay.bizGoDaddy.com, LLC7 Apr 202013 Apr 20257 Apr 2030
330wellspartners.businessNameCheap, Inc.13 Apr 202013 Apr 202013 Apr 2021
331wellspaceredwillow.comGoDaddy.com, LLC15 Apr 202029 Apr 202415 Apr 2025
332wellspan.doctorGo France Domains, LLC2 Nov 201617 Dec 20242 Nov 2025
333wellspace.nycGoDaddy.com, LLC5 May 201810 May 20185 May 2020
334wellspacecounselingpdx.comTucows Domains Inc.17 May 202016 May 202417 May 2025
335wellspacedplace.comRegister.it SPA17 Jun 202017 Jun 202017 Jun 2021
336wellspargoauto.comGoDaddy.com, LLC25 Jun 202025 Jun 202025 Jun 2021
337wellspanish.comLaunchpad, Inc.26 Jun 202026 Jun 202026 Jun 2021
338wellsparkheath.comMarkMonitor Inc.6 Sep 202127 Feb 20256 Sep 2027
339wellspanked.onlineGoDaddy.com, LLC5 Jul 20205 Jul 20205 Jul 2021
340wellspavementgroup.comGoDaddy.com, LLC31 Jul 202031 Jul 202031 Jul 2021
341wellspanwarmline.comeNom, Inc.17 Aug 202029 Sep 202317 Aug 2023
342wellspabox.infoGoDaddy.com, LLC12 Nov 201911 Jan 202012 Nov 2021
343wellsparkhealth.infoMarkMonitor Inc.25 Jan 201927 Feb 202525 Jan 2027
344wellspark.infoMarkMonitor Inc.17 Apr 201927 Feb 202517 Apr 2027
345wellspaceorg.comGoogle, Inc.29 Sep 202029 Sep 202029 Sep 2021
346wellspaceatwork.comGoDaddy.com, LLC2 Oct 20203 Oct 20242 Oct 2025
347wellspaceagency.comGoDaddy.com, LLC9 Oct 202010 Oct 20249 Oct 2025
348wellspacetowork.comGoDaddy.com, LLC10 Oct 202010 Oct 202010 Oct 2021
349wellspanportal.comNameKing.com Inc.26 Feb 202211 Apr 202526 Feb 2025
350wellspanhealthmedbridgego.comDNSPod, Inc.29 Oct 202029 Oct 202029 Oct 2021
351wellsparhealth.comNameCheap, Inc.9 Dec 20249 Dec 20249 Dec 2025
352wellsparkhalth.comGoDaddy.com, LLC24 Mar 202324 Mar 202324 Mar 2024
353wellsparkhelth.comGoDaddy.com, LLC12 Apr 202312 Apr 202312 Apr 2024
354wellspakhealth.comNameCheap, Inc.4 Dec 20244 Dec 20244 Dec 2025
355wellsparkhealt.comGoDaddy.com, LLC21 Mar 202321 Mar 202321 Mar 2024
356wellsparkhelath.comNameCheap, Inc.4 Dec 20244 Dec 20244 Dec 2025
357wellsparkhealh.comNameCheap, Inc.9 Dec 20249 Dec 20249 Dec 2025
358wellspanfpleb.comTucows Domains Inc.16 Nov 202015 Nov 202416 Nov 2025
359wellspacevalpo.comGoDaddy.com, LLC29 Nov 202010 Feb 202429 Nov 2023
360wellspacehealthmd.comGoogle, Inc.7 Dec 20207 Dec 20207 Dec 2021
361wellspace.designGoDaddy.com, LLC8 Dec 202019 Jan 20258 Dec 2024
362wellspacenexus.comGoDaddy.com, LLC9 Dec 202027 Nov 202310 Dec 2025
363wellspacenexus.netGoDaddy.com, LLC9 Dec 202027 Nov 202310 Dec 2025
364wellspaceshop.comGoDaddy.com, LLC14 Dec 202025 Jan 202414 Dec 2023
365wellspacespk.comGoDaddy.com, LLC23 Dec 202023 Dec 202023 Dec 2021
366wellspa78.onlineBeget LLC28 Dec 202028 Dec 202028 Dec 2021
367wellspa77.onlineBeget LLC28 Dec 202028 Dec 202028 Dec 2021
368wellspanegreeting.comGoDaddy.com, LLC4 Jan 20214 Jan 20214 Jan 2022
369wellspar.comGoDaddy.com, LLC8 Jan 20219 Jan 20258 Jan 2026
370wellspalms.comGoogle, Inc.23 Jan 20218 Jan 202523 Jan 2026
371wellspaexpo.comDreamHost, LLC27 Jan 202127 Dec 202427 Jan 2026
372wellspamedia.comDreamHost, LLC27 Jan 202127 Dec 202427 Jan 2026
373wellspaconference.comDreamHost, LLC27 Jan 202127 Dec 202427 Jan 2026
374wellspamhealth.comNameCheap, Inc.5 Feb 2021-5 Feb 2022
375wellspavingservices3.comName.com, Inc.5 Feb 202121 Mar 20255 Feb 2025
376wellspacecreative.comGoogle, Inc.11 Feb 202111 Feb 202111 Feb 2022
377wellspayments.comPDR Ltd. d/b/a PublicDomainRegistry.com18 Feb 202118 Feb 202518 Feb 2026
378wellspa360.comDreamHost, LLC9 Mar 20216 Feb 20259 Mar 2026
379wellspaceperth.comGoDaddy.com, LLC10 Mar 202110 Mar 202110 Mar 2022
380wellspace.clubGoDaddy.com, LLC23 Mar 202123 Mar 202123 Mar 2022
381wellspanvisitpay.comDynadot, LLC4 Apr 20214 Apr 20254 Apr 2026
382wellspa360expo.comDreamHost, LLC5 Apr 20215 Mar 20255 Apr 2026
383wellspanqualityforum.comCSC Corporate Domains, Inc.11 Apr 20238 Apr 202512 Apr 2026
384wellspacellc.netGoogle, Inc.27 Apr 202128 Apr 202327 Apr 2024
385wellspacellc.comGoDaddy.com, LLC6 Oct 20246 Oct 20246 Oct 2025
386wellspaced.lifeHosting Concepts B.V. dba Openprovider30 Apr 202130 Apr 202330 Apr 2024
387wellspaceclub.comSquarespace Domains LLC10 May 202410 May 202410 May 2025
388wellspavingllc.comGoogle, Inc.20 May 202118 May 202420 May 2026
389wellspacenz.comGoDaddy.com, LLC20 Jun 202116 Oct 202320 Jun 2025
390wellspage.comGoDaddy.com, LLC25 Jun 202124 Jun 202125 Jun 2022
391wellspaceminers.comHostinger, UAB29 Jun 202129 Jun 202129 Jun 2022
392wellspahome.comGransy s.r.o. d/b/a subreg.cz7 Sep 202317 Oct 20247 Sep 2024
393wellsparkportfolio.comeNom, Inc.13 Jul 202113 Jul 202113 Jul 2022
394wellspartner.comTucows Domains Inc.19 Jul 202129 Sep 202319 Jul 2023
395wellspanguide.comGoDaddy.com, LLC6 Aug 20216 Aug 20216 Aug 2022
396wellspageband.comGoogle, Inc.2 Sep 202118 Aug 20242 Sep 2025
397wellspacetv.infoGoDaddy.com, LLC4 Sep 20214 Sep 20214 Sep 2022
398wellspacetv.comGoDaddy.com, LLC4 Sep 20214 Sep 20214 Sep 2022
399wellspan.lifeNameCheap, Inc.20 Apr 202520 Apr 202520 Apr 2026
400wellspangroup.comGoDaddy.com, LLC25 Sep 202125 Sep 202125 Sep 2022
401wellspanpatientportal.comeNom, Inc.2 Jan 20232 Jan 20232 Jan 2024
402wellspaceaz.comGoDaddy.com, LLC20 Oct 20211 Jan 202420 Oct 2023
403wellspacemh.comGoDaddy.com, LLC25 Oct 20215 Dec 202325 Oct 2023
404wellspaceholdings.comGoDaddy.com, LLC25 Oct 20215 Dec 202325 Oct 2023
405wellspacemobilehomes.comGoDaddy.com, LLC25 Oct 20215 Dec 202325 Oct 2023
406wellspaceos.comGoogle, Inc.4 Nov 20215 Nov 20234 Nov 2024
407wellspages.comTurnCommerce, Inc. DBA NameBright.com13 Mar 202214 Apr 202413 Mar 2024
408wellspago.co.kr-1 Feb 20191 Feb 20191 Feb 2023
409wellspandigitalads.comTucows Domains Inc.1 Dec 202116 Nov 20241 Dec 2025
410wellspaceinstitute.comGoDaddy.com, LLC8 Dec 20218 Dec 20218 Dec 2031
411wellsparkapts.comGoDaddy.com, LLC17 Dec 20215 Oct 202217 Dec 2027
412wellsparkliving.comGoDaddy.com, LLC17 Dec 20215 Oct 202217 Dec 2027
413wellspanassessments.netGoDaddy.com, LLC20 Dec 202131 Jan 202520 Dec 2024
414wellsparkjobs.comMarkMonitor Inc.11 Jan 202227 Feb 202511 Jan 2027
415wellsparkhealthjobs.comMarkMonitor Inc.11 Jan 202227 Feb 202511 Jan 2027
416wellspanlife.comGoDaddy.com, LLC17 Feb 202231 Mar 202317 Feb 2023
417wellsparq.storeCrazy Domains FZ-LLC20 Feb 202217 Feb 202520 Feb 2026
418wellsparq.comTucows Domains Inc.20 Feb 202210 Feb 202320 Feb 2029
419wellspage.infoNameCheap, Inc.25 Feb 20228 May 202325 Feb 2023
420wellspavingllcpa.comTucows Domains Inc.3 Mar 20222 Feb 20253 Mar 2026
421wellspaving-nj.comAutomattic Inc.2 May 202214 Apr 20242 May 2025
422wellspacenw.comGoDaddy.com, LLC11 May 202212 May 202411 May 2026
423wellsparqbytitanhalo.comDynadot, LLC17 May 202218 May 202317 May 2024
424wellsparrows.comNameCheap, Inc.16 Feb 202412 Feb 202516 Feb 2026
425wellspace.lifeGoDaddy.com, LLC17 Apr 202517 Apr 202517 Apr 2026
426wellspaceit.comNameCheap, Inc.6 Jun 20227 May 20246 Jun 2025
427wellspark.emailNetwork Solutions, LLC17 Jun 202229 Aug 202417 Jun 2024
428wellspacegyms.comGoDaddy.com, LLC22 Jun 20223 Aug 202422 Jun 2024
429wellspanmedicalequip.comKey-Systems GmbH6 Jul 20226 Jul 20226 Jul 2023
430wellspanvideos.comTucows Domains Inc.2 Aug 202218 Jul 20242 Aug 2025
431wellspathway.comGoDaddy.com, LLC4 Aug 202214 Sep 20244 Aug 2024
432wellspark.digitalNameCheap, Inc.10 Aug 202221 Sep 202310 Aug 2023
433wellsparkdigital.comNameCheap, Inc.10 Aug 202222 Oct 202310 Aug 2023
434wellspace-penarth.orgMesh Digital Limited15 Aug 202228 Oct 202315 Aug 2023
435wellspace-penarth.comWebfusion Ltd.15 Aug 202226 Sep 202415 Aug 2024
436wellspacedesigns.comSquarespace Domains LLC15 Aug 202212 Jun 202415 Aug 2026
437wellspace-penarth.uk-15 Aug 202220 Aug 202315 Aug 2023
438wellspace-penarth.co.uk-15 Aug 202228 Jun 202415 Aug 2024
439wellspacect.comSquarespace Domains LLC27 Oct 202112 Oct 202427 Oct 2025
440wellspark.xyzNameCheap, Inc.1 Sep 202213 Nov 20241 Sep 2025
441wellspanusa.orgPorkbun, LLC1 Sep 202212 Sep 20231 Sep 2024
442wellspaymentserror.comHosting Concepts B.V. dba Openprovider31 Aug 202211 Nov 202331 Aug 2023
443wellsparrow.co.uk-5 Sep 20225 Sep 20225 Sep 2023
444wellspaceaustralia.comSynergy Wholesale Pty Ltd7 Sep 202223 Aug 20247 Sep 2025
445wellspace4educators.comFastDomain Inc.7 Sep 202221 Oct 20247 Sep 2024
446wellspanbenefits.orgCSC Corporate Domains, Inc.14 Sep 202215 Sep 202414 Sep 2025
447wellspace.worldTucows Domains Inc.16 Sep 202223 Jun 202416 Sep 2025
448wellspace.oneGoDaddy.com, LLC16 Sep 202210 Jun 202416 Sep 2027
449wellspaces.co.uk-24 Sep 202225 Sep 202424 Sep 2026
450wellspanliving.comWix.com Ltd.21 Sep 202125 Sep 202221 Sep 2022
451wellspanorthopedics.comKey-Systems GmbH19 Oct 20221 Jan 202419 Oct 2023
452wellspanhealthembassy.comGoDaddy.com, LLC21 Oct 202221 Oct 202221 Oct 2027
453wellspabenefits.orgCosmotown, Inc.29 Oct 202230 Oct 202329 Oct 2024
454wellspanbenefit.orgCosmotown, Inc.29 Oct 202230 Oct 202429 Oct 2025
455wellspanbenfits.orgCosmotown, Inc.29 Oct 202230 Oct 202329 Oct 2024
456wellspanbenifits.orgDynadot, LLC29 Oct 202229 Dec 202429 Oct 2025
457wellspanbenefits.com-29 Oct 202224 Sep 202329 Oct 2025
458wellspacebed.comIHS Telekom, Inc.31 Oct 20221 Nov 202431 Oct 2025
459wellspacepsychiatry.netGoDaddy.com, LLC9 Nov 202210 Nov 20249 Nov 2026
460wellspacepsychiatry.comGoDaddy.com, LLC9 Nov 202210 Nov 20249 Nov 2026
461wellsparkindustries.comeNom, Inc.23 Nov 202213 Nov 202423 Nov 2025
462wellspanspecialists.orgNameCheap, Inc.2 Dec 202216 Jan 20252 Dec 2025
463wellspark.kr-12 Jan 202012 Mar 202012 Jan 2024
464wellspan.onlineCommuniGal Communication Ltd.12 Feb 202423 Mar 202512 Feb 2025
465wellspaandmassage.comGoDaddy.com, LLC19 Dec 202120 Dec 202419 Dec 2025
466wellspamn.onlineNetwork Solutions, LLC18 Dec 202229 Feb 202418 Dec 2023
467wellsparkstorage.co.uk-23 Dec 202223 Dec 202423 Dec 2025
468wellspanhealthpark.comGoogle, Inc.11 Jan 202322 Feb 202511 Jan 2025
469wellspanpark.comGoogle, Inc.11 Jan 202330 Dec 202411 Jan 2026
470wellspark.appMarkMonitor Inc.4 Aug 202027 Feb 20254 Aug 2027
471wellsparkhealth.appMarkMonitor Inc.4 Aug 202027 Feb 20254 Aug 2027
472wellspacerealty.comGoDaddy.com, LLC19 Jan 20232 Apr 202519 Jan 2025
473wellspace.directoryNameCheap, Inc.20 Jan 202328 Dec 202420 Jan 2026
474wellspacetherapy.orgGoDaddy.com, LLC27 Jan 202313 Mar 202527 Jan 2026
475wellspainting4.comGoDaddy.com, LLC31 Jan 202331 Jan 202531 Jan 2026
476wellsparty.comTierraNet Inc. d/b/a DomainDiscover1 Feb 202316 Nov 202431 Jan 2026
477wellspann.orgXin Net Technology Corporation31 Jan 20204 Feb 202331 Jan 2024
478wellspace.cloudGoogle, Inc.19 Aug 20209 Aug 202419 Aug 2025
479wellspaconcept.comGransy s.r.o. d/b/a subreg.cz9 Feb 202328 Jan 20259 Feb 2026
480wellspauniverse.comGransy s.r.o. d/b/a subreg.cz9 Feb 202328 Jan 20259 Feb 2026
481wellsparknewton.comGoDaddy.com, LLC8 Aug 201720 Oct 20238 Aug 2023
482wellsparkma.comGoDaddy.com, LLC8 Aug 201720 Oct 20238 Aug 2023
483wellspaanimation.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
484wellspaevent.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
485wellspafamily.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
486wellspafamilyhotel.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
487wellspafamilyresort.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
488wellspaholistic.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
489wellspagift.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
490wellspahotel.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
491wellspahotelconcept.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
492wellspainstitute.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
493wellsparesort.comGransy s.r.o. d/b/a subreg.cz17 Feb 20233 Feb 202517 Feb 2026
494wellspacetherapypa.comGoDaddy.com, LLC18 Feb 202313 Feb 202518 Feb 2026
495wellspakauai.comGoDaddy.com, LLC22 Nov 201713 Nov 202422 Nov 2025
496wellspace.uk-26 Feb 202311 Feb 202526 Feb 2026
497wellspaceny.comGoDaddy.com, LLC8 Jan 20188 Oct 20228 Jan 2028
498wellspaio.comWix.com Ltd.11 Aug 202411 Aug 202411 Aug 2025
499wellspavingllc.netGoDaddy.com, LLC13 Mar 202312 Feb 202513 Mar 2030
500wellspaservices.comGoDaddy.com, LLC27 Mar 20198 Apr 202327 Mar 2024
501wellspanmedicalservices.comNetwork Solutions, LLC20 Aug 201920 Jun 202420 Aug 2029
502wellspanmedicine.comNameCheap, Inc.25 Mar 202023 Feb 202525 Mar 2026
503wellspacewell.comWix.com Ltd.12 Feb 202116 Feb 202412 Feb 2025
504wellspaceinteriors.comSquarespace Domains LLC10 Mar 202110 May 202410 Mar 2024
505wellsparkvitals.comGoDaddy.com, LLC1 Apr 20212 Apr 20251 Apr 2026
506wellspanleadershipforum.comCSC Corporate Domains, Inc.28 Jun 202118 May 202328 Jun 2025
507wellspacepgh.comSquarespace Domains LLC4 Aug 202120 Jul 20244 Aug 2025
508wellsparkna.comWix.com Ltd.11 Aug 202112 Jul 202411 Aug 2025
509wellspacemke.comSquarespace Domains LLC18 Aug 202111 Sep 202418 Aug 2025
510wellspacemobile.comGoDaddy.com, LLC25 Oct 20215 Dec 202325 Oct 2023
511wellspacehomes.comGoDaddy.com, LLC25 Oct 20215 Dec 202325 Oct 2023
512wellspacesgroup.comGoDaddy.com, LLC25 Dec 202126 Dec 202425 Dec 2025
513wellsparrow.comSquarespace Domains LLC31 Dec 202116 Dec 202431 Dec 2025
514wellspacemi.comSquarespace Domains LLC30 Jan 202215 Jan 202530 Jan 2026
515wellspace.llcGoogle, Inc.27 Apr 202127 Apr 202327 Apr 2024
516wellspace.xyzGoDaddy.com, LLC5 Jun 201729 Aug 20245 Jun 2025
517wellspanest.comWix.com Ltd.14 Mar 202224 May 202414 Mar 2024
518wellspastore.comGransy s.r.o. d/b/a subreg.cz11 Apr 202310 Apr 202411 Apr 2025
519wellspassed.comGoDaddy.com, LLC8 May 202220 May 20238 May 2024
520wellspaceacu.comNetwork Solutions, LLC23 May 202223 May 202223 May 2025
521wellspaceacuherbs.comNetwork Solutions, LLC23 May 202223 May 202223 May 2025
522wellspacestl.comGoogle, Inc.10 Jun 20221 Jul 202410 Jun 2025
523wellspaeola.comGoDaddy.com, LLC29 Jun 202225 Jun 202329 Jun 2023
524wellspace.devGoogle, Inc.4 Nov 20215 Nov 20234 Nov 2024
525wellspacefoundation.netGoDaddy.com, LLC9 Dec 202011 Dec 202410 Dec 2025
526wellspashop.nl-19 Nov 202419 Feb 2025-
527wellspace4women.comGoDaddy.com, LLC25 Apr 202325 Apr 202425 Apr 2025
528wellspansavings.orgPDR Ltd. d/b/a PublicDomainRegistry.com15 Feb 20175 Feb 202515 Feb 2026
529wellspanmedicalequipment.orgCSC Corporate Domains, Inc.21 Feb 201822 Feb 202521 Feb 2026
530wellsparkhealth.orgMarkMonitor Inc.25 Jan 201927 Feb 202525 Jan 2027
531wellspanplasticsurgery.orgCSC Corporate Domains, Inc.14 Aug 202015 Aug 202414 Aug 2025
532wellsparkprimary-sch.orgHostinger, UAB15 Dec 202327 Feb 202515 Dec 2024
533wellspacefoundation.orgGoDaddy.com, LLC9 Dec 202023 Jan 20259 Dec 2025
534wellspacenexus.orgGoDaddy.com, LLC9 Dec 202013 Aug 20249 Dec 2025
535wellspacellc.orgGoogle, Inc.27 Apr 202127 Apr 202327 Apr 2024
536wellspanliveevents.orgCSC Corporate Domains, Inc.17 Sep 20215 Jun 202317 Sep 2025
537wellspaceinstitute.orgGoDaddy.com, LLC8 Dec 202114 Aug 20248 Dec 2031
538wellspanwellatwork.orgCSC Corporate Domains, Inc.21 Mar 202223 May 202321 Mar 2026
539wellspanyorkhospital.orgNameCheap, Inc.24 Mar 20228 Apr 202324 Mar 2024
540wellspace.pl-2 Jul 202417 Dec 20242 Jul 2025
541wellspacepsychology.com.au--9 Aug 2024-
542wellsparkr.com-3 May 20236 May 20243 May 2025
543wellspartyofeight.comAutomattic Inc.7 May 202317 Apr 20247 May 2025
544wellspaceconsulting.comWix.com Ltd.8 May 202323 Jun 20248 May 2025
545wellspanuniforms.comGoDaddy.com, LLC11 May 202311 May 202311 May 2028
546wellspaceuk.co.uk-14 Jun 201919 Jun 202314 Jun 2023
547wellspacebeauty.comGabia, Inc.5 Jun 20235 Aug 20245 Jun 2024
548wellspaiolaunch.comTucows Domains Inc.13 Jun 202324 Aug 202413 Jun 2024
549wellsparkling.comCloudFlare, Inc.20 Jun 202330 Jan 202520 Jun 2025
550wellspaceadvocacy.orgregister.com, Inc.22 Jun 20236 Aug 202422 Jun 2025
551wellspacehealth-merch.storeTucows Domains Inc.26 Jun 20235 Sep 202426 Jun 2024
552wellspacity.comGoDaddy.com, LLC26 Jun 202326 Jun 202326 Jun 2028
553wellspace.storeGoDaddy.com, LLC14 Jul 202325 Aug 202414 Jul 2024
554wellspar.orgNameCheap, Inc.19 Jul 202329 Sep 202419 Jul 2024
555wellspath.usNameCheap, Inc.6 Jul 20236 Jul 20246 Jul 2024
556wellspan.careNameCheap, Inc.19 Jul 202329 Sep 202419 Jul 2024
557wellspamassage.topAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…24 Nov 20231 Jan 202524 Nov 2024
558wellspaced.orgTucows Domains Inc.8 Aug 202318 Sep 20248 Aug 2024
559wellspatrainingacademy.comGoDaddy.com, LLC11 Aug 202322 Sep 202411 Aug 2024
560wellspacetherapy.netGoogle, Inc.15 Aug 202331 Jul 202415 Aug 2025
561wellspath.comNetwork Solutions, LLC19 Aug 20231 Oct 202419 Aug 2024
562wellspacewonders.comNameCheap, Inc.20 Aug 20231 Nov 202420 Aug 2024
563wellspansports.comGoDaddy.com, LLC21 Aug 202322 Aug 202421 Aug 2025
564wellsparq-usa.comCrazy Domains FZ-LLC25 Aug 202321 Jun 202425 Aug 2025
565wellsparq-uk.comCrazy Domains FZ-LLC25 Aug 202321 Jun 202425 Aug 2025
566wellsparq-eur.comCrazy Domains FZ-LLC25 Aug 202321 Jun 202425 Aug 2025
567wellsparkai.comWix.com Ltd.26 Aug 20236 Oct 202426 Aug 2024
568wellsparkcoaching.comSquarespace Domains LLC27 Aug 202326 Sep 202427 Aug 2024
569wellspapartners.comGoDaddy.com, LLC5 Sep 202317 Oct 20245 Sep 2024
570wellspaceforwomen.comWix.com Ltd.4 Sep 20236 Jul 20244 Sep 2027
571wellspaceaustralia.com.au--2 Jun 2024-
572wellspacemeditation.comHostinger, UAB20 Sep 20233 Nov 202420 Sep 2025
573wellspace.ae----
574wellspaio.onlineGoDaddy.com, LLC28 Sep 20239 Nov 202428 Sep 2024
575wellspaceplaytherapy.comWix.com Ltd.1 Oct 202323 Jun 20241 Oct 2025
576wellspacemassage.comGoDaddy.com, LLC17 Oct 202318 Dec 202317 Oct 2025
577wellsparktherapy.comSquarespace Domains LLC23 Oct 20239 Oct 202423 Oct 2025
578wellspaceaid.comGoDaddy.com, LLC30 Oct 202330 Oct 202330 Oct 2026
579wellspark.storeAlibaba Cloud Computing Ltd. d/b/a HiChina (www.ne…5 Nov 202313 Jan 20255 Nov 2024
580wellsparked.comGoDaddy.com, LLC5 Nov 20236 Nov 20245 Nov 2025
581wellspan.infoGoDaddy.com, LLC7 Nov 202322 Dec 20247 Nov 2025
582wellspaggo.comGoDaddy.com, LLC7 Nov 20237 Nov 20237 Nov 2024
583wellsparkco.comNameCheap, Inc.9 Nov 202310 Oct 20249 Nov 2025
584wellspaceholistichealth.netHostinger, UAB10 Nov 202314 Oct 202410 Nov 2025
585wellspan.devCSC Corporate Domains, Inc.17 Nov 202322 Nov 202317 Nov 2026
586wellspayaid.comNameCheap, Inc.24 Nov 20235 Feb 202524 Nov 2024
587wellspanbiotech.comGoDaddy.com, LLC28 Nov 202329 Nov 202428 Nov 2025
588wellspaclub.onlineLimited Liability Company "Registrar of domain nam…3 Dec 202310 Feb 20253 Dec 2024
589wellspace-yess.orgTucows Domains Inc.4 Dec 202324 Nov 20244 Dec 2025
590wellspaceskincare.comGoDaddy.com, LLC9 Dec 202310 Dec 20249 Dec 2025
591wellsparedding.comGoDaddy.com, LLC10 Dec 202321 Jan 202510 Dec 2024
592wellspacenola.comInterNetworX Ltd. & Co. KG11 Dec 20231 Apr 202511 Dec 2026
593wellspaorlando.comGoDaddy.com, LLC20 Dec 202320 Dec 202320 Dec 2026
594wellsparkhq.comGoDaddy.com, LLC26 Dec 20239 Jan 202526 Dec 2025
595wellspace.coachGoogle, Inc.3 Jan 202424 Dec 20243 Jan 2026
596wellspaceholistictherapy.comGoogle, Inc.14 Jan 202430 Dec 202414 Jan 2026
597wellsparkle.comCloudFlare, Inc.22 Jan 202423 Dec 202422 Jan 2026
598wellsparagon.comHostinger, UAB26 Jan 202411 Mar 202526 Jan 2025
599wellspacemdfamilypractice.comPromo People inc.31 Jan 202424 Jan 202531 Jan 2026
600wellspark.teamNameCheap, Inc.3 Feb 202417 Mar 20253 Feb 2025
601wellspark.onlineNameCheap, Inc.5 Feb 202419 Mar 20255 Feb 2025
602wellsparkco.onlineNameCheap, Inc.9 Feb 202423 Mar 20259 Feb 2025
603wellspacemediation.comEpik Inc.13 Feb 202411 Feb 202513 Feb 2026
604wellspace.co.nz-23 Aug 202318 Feb 2024-
605wellspacenutrition.comGoDaddy.com, LLC22 Feb 202423 Feb 202522 Feb 2026
606wellspalelager.comDynadot, LLC22 Feb 202422 Feb 202522 Feb 2026
607wellspatherapy.comWeb Commerce Communications Limited dba WebNic.cc25 Feb 202425 Feb 202425 Feb 2026
608wellspaworx.comGoDaddy.com, LLC4 Mar 20244 Mar 20244 Mar 2027
609wellspansaverx.orgCSC Corporate Domains, Inc.7 Mar 20248 Mar 20257 Mar 2026
610wellspansaverx.comCSC Corporate Domains, Inc.7 Mar 20243 Mar 20257 Mar 2026
611wellspartauto.com-10 Mar 202410 Mar 202410 Mar 2025
612wellspacegalery.comDynadot, LLC22 Mar 202423 Mar 202522 Mar 2026
613wellspacecoach.comGoDaddy.com, LLC4 Apr 202418 Apr 20254 Apr 2026
614wellspaceaustralia.au--6 Aug 2024-
615wellspaintingia.comGoDaddy.com, LLC15 Apr 202415 Apr 202415 Apr 2025
616wellspace.coGoDaddy.com, LLC22 Jan 201127 Jan 202521 Jan 2026
617wellspace.workGoDaddy.com, LLC2 Oct 20208 Oct 20242 Oct 2025
618wellspaces.coGoDaddy.com, LLC17 Dec 201829 Dec 202417 Dec 2025
619wellspaceni.co.ukYour Domain LLC3 Aug 20184 Jul 20243 Aug 2025
620wellspacehk.comWeb Commerce Communications Limited dba WebNic.cc30 Apr 202430 Apr 202430 Apr 2025
621wellspace.com.au--26 Sep 2024-
622wellspace.shopGoDaddy.com, LLC14 Jul 202312 Jul 202414 Jul 2025
623wellspacetherapy.co.uk-21 Sep 20196 Sep 202421 Sep 2025
624wellsparryharrisonlawgroup.comDynadot, LLC2 May 202425 May 20242 May 2025
625wellspaddlesports.comGoDaddy.com, LLC2 May 202420 May 20242 May 2027
626wellspace.se-3 Dec 20231 Nov 20243 Dec 2025
627wellspa77.ru-28 Dec 2020-28 Dec 2025
628wellspa78.ru-28 Dec 2020-28 Dec 2025
629wellspace.ru-4 May 2011-4 May 2025
630wellspaclub.ru-3 Dec 2023-3 Dec 2024
631wellspare.ru-14 May 2020-14 May 2025
632wellspartner.ru-26 May 2010-26 May 2025
633wellspaddlesports.co.uk-2 May 202410 Sep 20242 May 2027
634wellspan-ls.comDreamHost, LLC13 May 202413 May 202413 May 2025
635wellspark.frEPAG Domainservices GmbH18 Jan 202416 Jan 202518 Jan 2025
636wellsparryharrisonlawgroup.bondDynadot, LLC25 May 202420 Jun 202425 May 2025
637wellspan-health.orgeNom, Inc.29 May 20243 Jun 202429 May 2025
638wellspaymentsapi.onlineNameCheap, Inc.17 Jun 202429 Jun 202417 Jun 2025
639wellsparq-sandpit.comCrazy Domains FZ-LLC21 Jun 20241 Aug 202421 Jun 2025
640wellspaintingnr.comGoogle, Inc.2 Jul 20242 Jul 20242 Jul 2025
641wellspayamerica.comGoDaddy.com, LLC6 Jul 202411 Jul 20246 Jul 2025
642wellspaceconsulting.orgGoogle, Inc.18 Jul 20242 Aug 202418 Jul 2025
643wellspacecolor.comWix.com Ltd.24 Jul 202424 Jul 202424 Jul 2025
644wellspaceliving.comTucows Domains Inc.9 Feb 202514 Mar 20259 Feb 2026
645wellspan.xyzWeb Commerce Communications Limited dba WebNic.cc29 Jul 202413 Mar 202529 Jul 2025
646wellspace-sylt.de--30 Jul 2024-
647wellspace.appGoDaddy.com, LLC12 Aug 202419 Dec 202412 Aug 2026
648wellspalnthireuk.co.uk-14 Aug 202414 Aug 202414 Aug 2025
649wellspacecollective.storeName.com, Inc.4 Sep 20241 Oct 20244 Sep 2025
650wellspansportscomplex.comGoDaddy.com, LLC9 Sep 20249 Sep 20249 Sep 2027
651wellspa248c.comGoDaddy.com, LLC11 Sep 202411 Sep 202411 Sep 2025
652wellsparklyn.comInternet Domain Services BS Corp12 Sep 202412 Sep 202412 Sep 2025
653wellspacehealthcenters.org1&1 Internet AG13 Sep 202418 Sep 202413 Sep 2025
654wellspacepc.comGoDaddy.com, LLC14 Sep 202414 Sep 202414 Sep 2034
655wellspaceprimarycare.comGoDaddy.com, LLC14 Sep 202414 Sep 202414 Sep 2034
656wellspavingandsealcoatingva.comName.com, Inc.18 Sep 202418 Sep 202418 Sep 2025
657wellspark.inGoDaddy.com, LLC26 Sep 20241 Oct 202426 Sep 2027
658wellspanstudio.comSquarespace Domains LLC26 Sep 202426 Sep 202426 Sep 2025
659wellspanstudios.comSquarespace Domains LLC26 Sep 202426 Sep 202426 Sep 2025
660wellspacefitness.co.uk-29 Sep 202429 Sep 202429 Sep 2025
661wellspacehub.comHostinger, UAB4 Oct 202418 Feb 20254 Oct 2025
662wellspark.de--1 Dec 2024-
663wellspacearchitects.co.uk-28 Oct 202428 Oct 202428 Oct 2026
664wellspan.co.uk-30 Oct 202430 Oct 202430 Oct 2026
665wellspan.me.uk-30 Oct 202430 Oct 202430 Oct 2025
666wellspan.org.uk-30 Oct 202430 Oct 202430 Oct 2025
667wellspan.uk-30 Oct 202430 Oct 202430 Oct 2025
668wellspamd.comWix.com Ltd.11 Nov 202411 Nov 202411 Nov 2025
669wellspancoaching.infoGoDaddy.com, LLC14 Nov 202419 Nov 202414 Nov 2025
670wellspancoaching.orgGoDaddy.com, LLC14 Nov 202419 Nov 202414 Nov 2025
671wellspancoaching.xyzGoDaddy.com, LLC14 Nov 202420 Dec 202414 Nov 2025
672wellspancoaching.comGoDaddy.com, LLC14 Nov 202414 Nov 202414 Nov 2025
673wellspan.appCSC Corporate Domains, Inc.22 Nov 202427 Nov 202422 Nov 2025
674wellsparkfit.comGoDaddy.com, LLC8 Dec 20248 Dec 20248 Dec 2025
675wellsparkfitness.comGoDaddy.com, LLC8 Dec 20248 Dec 20248 Dec 2025
676wellspacesdesign.comGoDaddy.com, LLC8 Dec 20248 Dec 20248 Dec 2025
677wellspacecollab.comPorkbun, LLC13 Dec 202413 Dec 202413 Dec 2026
678wellspace.tvGoDaddy.com, LLC22 Jan 201128 Jan 202522 Jan 2026
679wellspaceai.comGoDaddy.com, LLC3 Jan 20253 Jan 20253 Jan 2026
680wellspaceai.appGoDaddy.com, LLC5 Jan 202510 Jan 20255 Jan 2026
681wellspaconsulting.comWix.com Ltd.6 Jan 20256 Jan 20256 Jan 2026
682wellspaceyoga.comSquarespace Domains LLC24 Jan 202524 Jan 202524 Jan 2026
683wellspamed.comNameCheap, Inc.3 Feb 20253 Feb 20253 Feb 2026
684wellsparkhealth.usMarkMonitor Inc.17 Sep 202327 Feb 202517 Sep 2027
685wellspan.healthcareNameCheap, Inc.8 Mar 202513 Mar 20258 Mar 2026
686wellspaceofficial.co.uk-6 Mar 20256 Mar 20256 Mar 2026
687wellsparts.usCSC Corporate Domains, Inc.26 Oct 201020 Feb 202525 Oct 2025
688wellspan-community.comWild West Domains, LLC8 Mar 20258 Mar 20258 Mar 2026
689wellspanhelpdesk.orgGoDaddy.com, LLC17 Mar 202517 Mar 202517 Mar 2026
690wellspaceidaho.orgHostinger, UAB23 Mar 202523 Mar 202523 Mar 2026
691wellspaceidaho.comPDR Ltd. d/b/a PublicDomainRegistry.com23 Mar 202523 Mar 202523 Mar 2026
692wellspanaccess.comGoDaddy.com, LLC28 Mar 202528 Mar 202528 Mar 2026
693wellspanhospitals.orgCSC Corporate Domains, Inc.2 Apr 20252 Apr 20252 Apr 2026
694wellspanhospitals.comCSC Corporate Domains, Inc.2 Apr 20252 Apr 20252 Apr 2026
695wellspanhospitals.netCSC Corporate Domains, Inc.2 Apr 20252 Apr 20252 Apr 2026
696wellsparkdesign.comGoDaddy.com, LLC8 Apr 20258 Apr 20258 Apr 2026
697wellspace.fitDNSPod, Inc.25 Apr 202525 Apr 202525 Apr 2035

Reverse Whois Demo

Reverse Whois API

You can fetch the above results using our Reverse Whois API.

https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=wellspa

Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.

Sample Output: JSON SchemaXML SchemaJSON Live ResultsXML Live Results

Reverse Whois Pricing Total API Calls Price CPM Purchase
200 Reverse Whois API Queries 200 $2 $10.00 Order Now
1,000 Reverse Whois API Queries 1,000 $10 $10.00 Order Now
10,000 Reverse Whois API Queries 10,000 $100 $10.00 Order Now
50,000 Reverse Whois API Queries 50,000 $400 $8.00 Order Now
250,000 Reverse Whois API Queries 250,000 $1,500 $6.00 Order Now
1 Million Reverse Whois API Queries 1,000,000 $4,000 $4.00 Order Now
5 Million Reverse Whois API Queries 5,000,000 $10,000 $2.00 Order Now