With support for 
Keyword: WHITEHEAD
Reverse Whois » KEYWORD [whitehead ] { 1,207 domain names }
| Num | Domain Name | Registrar | Created | Updated | Expiry |
|---|---|---|---|---|---|
| 1 | whitehead.voting | RegistryGate GmbH | 23 Jul 2014 | - | 23 Jul 2015 |
| 2 | whitehead.london | GoDaddy.com, LLC | 11 Jan 2022 | 12 Jan 2025 | 11 Jan 2026 |
| 3 | whitehead.property | Uniregistrar Corp | 31 Jan 2015 | 17 Mar 2017 | 31 Jan 2018 |
| 4 | whitehead.work | 1&1 Internet AG | 7 Mar 2015 | 7 Mar 2015 | 7 Mar 2016 |
| 5 | whitehead.flowers | Uniregistrar Corp | 7 Apr 2015 | 7 Apr 2015 | 7 Apr 2016 |
| 6 | whitehead.rocks | eNom, Inc. | 13 Apr 2015 | 13 Apr 2015 | 13 Apr 2016 |
| 7 | whitehead.xyz | GoDaddy.com, LLC | 15 Aug 2015 | 30 Oct 2024 | 15 Aug 2025 |
| 8 | whitehead.news | eNom, Inc. | 17 Aug 2015 | 25 Jul 2017 | 17 Aug 2018 |
| 9 | whitehead.club | CloudFlare, Inc. | 25 Feb 2025 | 25 Feb 2025 | 25 Feb 2026 |
| 10 | whitehead.biz | GoDaddy.com, LLC | 14 Jul 2018 | 12 Jul 2024 | 14 Jul 2025 |
| 11 | whitehead.us | Google, Inc. | 15 May 2015 | 15 May 2017 | 14 May 2018 |
| 12 | whitehead.house | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 16 Sep 2015 | 19 Feb 2025 | 16 Sep 2028 |
| 13 | whitehead.info | - | 5 Aug 2024 | 10 Aug 2024 | 5 Aug 2025 |
| 14 | whitehead.agency | GoDaddy.com, LLC | 20 Apr 2022 | 1 Jul 2023 | 20 Apr 2023 |
| 15 | whitehead.com | Tucows Domains Inc. | 29 May 1997 | 29 Apr 2024 | 28 May 2025 |
| 16 | whitehead.website | NameCheap, Inc. | 1 Apr 2016 | 1 Apr 2016 | 1 Apr 2017 |
| 17 | whitehead.email | Google, Inc. | 26 Mar 2014 | 16 Mar 2025 | 26 Mar 2026 |
| 18 | whitehead.photography | GoDaddy.com, LLC | 3 Jun 2014 | 15 Jul 2016 | 3 Jun 2016 |
| 19 | whitehead.properties | GoDaddy.com, LLC | 5 Oct 2016 | 29 Sep 2017 | 5 Oct 2018 |
| 20 | whitehead.ltd | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 13 Oct 2016 | 10 Sep 2019 | 13 Oct 2020 |
| 21 | whitehead.net | Tucows Domains Inc. | 20 Nov 1996 | 21 Oct 2024 | 19 Nov 2025 |
| 22 | whitehead.org | Wild West Domains, LLC | 9 Jan 1996 | 9 Jun 2024 | 8 Jan 2027 |
| 23 | whitehead.space | NameCheap, Inc. | 28 Nov 2016 | 13 Dec 2017 | 28 Nov 2018 |
| 24 | whitehead.tc | - | 21 Dec 1999 | - | 22 Dec 2025 |
| 25 | whitehead.life | Namesilo, LLC | 25 Dec 2017 | 25 Dec 2017 | 25 Dec 2018 |
| 26 | whitehead.org.uk | - | 4 Apr 2008 | 29 Jul 2024 | 4 Apr 2025 |
| 27 | whitehead.co.uk | - | 31 Mar 2005 | 1 Mar 2024 | 31 Mar 2025 |
| 28 | whitehead.me.uk | - | 7 Mar 2002 | 7 Mar 2023 | 7 Mar 2026 |
| 29 | whitehead.uk.com | Reserved for non-billable transactions where Regis… | 1 Mar 2010 | 23 Feb 2025 | 1 Mar 2026 |
| 30 | whitehead.institute | Name.com, Inc. | 9 Mar 2018 | 3 May 2018 | 9 Mar 2019 |
| 31 | whitehead.expert | Name.com, Inc. | 9 Mar 2018 | 3 May 2018 | 9 Mar 2019 |
| 32 | whitehead.tech | GoDaddy.com, LLC | 13 Sep 2018 | 25 Nov 2024 | 13 Sep 2025 |
| 33 | whitehead.dev | Google, Inc. | 14 Feb 2021 | 14 Feb 2025 | 14 Feb 2026 |
| 34 | whitehead.works | NameCheap, Inc. | 3 Jul 2019 | 9 Jun 2024 | 3 Jul 2026 |
| 35 | whitehead.group | - | 31 Dec 2024 | 5 Jan 2025 | 31 Dec 2025 |
| 36 | whitehead.solutions | Gandi SAS | 27 Apr 2020 | 29 Aug 2024 | 27 Apr 2026 |
| 37 | whitehead.realty | Epik Inc. | 26 Sep 2020 | 16 Nov 2021 | 26 Sep 2022 |
| 38 | whitehead.foundation | Squarespace Domains LLC | 22 Jan 2021 | 31 Jul 2024 | 22 Jan 2026 |
| 39 | whitehead.pro | Porkbun, LLC | 26 Aug 2021 | 16 Jul 2024 | 26 Aug 2026 |
| 40 | whitehead.store | CommuniGal Communication Ltd. | 4 Aug 2024 | 1 Sep 2024 | 4 Aug 2025 |
| 41 | whitehead.or.kr | - | 21 Jan 2004 | 1 Nov 2017 | 21 Jan 2023 |
| 42 | whitehead.legal | GoDaddy.com, LLC | 14 Jun 2022 | 6 Sep 2024 | 14 Jun 2025 |
| 43 | whitehead.one | NameCheap, Inc. | 30 Aug 2022 | 5 Aug 2024 | 30 Aug 2025 |
| 44 | whitehead.engineering | Network Solutions, LLC | 16 Sep 2022 | 16 Sep 2022 | 16 Sep 2023 |
| 45 | whitehead.ai | - | - | - | - |
| 46 | whitehead.network | Synergy Wholesale Pty Ltd | 2 Nov 2022 | 23 Sep 2024 | 2 Nov 2028 |
| 47 | whitehead.cloud | Synergy Wholesale Pty Ltd | 2 Nov 2022 | 24 Aug 2024 | 2 Nov 2028 |
| 48 | whitehead.uk.net | - | 23 May 2015 | 31 Aug 2023 | 23 May 2025 |
| 49 | whitehead.pics | Namesilo, LLC | 21 Dec 2022 | 22 Dec 2023 | 21 Dec 2024 |
| 50 | whitehead.be | - | 25 Aug 2011 | - | - |
| 51 | whitehead.com.br | - | 31 Jul 2006 | 26 Jul 2022 | 31 Jul 2025 |
| 52 | whitehead.nl | One.com A/S | 25 Feb 2008 | 22 Nov 2019 | - |
| 53 | whitehead.family | Tucows Domains Inc. | 19 Jun 2022 | 10 Jun 2024 | 19 Jun 2025 |
| 54 | whitehead.fun | NameCheap, Inc. | 3 Sep 2022 | 15 Nov 2024 | 3 Sep 2025 |
| 55 | whitehead.melbourne | Synergy Wholesale Pty Ltd | 21 Jan 2022 | 13 Jan 2025 | 21 Jan 2026 |
| 56 | whitehead.org.pl | - | 18 Apr 2021 | 16 Apr 2024 | 18 Apr 2025 |
| 57 | whitehead.uk | - | 25 Jun 2019 | 26 May 2024 | 25 Jun 2025 |
| 58 | whitehead.media | Tucows Domains Inc. | 28 Oct 2023 | 19 Oct 2024 | 28 Oct 2025 |
| 59 | whitehead.wiki | Porkbun, LLC | 4 Nov 2023 | 18 Dec 2024 | 4 Nov 2024 |
| 60 | whitehead.chat | NameCheap, Inc. | 2 Feb 2024 | 3 Feb 2025 | 2 Feb 2026 |
| 61 | whitehead.digital | Porkbun, LLC | 18 Mar 2024 | 30 Mar 2025 | 18 Mar 2026 |
| 62 | whitehead.shop | Dynadot, LLC | 3 Dec 2023 | 29 Jan 2024 | 3 Dec 2024 |
| 63 | whitehead.tokyo | GMO Internet Inc. | 18 Feb 2024 | 29 Mar 2024 | 18 Feb 2025 |
| 64 | whitehead.fr | One.com A/S | 24 Jul 2010 | 31 Aug 2024 | 24 Jul 2025 |
| 65 | whitehead.ru | - | 26 Oct 2023 | - | 26 Oct 2025 |
| 66 | whitehead.asia | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 24 May 2024 | 29 May 2024 | 24 May 2025 |
| 67 | whitehead.law | GoDaddy.com, LLC | 13 Sep 2024 | 7 Feb 2025 | 13 Sep 2027 |
| 68 | whitehead.software | Network Solutions, LLC | 7 Oct 2024 | 12 Oct 2024 | 7 Oct 2025 |
| 69 | whitehead.app | CloudFlare, Inc. | 16 Nov 2024 | 21 Nov 2024 | 16 Nov 2025 |
| 70 | whitehead.co.nz | - | 13 Dec 2023 | 21 Feb 2025 | - |
| 71 | whitehead.com.au | - | - | 30 Aug 2023 | - |
| 72 | whitehead.esq | Google, Inc. | 5 Mar 2025 | 5 Mar 2025 | 5 Mar 2026 |
| 73 | whiteheadsets.com | GoDaddy.com, LLC | 3 Jun 2008 | 4 Jun 2015 | 3 Jun 2016 |
| 74 | whiteheadfamily.com | TurnCommerce, Inc. DBA NameBright.com | 21 Oct 2020 | 26 Aug 2021 | 21 Oct 2025 |
| 75 | whiteheadfarmspercherons.com | 1&1 Internet AG | 29 Oct 2014 | 4 Nov 2016 | 29 Oct 2017 |
| 76 | whiteheadconstructions.com | Melbourne IT, Ltd | 24 Jun 2010 | 16 Jun 2024 | 24 Jun 2025 |
| 77 | whiteheadflorist.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 19 Aug 2002 | 25 Jul 2016 | 19 Aug 2017 |
| 78 | whiteheadins.com | GoDaddy.com, LLC | 7 Jun 2012 | 7 Jun 2015 | 7 Jun 2016 |
| 79 | whiteheadperformance.com | GoDaddy.com, LLC | 19 Jul 2005 | 27 Oct 2022 | 19 Jul 2028 |
| 80 | whiteheadpower.com | GoDaddy.com, LLC | 19 Jun 2013 | 20 Jun 2015 | 19 Jun 2016 |
| 81 | whiteheadfinancialservices.com | GoDaddy.com, LLC | 24 Jun 2015 | 24 Jun 2015 | 24 Jun 2016 |
| 82 | whiteheadandwood.com | GoDaddy.com, LLC | 6 Feb 2015 | 10 Feb 2025 | 6 Feb 2027 |
| 83 | whiteheadonline.com | PresidentialDomains LLC | 16 Sep 2013 | 17 Sep 2017 | 16 Sep 2018 |
| 84 | whiteheadtruckinginc.com | register.com, Inc. | 28 Aug 2014 | 28 Aug 2014 | 28 Aug 2015 |
| 85 | whiteheadbuilders.com | TurnCommerce, Inc. DBA NameBright.com | 17 Nov 2011 | 19 Dec 2023 | 17 Nov 2023 |
| 86 | whiteheadbbq.com | GoDaddy.com, LLC | 3 Dec 2015 | 3 Dec 2015 | 3 Dec 2016 |
| 87 | whiteheadphoto.com | DomainExtreme LLC | 22 Apr 2013 | 23 Apr 2017 | 22 Apr 2018 |
| 88 | whiteheadrestoration.com | 1&1 Internet AG | 14 Nov 2014 | 5 Oct 2022 | 14 Nov 2025 |
| 89 | whiteheadcommunications.com | register.com, Inc. | 14 Sep 2014 | 20 Sep 2024 | 14 Sep 2029 |
| 90 | whiteheadsigns.com | Network Solutions, LLC | 15 Sep 2014 | 16 Aug 2024 | 15 Sep 2025 |
| 91 | whiteheadsolptrs.com | GoDaddy.com, LLC | 3 Sep 2014 | 4 Sep 2016 | 3 Sep 2018 |
| 92 | whiteheadsonline.com | DropCatch.com 478 LLC | 6 Feb 2016 | 7 Feb 2017 | 6 Feb 2018 |
| 93 | whiteheadnatural.com | GoDaddy.com, LLC | 6 Sep 2014 | 6 Sep 2014 | 6 Sep 2016 |
| 94 | whiteheadedu.com | Beijing Lanhai Jiye Technology Co., Ltd | 19 Nov 2014 | 7 Mar 2025 | 19 Nov 2025 |
| 95 | whiteheadbowls.com | TurnCommerce, Inc. DBA NameBright.com | 6 Feb 2022 | 9 Mar 2024 | 6 Feb 2024 |
| 96 | whiteheadlawfirm.com | GoDaddy.com, LLC | 20 Dec 2018 | 21 Dec 2024 | 20 Dec 2025 |
| 97 | whiteheadfink.com | GoDaddy.com, LLC | 4 Oct 2014 | 5 Oct 2024 | 4 Oct 2025 |
| 98 | whitehead-museum.com | enom433, Incorporated | 15 Mar 2017 | 16 Mar 2017 | 15 Mar 2018 |
| 99 | whiteheadhouse.com | DropCatch.com 708 LLC | 12 Mar 2018 | 12 Mar 2018 | 12 Mar 2019 |
| 100 | whiteheadresearchm.com | register.com, Inc. | 26 Sep 2014 | 26 Sep 2014 | 26 Sep 2015 |
| 101 | whiteheadclothing.com | Tucows Domains Inc. | 11 Oct 2013 | 15 Oct 2014 | 11 Oct 2015 |
| 102 | whiteheadchiro-hub.com | GoDaddy.com, LLC | 6 Dec 2014 | 6 Dec 2014 | 6 Dec 2015 |
| 103 | whiteheadrelocation.com | - | - | - | - |
| 104 | whiteheadschmid.com | GoDaddy.com, LLC | 15 Dec 2014 | 15 Dec 2014 | 15 Dec 2016 |
| 105 | whiteheadrealtor.com | Fabulous.com Pty Ltd. | 28 Nov 2004 | 4 Dec 2017 | 28 Nov 2018 |
| 106 | whiteheadme.info | CommuniGal Communication Ltd. | 29 Oct 2021 | 30 Oct 2021 | 29 Oct 2022 |
| 107 | whiteheadsflowers.info | GoDaddy.com, LLC | 29 Dec 2014 | 29 Dec 2014 | 29 Dec 2015 |
| 108 | whiteheadstudios.com | DropCatch.com 847 LLC | 19 Mar 2025 | 20 Mar 2025 | 19 Mar 2026 |
| 109 | whiteheadconferencecenter.xyz | Network Solutions, LLC | 29 Jun 2014 | 30 Jun 2014 | 29 Jun 2015 |
| 110 | whitehead497store.info | GoDaddy.com, LLC | 12 Aug 2015 | 13 Aug 2015 | 12 Aug 2016 |
| 111 | whiteheads.xyz | Uniregistrar Corp | 2 Jun 2016 | 7 Dec 2016 | 2 Jun 2017 |
| 112 | whiteheadoriginals.com | GoDaddy.com, LLC | 5 Jan 2015 | 5 Jan 2015 | 5 Jan 2016 |
| 113 | whiteheadandwhiteheads.com | Tucows Domains Inc. | 3 Jan 2011 | 7 Jan 2015 | 3 Jan 2016 |
| 114 | whiteheadsauto.com | eNom, Inc. | 14 Jan 2015 | 14 Jan 2015 | 14 Jan 2016 |
| 115 | whiteheadfairytale.com | GoDaddy.com, LLC | 16 Jan 2015 | 16 Jan 2015 | 16 Jan 2016 |
| 116 | whitehead-treatment.xyz | GMO Internet Inc. | 17 Jun 2015 | 17 Jun 2015 | 17 Jun 2016 |
| 117 | whiteheaddna.com | Beijing Lanhai Jiye Technology Co., Ltd | 27 Sep 2024 | 25 Mar 2025 | 27 Sep 2025 |
| 118 | whiteheadcreekhuntclub.com | register.com, Inc. | 16 Aug 2015 | 16 Aug 2015 | 16 Aug 2016 |
| 119 | whiteheadgrafix.com | - | 2 Jul 2022 | 2 Jul 2023 | 2 Jul 2024 |
| 120 | whitehead-associates.com | GoDaddy.com, LLC | 26 Jan 2015 | 1 Feb 2025 | 26 Jan 2026 |
| 121 | whiteheadrecruitment.com | Webfusion Ltd. | 28 Jan 2015 | 29 Jan 2025 | 28 Jan 2027 |
| 122 | whiteheadsflowersandgifts.com | GoDaddy.com, LLC | 18 Aug 2015 | 18 Aug 2015 | 18 Aug 2016 |
| 123 | whitehead-eagles.com | 1API GmbH | 14 Feb 2015 | 14 Feb 2015 | 14 Feb 2018 |
| 124 | whiteheadturningpoint.com | GoDaddy.com, LLC | 23 Feb 2015 | 23 Feb 2015 | 23 Feb 2016 |
| 125 | whiteheadec.com | GoDaddy.com, LLC | 5 Mar 2015 | 4 Mar 2025 | 5 Mar 2026 |
| 126 | whiteheadwaterfront.com | Tucows Domains Inc. | 4 Mar 2003 | 8 Mar 2015 | 4 Mar 2016 |
| 127 | whiteheadclinics.com | eNom, Inc. | 24 Aug 2015 | 24 Aug 2015 | 24 Aug 2016 |
| 128 | whiteheadautosales.net | GoDaddy.com, LLC | 9 Mar 2015 | 10 Mar 2025 | 9 Mar 2026 |
| 129 | whiteheadmotorsma.com | GoDaddy.com, LLC | 18 Mar 2015 | 19 Mar 2025 | 18 Mar 2026 |
| 130 | whiteheadcommunityassociation.com | NameCheap, Inc. | 14 Jun 2024 | 14 Jun 2024 | 14 Jun 2025 |
| 131 | whiteheadsetofpie.com | GoDaddy.com, LLC | 26 Aug 2015 | 26 Aug 2015 | 26 Aug 2016 |
| 132 | whiteheadcommunityassociation.org | GoDaddy.com, LLC | 19 Mar 2015 | 20 Mar 2017 | 19 Mar 2019 |
| 133 | whiteheadcommunityassociation.net | GoDaddy.com, LLC | 19 Mar 2015 | 19 Mar 2015 | 19 Mar 2017 |
| 134 | whiteheadcommunityassociation.info | GoDaddy.com, LLC | 19 Mar 2015 | 20 Mar 2017 | 19 Mar 2019 |
| 135 | whiteheadsbarbershop.com | Google, Inc. | 5 Jul 2024 | 5 Jul 2024 | 5 Jul 2025 |
| 136 | whiteheadmade.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 25 Mar 2015 | 25 Mar 2015 | 25 Mar 2016 |
| 137 | whiteheadbrainmgmt.com | Key-Systems GmbH | 26 Mar 2015 | 29 Apr 2015 | 26 Mar 2016 |
| 138 | whiteheadresearchmetals.com | register.com, Inc. | 26 Mar 2015 | 26 Mar 2015 | 26 Mar 2016 |
| 139 | whiteheadasoc.com | GoDaddy.com, LLC | 30 Aug 2015 | 30 Aug 2015 | 30 Aug 2016 |
| 140 | whiteheadaccountingservices.com | GoDaddy.com, LLC | 2 Sep 2015 | 2 Sep 2015 | 2 Sep 2016 |
| 141 | whiteheadj.com | register.com, Inc. | 4 Sep 2015 | 20 Aug 2016 | 4 Sep 2017 |
| 142 | whitehead-monckton.com | NameCheap, Inc. | 2 Oct 2023 | 3 Oct 2024 | 2 Oct 2025 |
| 143 | whiteheadsonnose.com | DomainAhead LLC | 15 Jul 2016 | 24 Aug 2018 | 15 Jul 2019 |
| 144 | whiteheademploymentlaw.com | Launchpad, Inc. | 29 Apr 2015 | 30 May 2024 | 29 Apr 2025 |
| 145 | whiteheadhomeinspections.com | GoDaddy.com, LLC | 1 May 2015 | 1 May 2015 | 1 May 2016 |
| 146 | whiteheadrealtysells.com | eNom, Inc. | 9 Sep 2015 | 9 Sep 2015 | 9 Sep 2016 |
| 147 | whiteheadsautorepair.com | Media Elite Holdings Limited | 3 Aug 2020 | 31 Aug 2024 | 3 Aug 2028 |
| 148 | whiteheadsflowersngifts.com | GoDaddy.com, LLC | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 149 | whiteheadflowersngifts.com | GoDaddy.com, LLC | 11 Sep 2015 | 11 Sep 2015 | 11 Sep 2016 |
| 150 | whiteheadlawncare.org | Tucows Domains Inc. | 17 May 2014 | 21 May 2015 | 17 May 2016 |
| 151 | whiteheadappliancecenter.com | GoDaddy.com, LLC | 27 May 2015 | 27 May 2015 | 27 May 2016 |
| 152 | whiteheadchiropractic.com | FastDomain Inc. | 3 Jun 2015 | 19 May 2024 | 3 Jun 2025 |
| 153 | whiteheadcap.com | Tucows Domains Inc. | 1 Jun 2011 | 5 Jun 2015 | 1 Jun 2016 |
| 154 | whiteheadit.net | EvoPlus Ltd. | 16 Sep 2015 | 16 Sep 2015 | 16 Sep 2016 |
| 155 | whiteheadrblband.com | GoDaddy.com, LLC | 8 Jun 2015 | 8 Jun 2015 | 8 Jun 2018 |
| 156 | whiteheadjr.com | Key-Systems GmbH | 10 Nov 2022 | 23 Jan 2024 | 10 Nov 2023 |
| 157 | whiteheadlawyers.com | Tucows Domains Inc. | 21 Jun 2010 | 6 Jun 2024 | 21 Jun 2025 |
| 158 | whiteheadinsurance1.net | Tucows Domains Inc. | 29 Jun 2015 | 3 Jul 2019 | 29 Jun 2019 |
| 159 | whiteheadburnett.com | TurnCommerce, Inc. DBA NameBright.com | 3 Jul 2015 | 2 Nov 2020 | 3 Jul 2026 |
| 160 | whitehead-lawfirm.net | register.com, Inc. | 2 Jul 2015 | 2 Jul 2015 | 2 Jul 2016 |
| 161 | whiteheadvisualarts.com | eNom, Inc. | 7 Jul 2015 | 5 Jun 2016 | 7 Jul 2018 |
| 162 | whitehead2017.com | GMO Internet Inc. | 23 Jul 2020 | 23 Jul 2020 | 23 Jul 2021 |
| 163 | whiteheadcosmetics.com | GoDaddy.com, LLC | 29 Jul 2015 | 29 Jul 2015 | 29 Jul 2017 |
| 164 | whiteheadsflowerandgifts.com | Wild West Domains, LLC | 7 Aug 2015 | 7 Aug 2015 | 7 Aug 2016 |
| 165 | whiteheadwriter.com | GoDaddy.com, LLC | 4 Oct 2015 | 4 Oct 2015 | 4 Oct 2018 |
| 166 | whiteheadcountyantrim.com | eNom, Inc. | 9 Aug 2015 | 26 Jul 2017 | 9 Aug 2017 |
| 167 | whiteheadsflowersllc.com | register.com, Inc. | 10 Aug 2015 | 10 Aug 2015 | 10 Aug 2016 |
| 168 | whiteheadguki.xyz | GMO Internet Inc. | 5 Oct 2015 | - | 5 Oct 2016 |
| 169 | whiteheadfitness.com | GoDaddy.com, LLC | 17 Jan 2020 | 17 Jan 2020 | 17 Jan 2021 |
| 170 | whiteheadpr.com | GoDaddy.com, LLC | 12 Oct 2015 | 12 Oct 2015 | 12 Oct 2016 |
| 171 | whiteheadindustrial.com | Network Solutions, LLC | 20 Aug 2011 | 21 Jun 2021 | 20 Aug 2026 |
| 172 | whiteheadmonckton.com | Google, Inc. | 18 Dec 2019 | 18 Dec 2019 | 18 Dec 2020 |
| 173 | whiteheadnotary.com | GoDaddy.com, LLC | 10 Nov 2015 | 10 Nov 2015 | 10 Nov 2018 |
| 174 | whiteheadmann.com | TurnCommerce, Inc. DBA NameBright.com | 9 Feb 2022 | 11 Mar 2025 | 9 Feb 2025 |
| 175 | whiteheadcustoms.com | GoDaddy.com, LLC | 1 Dec 2015 | 1 Dec 2015 | 1 Dec 2016 |
| 176 | whiteheadhousing.org | Network Solutions, LLC | 4 Dec 2015 | 4 Dec 2015 | 4 Dec 2016 |
| 177 | whiteheadsonline.net | PDR Ltd. d/b/a PublicDomainRegistry.com | 5 Dec 2015 | 5 Dec 2015 | 5 Dec 2016 |
| 178 | whiteheadforassessor.com | GoDaddy.com, LLC | 30 Dec 2019 | 30 Dec 2019 | 30 Dec 2020 |
| 179 | whiteheadds.com | Tucows Domains Inc. | 9 Dec 2015 | 13 Dec 2016 | 9 Dec 2016 |
| 180 | whiteheadwellness.com | register.com, Inc. | 15 Dec 2015 | 8 Dec 2016 | 15 Dec 2017 |
| 181 | whiteheadplumbingllc.com | Wild West Domains, LLC | 31 Oct 2019 | 1 Nov 2024 | 31 Oct 2025 |
| 182 | whiteheadrealtygroup.com | Google, Inc. | 21 Jan 2016 | 7 Jan 2025 | 21 Jan 2026 |
| 183 | whiteheadmansion.com | FastDomain Inc. | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2017 |
| 184 | whitehead-house.com | FastDomain Inc. | 22 Jan 2016 | 22 Jan 2016 | 22 Jan 2017 |
| 185 | whitehead-home.com | FastDomain Inc. | 22 Jan 2016 | 22 Jan 2017 | 22 Jan 2018 |
| 186 | whitehead-electric.info | Network Solutions, LLC | 25 Dec 2018 | 25 Dec 2018 | 25 Dec 2019 |
| 187 | whiteheadpr.net | Network Solutions, LLC | 31 Jan 2016 | 15 Mar 2025 | 31 Jan 2025 |
| 188 | whiteheadsassetrecovery.com | FastDomain Inc. | 1 Feb 2016 | 1 Feb 2017 | 1 Feb 2018 |
| 189 | whitehead2032.com | FastDomain Inc. | 9 Feb 2016 | 9 Feb 2016 | 9 Feb 2017 |
| 190 | whiteheadpimple.com | GoDaddy.com, LLC | 17 Feb 2016 | 17 Feb 2016 | 17 Feb 2017 |
| 191 | whiteheadstreetbooktique.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 17 Feb 2016 | 18 Feb 2016 | 17 Feb 2017 |
| 192 | whiteheadreality.com | eNom, Inc. | 21 Feb 2016 | 21 Feb 2016 | 21 Feb 2017 |
| 193 | whiteheadinsurancegroup.com | GoDaddy.com, LLC | 23 Feb 2016 | 23 Feb 2025 | 23 Feb 2027 |
| 194 | whiteheadoffice.com | GoDaddy.com, LLC | 24 Feb 2016 | 21 Sep 2022 | 24 Feb 2026 |
| 195 | whiteheadconstruction.biz | GoDaddy.com, LLC | 1 Mar 2016 | 13 Jul 2024 | 28 Feb 2032 |
| 196 | whiteheadinsuranceoneida.com | GoDaddy.com, LLC | 2 Mar 2016 | 3 Mar 2025 | 2 Mar 2026 |
| 197 | whiteheadinsurancejamestown.com | GoDaddy.com, LLC | 2 Mar 2016 | 3 Mar 2025 | 2 Mar 2026 |
| 198 | whiteheadpainting.info | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 199 | whiteheadpainting.org | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 200 | whiteheadpainting.net | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 201 | whiteheadpainting.com | GoDaddy.com, LLC | 3 Mar 2016 | 3 Mar 2016 | 3 Mar 2017 |
| 202 | whiteheadinn.com | TurnCommerce, Inc. DBA NameBright.com | 4 Mar 2016 | 26 Feb 2021 | 4 Mar 2025 |
| 203 | whiteheadsellshomes.com | GoDaddy.com, LLC | 7 Mar 2016 | 7 Mar 2016 | 7 Mar 2018 |
| 204 | whiteheadcoolingandheating.xyz | NameCheap, Inc. | 8 Mar 2016 | 30 Mar 2016 | 8 Mar 2017 |
| 205 | whiteheadgutters.com | Tucows Domains Inc. | 8 Mar 2013 | 12 Mar 2016 | 8 Mar 2017 |
| 206 | whiteheadmiles.com | Rebel.com Corp. | 10 Mar 2016 | 25 Jan 2025 | 10 Mar 2026 |
| 207 | whiteheadrealtyonline.net | eNom, Inc. | 14 Mar 2016 | 13 Feb 2025 | 14 Mar 2026 |
| 208 | whiteheadconstruction.org | Tucows Domains Inc. | 14 Mar 2016 | 18 Mar 2017 | 14 Mar 2018 |
| 209 | whiteheadhome.info | Network Solutions, LLC | 15 Mar 2016 | 15 Mar 2016 | 15 Mar 2017 |
| 210 | whiteheadshoesold.com | HiChina Zhicheng Technology Limited | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 211 | whiteheadshoeold.com | HiChina Zhicheng Technology Limited | 17 Mar 2016 | 17 Mar 2016 | 17 Mar 2017 |
| 212 | whiteheads.com | GoDaddy.com, LLC | 25 Mar 2004 | 2 Mar 2025 | 25 Mar 2026 |
| 213 | whiteheadforhouse.com | Network Solutions, LLC | 27 Mar 2016 | 27 Mar 2016 | 27 Mar 2017 |
| 214 | whiteheadassoc.com | GoDaddy.com, LLC | 3 Jan 1996 | 4 Dec 2023 | 2 Jan 2027 |
| 215 | whiteheadmedia.com | Dynadot, LLC | 13 Sep 2019 | 23 Oct 2024 | 13 Sep 2025 |
| 216 | whiteheadandlow.com | Tucows Domains Inc. | 26 Apr 2024 | 26 Apr 2024 | 26 Apr 2025 |
| 217 | whitehead-construction.com | Tucows Domains Inc. | 10 Apr 2012 | 14 Apr 2017 | 10 Apr 2017 |
| 218 | whiteheadswrecker.com | Vitalwerks Internet Solutions, LLC DBA No-IP | 18 Apr 2016 | 19 Mar 2024 | 18 Apr 2025 |
| 219 | whiteheadstimber.com | TurnCommerce, Inc. DBA NameBright.com | 12 Jul 2017 | 13 Aug 2024 | 12 Jul 2024 |
| 220 | whiteheadwedding.com | eNom, Inc. | 4 May 2024 | 4 May 2024 | 4 May 2025 |
| 221 | whiteheadmanortest.com | Domain.com, LLC | 28 Apr 2016 | 13 Apr 2017 | 28 Apr 2018 |
| 222 | whiteheadtreecare.com | GoDaddy.com, LLC | 2 May 2016 | 3 May 2024 | 2 May 2025 |
| 223 | whiteheadfreightdispatch.com | Gandi SAS | 4 May 2016 | 4 May 2016 | 4 May 2017 |
| 224 | whiteheadlawncare.com | Tucows Domains Inc. | 11 May 2014 | 11 May 2014 | 11 May 2017 |
| 225 | whiteheadsoils.com | Tucows Domains Inc. | 25 May 2016 | 29 May 2017 | 25 May 2017 |
| 226 | whiteheadcomms.com | Tucows Domains Inc. | 30 May 2012 | 30 May 2012 | 30 May 2017 |
| 227 | whiteheadholdings.net | GoDaddy.com, LLC | 5 Jun 2016 | 5 Jun 2016 | 5 Jun 2017 |
| 228 | whiteheadholdings.info | GoDaddy.com, LLC | 5 Jun 2016 | 6 Jun 2017 | 5 Jun 2018 |
| 229 | whiteheadholdings.com | GoDaddy.com, LLC | 5 Jun 2016 | 5 Jun 2016 | 5 Jun 2017 |
| 230 | whiteheadholdings.org | GoDaddy.com, LLC | 5 Jun 2016 | 6 Jun 2017 | 5 Jun 2018 |
| 231 | whiteheadconstruction.com | GoDaddy.com, LLC | 6 May 1999 | 7 May 2024 | 6 May 2025 |
| 232 | whiteheadsmatter.com | GoDaddy.com, LLC | 15 Jun 2016 | 15 Jun 2016 | 15 Jun 2017 |
| 233 | whiteheadmichaelwedding.com | Tucows Domains Inc. | 15 Jun 2016 | 3 Jun 2017 | 15 Jun 2018 |
| 234 | whiteheadscreations.com | Tucows Domains Inc. | 19 Jun 2012 | 23 Jun 2019 | 19 Jun 2019 |
| 235 | whiteheadphotos.com | Tucows Domains Inc. | 17 Jun 2013 | 17 Jun 2013 | 17 Jun 2017 |
| 236 | whiteheadandhoag.com | NameCheap, Inc. | 20 Jun 2016 | 22 May 2024 | 20 Jun 2025 |
| 237 | whiteheadconstructiontx.net | GoDaddy.com, LLC | 5 Jul 2016 | 5 Jul 2016 | 5 Jul 2017 |
| 238 | whitehead-bangalore.in | - | 11 Sep 2016 | 12 Sep 2017 | 11 Sep 2018 |
| 239 | whiteheadperformance.biz | GoDaddy.com, LLC | 24 Aug 2011 | 29 Aug 2017 | 23 Aug 2020 |
| 240 | whiteheads.biz | Tucows Domains Inc. | 22 Mar 2012 | 26 Feb 2025 | 21 Mar 2026 |
| 241 | whiteheadconsulting.info | Network Solutions, LLC | 29 Jul 2016 | 10 Sep 2017 | 29 Jul 2018 |
| 242 | whiteheadadlinks.com | - | 31 Jul 2016 | 31 Jul 2016 | 31 Jul 2018 |
| 243 | whiteheadcoaching.com | register.com, Inc. | 31 Oct 2011 | 28 Oct 2022 | 31 Oct 2027 |
| 244 | whiteheadfamilylaw.com | - | 2 Aug 2016 | 2 Aug 2016 | 2 Aug 2017 |
| 245 | whitehead-racing.com | - | 4 Aug 2016 | 4 Aug 2016 | 4 Aug 2018 |
| 246 | whiteheadwavily.date | NameCheap, Inc. | 14 Aug 2016 | 14 Aug 2017 | 13 Aug 2017 |
| 247 | whiteheadsbawds.host | NameCheap, Inc. | 14 Aug 2016 | 19 Sep 2017 | 14 Aug 2017 |
| 248 | whiteheadfinancial.com | GoDaddy.com, LLC | 9 Feb 2019 | 10 Feb 2024 | 9 Feb 2026 |
| 249 | whiteheadweedery.com | - | 18 Aug 2016 | 18 Aug 2016 | 18 Aug 2017 |
| 250 | whiteheadhome.space | Network Solutions, LLC | 18 Aug 2016 | 30 Sep 2017 | 18 Aug 2017 |
| 251 | whiteheadgasservices.co.uk | register.com, Inc. | 25 May 2023 | 25 May 2023 | 25 May 2024 |
| 252 | whiteheadsonnose.net | LCN.COM Ltd. | 5 Sep 2016 | 5 Sep 2017 | 5 Sep 2018 |
| 253 | whiteheadorthodontics.com | TurnCommerce, Inc. DBA NameBright.com | 16 Aug 2012 | 15 Jul 2020 | 7 Aug 2025 |
| 254 | whiteheadchiro.com | register.com, Inc. | 10 Jul 1998 | 10 Jul 2024 | 9 Jul 2025 |
| 255 | whiteheadroad.com | eNom, Inc. | 15 Sep 2016 | 28 Oct 2017 | 15 Sep 2017 |
| 256 | whiteheadhomes.com | register.com, Inc. | 13 Sep 2021 | 14 Oct 2024 | 13 Sep 2029 |
| 257 | whiteheadevents.com | Tucows Domains Inc. | 26 Sep 2016 | 30 Sep 2020 | 26 Sep 2020 |
| 258 | whiteheadpsycologue.com | OVH sas | 28 Sep 2016 | 28 Sep 2016 | 28 Sep 2017 |
| 259 | whitehead-iyy.com | Network Solutions, LLC | 6 Oct 2016 | 6 Oct 2017 | 6 Oct 2018 |
| 260 | whiteheadappraisals.com | GoDaddy.com, LLC | 6 Oct 2016 | 9 Jan 2024 | 6 Oct 2027 |
| 261 | whiteheadcreative.com | GoDaddy.com, LLC | 22 Jun 2006 | 23 Jun 2024 | 22 Jun 2025 |
| 262 | whitehead-insurance.com | GoDaddy.com, LLC | 1 May 2003 | 2 May 2024 | 1 May 2025 |
| 263 | whiteheadinsurance.com | GoDaddy.com, LLC | 11 Apr 1999 | 5 Sep 2024 | 11 Apr 2025 |
| 264 | whiteheadsfishandchips.com | eNom, Inc. | 27 Mar 2014 | 15 Dec 2024 | 27 Mar 2026 |
| 265 | whiteheadbunch.com | Network Solutions, LLC | 27 May 2007 | 28 Mar 2025 | 27 May 2026 |
| 266 | whiteheadit.com | Tucows Domains Inc. | 25 Jun 2009 | 25 Mar 2024 | 25 Jun 2025 |
| 267 | whiteheadroe.com | Webfusion Ltd. | 23 Apr 2010 | 24 Apr 2024 | 23 Apr 2025 |
| 268 | whiteheadchioccalaw.com | GoDaddy.com, LLC | 7 May 2009 | 11 Sep 2022 | 7 May 2026 |
| 269 | whiteheadsestateagents.com | GoDaddy.com, LLC | 10 Mar 2011 | 11 Mar 2025 | 10 Mar 2027 |
| 270 | whiteheadfineart.com | Wix.com Ltd. | 5 Aug 2019 | 6 Jul 2024 | 5 Aug 2025 |
| 271 | whiteheadranches.com | eNom, Inc. | 23 Nov 2009 | 25 Oct 2024 | 23 Nov 2025 |
| 272 | whiteheadsonface.com | TurnCommerce, Inc. DBA NameBright.com | 13 May 2012 | 25 Jul 2024 | 13 May 2024 |
| 273 | whiteheadvhoudini.com | Tucows Domains Inc. | 1 Feb 2009 | 25 Jan 2025 | 1 Feb 2026 |
| 274 | whiteheadelectrical.com | Tucows Domains Inc. | 9 Aug 2024 | 16 Jan 2025 | 9 Aug 2025 |
| 275 | whiteheadphones.com | Name.com, Inc. | 22 Nov 2007 | 1 Jan 2025 | 22 Nov 2025 |
| 276 | whitehead-john.com | DomainPeople, Inc. | 28 Oct 2000 | 13 Mar 2025 | 28 Oct 2030 |
| 277 | whiteheadtrust.com | NameCheap, Inc. | 3 Sep 2017 | 4 Aug 2024 | 3 Sep 2025 |
| 278 | whiteheadconferencecenter.com | Network Solutions, LLC | 1 Jul 2008 | 2 May 2024 | 1 Jul 2025 |
| 279 | whiteheadeaglephoto.com | GoDaddy.com, LLC | 1 Feb 2010 | 2 Feb 2016 | 1 Feb 2018 |
| 280 | whiteheadpaintandsupply.com | GoDaddy.com, LLC | 10 Jun 2009 | 5 Jun 2015 | 21 Aug 2020 |
| 281 | whiteheadmanagement.com | GoDaddy.com, LLC | 18 Feb 2013 | 30 Aug 2023 | 29 Aug 2028 |
| 282 | whiteheadweb.com | Network Solutions, LLC | 28 Jul 1999 | 28 Jul 2020 | 28 Jul 2030 |
| 283 | whiteheadlawllc.com | NameCheap, Inc. | 29 Jul 2008 | 2 Jul 2024 | 29 Jul 2025 |
| 284 | whiteheadmotorsonline.com | GoDaddy.com, LLC | 27 Jun 2012 | 11 Sep 2022 | 27 Jun 2027 |
| 285 | whiteheadenterprisesltd.com | Wild West Domains, LLC | 4 Oct 2009 | 4 Oct 2016 | 4 Oct 2017 |
| 286 | whiteheadthinktank.com | GoDaddy.com, LLC | 16 Jun 2003 | 17 Jun 2024 | 16 Jun 2025 |
| 287 | whiteheadtelecomessay.com | GoDaddy.com, LLC | 9 Sep 2009 | 6 Sep 2022 | 9 Sep 2026 |
| 288 | whiteheadrealestate.com | Network Solutions, LLC | 23 Dec 2011 | 4 Dec 2024 | 23 Dec 2025 |
| 289 | whiteheadconcretepumping.com | Tucows Domains Inc. | 19 Apr 2008 | 21 Mar 2025 | 19 Apr 2026 |
| 290 | whitehead-electric.com | Network Solutions, LLC | 21 Jan 2004 | 27 Nov 2024 | 21 Jan 2028 |
| 291 | whiteheadcapital.com | GoDaddy.com, LLC | 20 Feb 2018 | 21 Feb 2025 | 20 Feb 2026 |
| 292 | whiteheadpaint.com | GoDaddy.com, LLC | 21 Aug 2006 | 5 Jun 2015 | 21 Aug 2020 |
| 293 | whiteheadtutorial.com | GoDaddy.com, LLC | 1 Nov 2010 | 1 Nov 2015 | 1 Nov 2016 |
| 294 | whiteheademail.com | Google, Inc. | 16 Jun 2012 | 2 Jun 2024 | 16 Jun 2025 |
| 295 | whiteheadenergy.com | TurnCommerce, Inc. DBA NameBright.com | 1 Dec 2019 | 26 Aug 2021 | 1 Dec 2024 |
| 296 | whiteheadalloys.com | 1API GmbH | 28 Jun 2004 | 14 May 2024 | 28 Jun 2026 |
| 297 | whiteheaddiecast.com | Network Solutions, LLC | 28 Oct 1997 | 5 Feb 2025 | 27 Oct 2026 |
| 298 | whiteheadranch.com | eNom, Inc. | 20 Mar 2007 | 19 Mar 2025 | 20 Mar 2026 |
| 299 | whiteheadsmedia.com | FastDomain Inc. | 27 Nov 2012 | 13 Nov 2017 | 27 Nov 2018 |
| 300 | whiteheaddesignworkshop.com | 1&1 Internet AG | 1 Jul 2009 | 2 Jul 2016 | 1 Jul 2017 |
| 301 | whiteheadinsurancewichitaks.com | Tucows Domains Inc. | 14 Mar 2014 | 18 Mar 2019 | 14 Mar 2019 |
| 302 | whiteheadmaloney.com | eNom, Inc. | 5 Aug 2013 | 16 Sep 2016 | 5 Aug 2016 |
| 303 | whiteheadginseng.com | Rebel.com Corp. | 2 Mar 2005 | 17 Jan 2025 | 2 Mar 2026 |
| 304 | whiteheadplumbing.com | GoDaddy.com, LLC | 7 Apr 2009 | 8 Apr 2024 | 7 Apr 2025 |
| 305 | whiteheadsltd.com | Cronon AG | 15 Feb 2025 | 16 Feb 2025 | 15 Feb 2026 |
| 306 | whiteheadmanor.com | Network Solutions, LLC | 14 Aug 2005 | 10 Oct 2024 | 14 Aug 2025 |
| 307 | whiteheadortho.com | GoDaddy.com, LLC | 16 Mar 2005 | 20 Feb 2024 | 16 Mar 2026 |
| 308 | whiteheadproperty.com | GoDaddy.com, LLC | 29 Aug 2013 | 10 Oct 2023 | 29 Aug 2023 |
| 309 | whitehead-japan.com | Japan Registry Services Co., Ltd. | 20 Dec 2008 | 25 Oct 2024 | 20 Dec 2025 |
| 310 | whiteheadrealtyonline.com | GoDaddy.com, LLC | 21 Apr 2009 | 22 Apr 2023 | 21 Apr 2025 |
| 311 | whiteheadbay.com | GoDaddy.com, LLC | 14 Mar 2013 | 30 Sep 2024 | 29 Sep 2025 |
| 312 | whiteheadpapers.com | GoDaddy.com, LLC | 15 Feb 2001 | 15 Feb 2016 | 15 Feb 2017 |
| 313 | whitehead-studios.com | Tucows Domains Inc. | 24 Feb 2014 | 9 Feb 2025 | 24 Feb 2026 |
| 314 | whiteheadmotorsnj.com | GoDaddy.com, LLC | 10 Jul 2009 | 11 Jul 2024 | 10 Jul 2026 |
| 315 | whiteheadfarmmi.com | Domain.com, LLC | 1 Mar 2010 | 9 Feb 2025 | 1 Mar 2026 |
| 316 | whiteheadboard.com | Beijing Lanhai Jiye Technology Co., Ltd | 23 Nov 2022 | 24 Nov 2024 | 23 Nov 2025 |
| 317 | whiteheadtire.com | Tucows Domains Inc. | 22 Jul 2014 | 8 Jul 2024 | 22 Jul 2025 |
| 318 | whiteheadlandscaping.com | 101domain, Inc. | 11 Mar 2005 | 30 Jan 2023 | 11 Mar 2032 |
| 319 | whiteheadgolfclub.com | GoDaddy.com, LLC | 9 May 2005 | 10 May 2024 | 9 May 2025 |
| 320 | whitehead-wonders.com | 1&1 Internet AG | 12 Dec 2012 | 13 Dec 2016 | 12 Dec 2017 |
| 321 | whiteheaddesigns.com | Webfusion Ltd. | 17 Nov 2000 | 18 Nov 2024 | 17 Nov 2025 |
| 322 | whiteheadnorthernireland.com | eNom, Inc. | 12 Mar 2013 | 11 Feb 2017 | 12 Mar 2018 |
| 323 | whiteheadelectric.com | Network Solutions, LLC | 27 Jan 1999 | 28 Nov 2020 | 27 Jan 2026 |
| 324 | whiteheadcompanies.com | GoDaddy.com, LLC | 26 May 2013 | 2 May 2015 | 26 May 2021 |
| 325 | whiteheadz.com | Crazy Domains FZ-LLC | 24 Oct 2018 | 16 Oct 2023 | 24 Oct 2025 |
| 326 | whiteheadfam.com | GoDaddy.com, LLC | 7 Sep 2010 | 8 Sep 2024 | 7 Sep 2025 |
| 327 | whitehead85.com | 1&1 Internet AG | 6 Jul 2011 | 14 Apr 2018 | 6 Jul 2025 |
| 328 | whiteheadhoag.com | eNom, Inc. | 24 Dec 2004 | 24 Jan 2017 | 24 Dec 2017 |
| 329 | whiteheads-wind.com | united-domains AG | 2 Feb 2010 | 6 Feb 2025 | 2 Feb 2026 |
| 330 | whiteheadbros.com | 1&1 Internet AG | 2 Apr 2012 | 3 Apr 2016 | 2 Apr 2017 |
| 331 | whiteheadfarms.com | Network Solutions, LLC | 17 Jan 2008 | 4 Dec 2024 | 17 Jan 2026 |
| 332 | whiteheadwellnesscenter.com | FastDomain Inc. | 3 Jun 2023 | 21 Jun 2023 | 3 Jun 2023 |
| 333 | whiteheadmarketing.com | GoDaddy.com, LLC | 20 Feb 2014 | 21 Feb 2025 | 20 Feb 2027 |
| 334 | whiteheadperformanceblog.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 335 | whiteheadeagle.com | FastDomain Inc. | 17 Mar 2017 | 14 Feb 2025 | 17 Mar 2026 |
| 336 | whiteheadrealtors.com | GoDaddy.com, LLC | 8 Jun 2021 | 13 Feb 2025 | 8 Jun 2025 |
| 337 | whiteheadclub.com | - | 14 Sep 2024 | 14 Sep 2024 | 14 Sep 2025 |
| 338 | whitehead-fencing.com | Wild West Domains, LLC | 29 Oct 2009 | 20 Oct 2015 | 29 Oct 2016 |
| 339 | whiteheadyoung.com | eNom, Inc. | 5 Jan 2012 | 14 Mar 2017 | 5 Jan 2018 |
| 340 | whiteheadlegal.com | Tucows Domains Inc. | 9 Jun 2006 | 11 May 2024 | 9 Jun 2025 |
| 341 | whiteheadconst.com | Tucows Domains Inc. | 25 Sep 2003 | 23 Aug 2023 | 25 Sep 2025 |
| 342 | whiteheadcattle.com | Blacknight Internet Solutions Ltd. | 22 Aug 2018 | 17 Aug 2024 | 22 Aug 2025 |
| 343 | whiteheadtattoo.com | eNom, Inc. | 1 Apr 2011 | 9 Mar 2020 | 1 Apr 2029 |
| 344 | whiteheadsafety.com | Network Solutions, LLC | 20 Aug 2011 | 21 Jun 2021 | 20 Aug 2026 |
| 345 | whitehead-gustave.com | Cronon AG | 29 Nov 2003 | 19 Jan 2025 | 29 Nov 2025 |
| 346 | whiteheadwonders.com | 1&1 Internet AG | 26 Nov 2012 | 14 Apr 2018 | 26 Nov 2020 |
| 347 | whiteheadchevrolet.com | GoDaddy.com, LLC | 22 Jan 2022 | 30 Aug 2023 | 22 Jan 2026 |
| 348 | whiteheadconsulting.com | Annulet LLC | 20 Feb 2013 | 8 Apr 2024 | 20 Feb 2025 |
| 349 | whitehead-group.com | Register.it SPA | 15 Apr 2014 | 4 Jun 2024 | 15 Apr 2026 |
| 350 | whiteheadfoundation.com | - | 8 Sep 2024 | 14 Feb 2025 | 8 Sep 2025 |
| 351 | whiteheadarts.com | GoDaddy.com, LLC | 16 Sep 2007 | 17 Sep 2016 | 16 Sep 2017 |
| 352 | whitehead-ni.com | NameCheap, Inc. | 23 Jan 2002 | 24 Dec 2024 | 23 Jan 2026 |
| 353 | whiteheadtm.com | DiaMatrix C.C. | 2 Feb 2014 | 22 Jan 2025 | 2 Feb 2026 |
| 354 | whiteheadcpa.com | Tucows Domains Inc. | 20 May 2004 | 6 May 2024 | 20 May 2025 |
| 355 | whiteheadmotorsports.com | NameKing.com Inc. | 26 May 2010 | 9 Aug 2024 | 26 May 2024 |
| 356 | whiteheadco.com | GoDaddy.com, LLC | 24 Mar 2013 | 13 Sep 2022 | 12 Apr 2027 |
| 357 | whiteheadenergysolutions.com | - | 9 Jul 2024 | 9 Jul 2024 | 9 Jul 2025 |
| 358 | whiteheadlandclearing.com | Google, Inc. | 12 Dec 2007 | 27 Nov 2024 | 12 Dec 2025 |
| 359 | whiteheadandco.com | GoDaddy.com, LLC | 30 Jun 2000 | 5 Sep 2022 | 30 Jun 2027 |
| 360 | whitehead-gesellschaft.com | 1&1 Internet AG | 4 Mar 2010 | 5 Mar 2017 | 4 Mar 2018 |
| 361 | whiteheadmg.com | GoDaddy.com, LLC | 17 Oct 2017 | 29 Dec 2024 | 17 Oct 2024 |
| 362 | whiteheadconstructiontx.com | Wild West Domains, LLC | 10 Jul 2007 | 10 Jul 2017 | 10 Jul 2018 |
| 363 | whitehead-lausmann.com | 1&1 Internet AG | 18 Jul 2001 | 30 Dec 2020 | 18 Jul 2025 |
| 364 | whiteheadassociates.com | Network Solutions, LLC | 18 Feb 1999 | 20 Dec 2022 | 18 Feb 2026 |
| 365 | whiteheadperformancesite.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 366 | whiteheadappeldesign.com | GoDaddy.com, LLC | 17 Apr 2007 | 31 Mar 2012 | 17 Apr 2017 |
| 367 | whiteheadscanesyrup.com | FastDomain Inc. | 1 Dec 2002 | 9 Jun 2024 | 24 Jun 2025 |
| 368 | whiteheadreo.com | GoDaddy.com, LLC | 10 Dec 2010 | 16 Dec 2015 | 15 Dec 2016 |
| 369 | whiteheadfirm.com | Vautron Rechenzentrum AG | 2 Jan 2004 | 3 Dec 2024 | 2 Jan 2026 |
| 370 | whiteheadsletting.com | Webfusion Ltd. | 2 Apr 2013 | 26 Mar 2017 | 2 Apr 2018 |
| 371 | whiteheadedrobin.com | GoDaddy.com, LLC | 20 Jan 2012 | 20 Jan 2015 | 20 Jan 2017 |
| 372 | whiteheadfamilyproductions.com | Launchpad, Inc. | 18 Oct 2013 | 16 Oct 2015 | 18 Oct 2016 |
| 373 | whiteheadfamilysingers.com | 1&1 Internet AG | 23 Jul 2011 | 23 Jul 2016 | 23 Jul 2018 |
| 374 | whiteheadsgroup.com | TurnCommerce, Inc. DBA NameBright.com | 7 Aug 2022 | 1 Aug 2023 | 7 Aug 2025 |
| 375 | whiteheadmediation.com | GoDaddy.com, LLC | 21 Jan 2022 | 4 Mar 2025 | 21 Jan 2025 |
| 376 | whiteheadbirdandmiles.com | Network Solutions, LLC | 8 Aug 2014 | 5 Aug 2017 | 8 Aug 2019 |
| 377 | whiteheadpianoservices.com | Realtime Register B.V. | 10 Jun 2022 | 22 Jul 2023 | 10 Jun 2023 |
| 378 | whiteheadlawsc.com | NameCheap, Inc. | 17 Oct 2011 | 17 Sep 2024 | 17 Oct 2025 |
| 379 | whiteheadsignsllc.com | Tucows Domains Inc. | 6 Jan 2012 | 10 Jan 2018 | 6 Jan 2018 |
| 380 | whiteheadsflowers.com | NameCheap, Inc. | 19 Jun 2023 | 20 May 2024 | 19 Jun 2025 |
| 381 | whiteheadracing.com | GoDaddy.com, LLC | 13 Apr 2013 | 13 Apr 2024 | 13 Apr 2025 |
| 382 | whiteheadmail.com | Tucows Domains Inc. | 17 Aug 2006 | 21 Aug 2018 | 17 Aug 2028 |
| 383 | whiteheadinvestments.com | GoDaddy.com, LLC | 16 Dec 2023 | 16 Dec 2023 | 16 Dec 2026 |
| 384 | whiteheadperformanceshop.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 385 | whiteheadperformancenow.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 386 | whiteheadsdevelopment.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Dec 2013 | 30 Nov 2015 | 23 Dec 2016 |
| 387 | whiteheadmediaventures.com | GoDaddy.com, LLC | 1 Apr 2008 | 1 Apr 2024 | 1 Apr 2025 |
| 388 | whiteheadlawmd.com | GoDaddy.com, LLC | 3 Oct 2013 | 4 Oct 2024 | 3 Oct 2025 |
| 389 | whiteheadts.com | Tucows Domains Inc. | 20 Jun 2013 | 24 Jun 2020 | 20 Jun 2020 |
| 390 | whiteheaddesign.com | GoDaddy.com, LLC | 12 Apr 2002 | 1 Apr 2024 | 12 Apr 2026 |
| 391 | whiteheadmiller.com | GoDaddy.com, LLC | 18 Mar 2009 | 18 Mar 2025 | 18 Mar 2027 |
| 392 | whitehead-consulting.com | GoDaddy.com, LLC | 17 Sep 2009 | 18 Sep 2024 | 17 Sep 2025 |
| 393 | whiteheadperformances.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 394 | whiteheadancestry.com | Realtime Register B.V. | 23 May 2024 | 26 Nov 2024 | 23 May 2025 |
| 395 | whiteheadsales.com | GoDaddy.com, LLC | 26 May 2010 | 27 May 2024 | 26 May 2026 |
| 396 | whiteheadlawde.com | GoDaddy.com, LLC | 3 Oct 2013 | 4 Oct 2024 | 3 Oct 2025 |
| 397 | whiteheadproperties.com | GoDaddy.com, LLC | 29 Aug 2013 | 15 Oct 2024 | 29 Aug 2025 |
| 398 | whiteheadslet.com | Webfusion Ltd. | 29 Jan 2013 | 22 Jan 2017 | 29 Jan 2018 |
| 399 | whiteheadnetwork.com | easyDNS Technologies, Inc. | 27 Aug 1998 | 25 Jun 2024 | 26 Aug 2026 |
| 400 | whiteheadbusinesssolutions.com | GoDaddy.com, LLC | 5 Jun 2012 | 6 Jun 2024 | 5 Jun 2025 |
| 401 | whiteheadhardware.com | Network Solutions, LLC | 20 Aug 2011 | 21 Jun 2021 | 20 Aug 2026 |
| 402 | whiteheadtaxes.com | GoDaddy.com, LLC | 2 Jan 2014 | 3 Jan 2024 | 2 Jan 2026 |
| 403 | whitehead-elderlaw.com | GoDaddy.com, LLC | 13 Dec 2004 | 1 Feb 2025 | 13 Dec 2025 |
| 404 | whiteheadfloors.com | GoDaddy.com, LLC | 16 Mar 2007 | 30 Sep 2022 | 16 Mar 2027 |
| 405 | whiteheadaircraft.com | GoDaddy.com, LLC | 27 Aug 2006 | 23 Aug 2024 | 27 Aug 2025 |
| 406 | whiteheadliterature.com | GoDaddy.com, LLC | 27 Aug 2013 | 27 Aug 2016 | 27 Aug 2017 |
| 407 | whiteheadusa.com | FastDomain Inc. | 14 Aug 2000 | 14 Aug 2016 | 14 Aug 2017 |
| 408 | whiteheadgag.com | GoDaddy.com, LLC | 29 Aug 2012 | 1 Oct 2024 | 30 Sep 2025 |
| 409 | whiteheadcarvings.com | GoDaddy.com, LLC | 10 Oct 2001 | 1 Nov 2024 | 10 Oct 2025 |
| 410 | whiteheadphotography.com | Annulet LLC | 13 Jan 2012 | 2 Mar 2025 | 13 Jan 2026 |
| 411 | whiteheadhomeandenergy.com | Tucows Domains Inc. | 17 May 2011 | 18 Apr 2024 | 17 May 2025 |
| 412 | whiteheadincga.com | GoDaddy.com, LLC | 17 Jul 2014 | 18 Jul 2016 | 17 Jul 2017 |
| 413 | whiteheadboards.com | Epik Inc. | 21 Aug 2011 | 27 Aug 2017 | 21 Aug 2018 |
| 414 | whitehead-enterprises.com | GoDaddy.com, LLC | 3 Jun 2024 | 3 Jun 2024 | 3 Jun 2025 |
| 415 | whiteheadbrothers.com | GoDaddy.com, LLC | 28 Mar 2008 | 29 Mar 2024 | 28 Mar 2025 |
| 416 | whitehead-realty.com | GoDaddy.com, LLC | 14 Sep 2012 | 15 Sep 2024 | 14 Sep 2025 |
| 417 | whiteheadartisanstudios.com | Domain.com, LLC | 4 Nov 2013 | 7 Nov 2017 | 4 Nov 2017 |
| 418 | whiteheadvt.com | FastDomain Inc. | 30 Sep 2011 | 14 Sep 2024 | 30 Sep 2025 |
| 419 | whiteheadcommercial.com | Tucows Domains Inc. | 19 Nov 2024 | 19 Nov 2024 | 19 Nov 2025 |
| 420 | whiteheadrecording.com | NetEarth One Inc. d/b/a NetEarth | 3 Sep 2006 | 18 Jun 2024 | 3 Sep 2025 |
| 421 | whitehead-performance.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 422 | whiteheadpouredwalls.com | Domain.com, LLC | 25 Mar 2002 | 5 Mar 2025 | 25 Mar 2026 |
| 423 | whiteheadroadrace.com | eNom, Inc. | 24 Jul 2013 | 25 Jun 2017 | 24 Jul 2018 |
| 424 | whiteheadrealty.com | GoDaddy.com, LLC | 13 Mar 1998 | 12 Mar 2025 | 12 Mar 2026 |
| 425 | whiteheadstreet.com | Tucows Domains Inc. | 20 Apr 2017 | 24 Apr 2018 | 20 Apr 2018 |
| 426 | whiteheadautosales.com | GoDaddy.com, LLC | 3 Aug 2012 | 4 Aug 2024 | 3 Aug 2025 |
| 427 | whiteheadfestival.com | eNom, Inc. | 15 Jul 2013 | 1 Jul 2017 | 15 Jul 2018 |
| 428 | whiteheadperformanceonline.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 429 | whiteheadlawgroup.com | - | 7 Mar 2022 | 7 Mar 2022 | 7 Mar 2023 |
| 430 | whiteheadmotors.com | GoDaddy.com, LLC | 7 May 2009 | 8 May 2024 | 7 May 2025 |
| 431 | whiteheadre.com | GoDaddy.com, LLC | 13 Jan 2010 | 9 Aug 2023 | 13 Jan 2027 |
| 432 | whiteheadproductions.com | Webfusion Ltd. | 4 Sep 2012 | 7 Dec 2024 | 4 Sep 2028 |
| 433 | whiteheadstreatment.com | GoDaddy.com, LLC | 6 Jun 2013 | 1 Jun 2024 | 6 Jun 2025 |
| 434 | whiteheadagency.com | TurnCommerce, Inc. DBA NameBright.com | 10 Sep 2017 | 4 Sep 2020 | 10 Sep 2025 |
| 435 | whitehead-hancock.com | GoDaddy.com, LLC | 25 Jan 2000 | 28 Dec 2023 | 25 Jan 2026 |
| 436 | whiteheadgallery.com | Tucows Domains Inc. | 28 Mar 2004 | 14 Mar 2025 | 28 Mar 2026 |
| 437 | whiteheadgroup.com | Google, Inc. | 28 Jul 2005 | 13 Jul 2024 | 28 Jul 2025 |
| 438 | whiteheadlandsurveying.com | Tucows Domains Inc. | 18 Jan 2007 | 22 Jan 2018 | 18 Jan 2018 |
| 439 | whitehead2015.com | Wild West Domains, LLC | 24 Jul 2013 | 25 Jul 2016 | 24 Jul 2017 |
| 440 | whiteheadacne.com | GoDaddy.com, LLC | 30 Sep 2010 | 1 Oct 2024 | 30 Sep 2025 |
| 441 | whitehead-family.com | 1&1 Internet AG | 22 Oct 2005 | 23 Oct 2016 | 22 Oct 2018 |
| 442 | whiteheadbuildingservices.com | Tucows Domains Inc. | 15 Jun 2009 | 16 May 2024 | 15 Jun 2025 |
| 443 | whiteheadfabrication.com | FastDomain Inc. | 16 Aug 2011 | 18 Sep 2016 | 16 Aug 2016 |
| 444 | whiteheadenterprises.com | Dynadot, LLC | 25 Jul 2024 | 25 Jul 2024 | 25 Jul 2025 |
| 445 | whiteheadedrobinwinery.com | Namesilo, LLC | 2 Mar 2018 | 3 Mar 2018 | 2 Mar 2019 |
| 446 | whiteheadfoodequipment.com | GoDaddy.com, LLC | 1 Sep 2003 | 8 Sep 2022 | 1 Sep 2029 |
| 447 | whiteheadforcongress.com | NameCheap, Inc. | 16 Feb 2007 | 27 Mar 2025 | 16 Feb 2026 |
| 448 | whiteheadmanorconferencecenter.com | Network Solutions, LLC | 16 Dec 2008 | 17 Oct 2021 | 16 Dec 2026 |
| 449 | whiteheadtelecom.com | GoDaddy.com, LLC | 3 Sep 2009 | 6 Sep 2022 | 10 Sep 2026 |
| 450 | whiteheadperformancestore.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 451 | whiteheadauto.com | NameCheap, Inc. | 23 Apr 1998 | 23 Mar 2025 | 22 Apr 2026 |
| 452 | whiteheadherefords.com | Tucows Domains Inc. | 6 Jan 2004 | 7 Nov 2024 | 6 Jan 2026 |
| 453 | whiteheadresearch.com | NameCheap, Inc. | 8 Feb 2007 | 8 Mar 2024 | 8 Feb 2026 |
| 454 | whiteheadhome.com | GoDaddy.com, LLC | 14 Aug 2006 | 15 Aug 2024 | 14 Aug 2027 |
| 455 | whiteheadslettings.com | DropCatch.com 587 LLC | 28 May 2017 | 16 Jul 2017 | 28 May 2018 |
| 456 | whiteheadmotorscredit.com | GoDaddy.com, LLC | 13 Jun 2013 | 14 Jun 2024 | 13 Jun 2026 |
| 457 | whiteheadci.com | Webfusion Ltd. | 24 Jan 2011 | 25 Jan 2025 | 24 Jan 2026 |
| 458 | whiteheadlaw.com | Wild West Domains, LLC | 6 Nov 1999 | 7 Nov 2024 | 6 Nov 2025 |
| 459 | whiteheadfarmrealestate.com | Network Solutions, LLC | 21 Oct 2005 | 13 Sep 2024 | 21 Oct 2025 |
| 460 | whiteheadhancockhvacplumbing.com | - | 19 Oct 2011 | 19 Oct 2011 | 19 Oct 2017 |
| 461 | whiteheadhosting.com | Tucows Domains Inc. | 13 Oct 2011 | 30 Sep 2024 | 13 Oct 2025 |
| 462 | whiteheadpropertyservices.com | TierraNet Inc. d/b/a DomainDiscover | 12 May 2010 | 26 May 2016 | 12 May 2017 |
| 463 | whiteheadteam.com | FastDomain Inc. | 5 Jul 2013 | 20 Jun 2024 | 5 Jul 2025 |
| 464 | whiteheadscutlery.com | GoDaddy.com, LLC | 13 Dec 2010 | 14 Dec 2024 | 13 Dec 2025 |
| 465 | whiteheadpianostudio.com | register.com, Inc. | 16 Jan 2014 | 16 Mar 2017 | 16 Jan 2018 |
| 466 | whiteheadboutique.com | GoDaddy.com, LLC | 14 Mar 2014 | 15 Mar 2016 | 14 Mar 2017 |
| 467 | whiteheadperformanceparts.com | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2014 | 24 Aug 2017 |
| 468 | whiteheadhr.com | Tucows Domains Inc. | 22 Feb 2006 | 24 Jan 2025 | 22 Feb 2026 |
| 469 | whiteheadshome.com | Webfusion Ltd. | 5 Dec 2007 | 28 Nov 2015 | 5 Dec 2018 |
| 470 | whitehead-law.com | eNom, Inc. | 24 Aug 2002 | 26 Jul 2024 | 24 Aug 2025 |
| 471 | whiteheadandwhitehead.com | GoDaddy.com, LLC | 17 Feb 2003 | 18 Feb 2025 | 17 Feb 2026 |
| 472 | whiteheadwoodworks.com | GoDaddy.com, LLC | 29 Oct 2013 | 7 Dec 2021 | 29 Oct 2022 |
| 473 | whiteheadgardensociety.com | GMO Internet Inc. | 22 Jun 2020 | 22 Jun 2020 | 22 Jun 2021 |
| 474 | whiteheadinc.com | GoDaddy.com, LLC | 10 Mar 1999 | 10 Mar 2025 | 10 Mar 2026 |
| 475 | whiteheadcattle.info | Blacknight Internet Solutions Ltd. | 19 May 2010 | 28 Apr 2017 | 19 May 2018 |
| 476 | whitehead-consulting.info | GoDaddy.com, LLC | 17 Sep 2009 | 10 Aug 2017 | 17 Sep 2020 |
| 477 | whiteheadgroup.info | Register.it SPA | 8 Oct 2007 | 13 Oct 2023 | 8 Oct 2025 |
| 478 | whiteheadinn.info | GoDaddy.com, LLC | 28 Jan 2014 | 14 Mar 2025 | 28 Jan 2026 |
| 479 | whiteheadperformance.info | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2017 | 24 Aug 2020 |
| 480 | whiteheadphones.info | GoDaddy.com, LLC | 19 Sep 2008 | 1 Oct 2016 | 19 Sep 2017 |
| 481 | whiteheadfamily.info | Tucows Domains Inc. | 8 Apr 2002 | 28 Mar 2025 | 8 Apr 2026 |
| 482 | whiteheads.info | FastDomain Inc. | 26 Jan 2003 | 16 Jan 2025 | 26 Jan 2026 |
| 483 | whiteheadperformance.mobi | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2017 | 24 Aug 2020 |
| 484 | whiteheadimages.com | DropCatch.com 1298 LLC | 30 Dec 2022 | 17 Jan 2025 | 30 Dec 2025 |
| 485 | whiteheadinsurance.net | Dynadot, LLC | 11 Oct 2021 | 11 Oct 2021 | 11 Oct 2022 |
| 486 | whiteheadgroup.net | GoDaddy.com, LLC | 11 Oct 2021 | 12 Oct 2024 | 11 Oct 2027 |
| 487 | whiteheadelectric.net | GoDaddy.com, LLC | 22 Apr 2010 | 7 Sep 2022 | 22 Apr 2025 |
| 488 | whiteheadrealty.net | NameSecure L.L.C. | 17 Jul 2023 | 29 Aug 2024 | 17 Jul 2024 |
| 489 | whiteheadmanagement.net | GoDaddy.com, LLC | 18 Feb 2013 | 30 Aug 2023 | 29 Aug 2028 |
| 490 | whiteheadlaw.net | GoDaddy.com, LLC | 5 Dec 2012 | 3 Dec 2024 | 5 Dec 2026 |
| 491 | whiteheadchevrolet.net | - | 20 Jul 2021 | 22 Jul 2021 | 20 Jul 2022 |
| 492 | whiteheadre.net | GoDaddy.com, LLC | 13 Jan 2010 | 9 Aug 2023 | 13 Jan 2027 |
| 493 | whiteheadins.net | GoDaddy.com, LLC | 14 Mar 2013 | 26 Mar 2024 | 14 Mar 2025 |
| 494 | whitehead-consulting.net | GoDaddy.com, LLC | 17 Sep 2009 | 10 Aug 2017 | 17 Sep 2020 |
| 495 | whitehead-electric.net | Tucows Domains Inc. | 17 Nov 2024 | 4 Dec 2024 | 17 Nov 2025 |
| 496 | whiteheads.net | GoDaddy.com, LLC | 10 Dec 2004 | 20 Nov 2024 | 10 Dec 2025 |
| 497 | whiteheadcattle.net | Blacknight Internet Solutions Ltd. | 19 May 2010 | 28 Apr 2016 | 19 May 2018 |
| 498 | whiteheadinn.net | GoDaddy.com, LLC | 28 Jan 2014 | 29 Jan 2025 | 28 Jan 2026 |
| 499 | whiteheadhome.net | Network Solutions, LLC | 31 Jan 2002 | 2 Dec 2024 | 31 Jan 2026 |
| 500 | whiteheadrealestate.net | Network Solutions, LLC | 21 Oct 2005 | 13 Sep 2024 | 21 Oct 2025 |
| 501 | whiteheadnetwork.net | easyDNS Technologies, Inc. | 13 Nov 2000 | 26 Aug 2024 | 13 Nov 2025 |
| 502 | whiteheadstudios.net | Wild West Domains, LLC | 7 Mar 2012 | 7 Mar 2012 | 7 Mar 2017 |
| 503 | whiteheadfamily.net | Wild West Domains, LLC | 8 Sep 2008 | 8 Sep 2019 | 8 Sep 2020 |
| 504 | whiteheadmotors.net | GoDaddy.com, LLC | 5 Feb 2008 | 8 May 2024 | 7 May 2025 |
| 505 | whiteheadconstruction.net | Wild West Domains, LLC | 9 Apr 2003 | 19 Apr 2023 | 9 Apr 2025 |
| 506 | whiteheadperformance.net | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2017 | 24 Aug 2020 |
| 507 | whitehead-insurance.net | Tucows Domains Inc. | 1 Mar 2011 | 5 Mar 2017 | 1 Mar 2017 |
| 508 | whiteheadfoodequipment.net | GoDaddy.com, LLC | 31 Aug 2003 | 1 Sep 2024 | 31 Aug 2025 |
| 509 | whiteheadconsulting.net | Amazon Registrar, Inc. | 2 Aug 2023 | 28 Jun 2024 | 2 Aug 2025 |
| 510 | whitehead-home.net | eNom, Inc. | 10 Feb 2013 | 31 Jan 2025 | 10 Feb 2026 |
| 511 | whiteheadmuseum.org | FastDomain Inc. | 1 Dec 2008 | 23 Nov 2024 | 1 Dec 2025 |
| 512 | whiteheadcattle.org | Blacknight Internet Solutions Ltd. | 19 May 2010 | 21 Nov 2016 | 19 May 2018 |
| 513 | whitehead-uk.org | register.com, Inc. | 9 Oct 2012 | 12 Oct 2016 | 9 Oct 2017 |
| 514 | whiteheadinn.org | GoDaddy.com, LLC | 28 Jan 2014 | 15 Jan 2017 | 28 Jan 2018 |
| 515 | whiteheadfamily.org | Ascio Technologies, Inc. Danmark - Filial af Ascio… | 2 Aug 2003 | 9 Jun 2024 | 2 Aug 2025 |
| 516 | whiteheadresearch.org | NameCheap, Inc. | 8 Feb 2007 | 13 Mar 2024 | 8 Feb 2026 |
| 517 | whiteheadconferencecenter.org | Network Solutions, LLC | 1 Jul 2008 | 7 May 2024 | 1 Jul 2025 |
| 518 | whiteheadlightstation.org | Wild West Domains, LLC | 26 Mar 2007 | 1 Apr 2025 | 26 Mar 2030 |
| 519 | whiteheadstreatment.org | Namesilo, LLC | 8 May 2011 | 22 Jun 2024 | 8 May 2025 |
| 520 | whiteheads.org | Mesh Digital Limited | 7 Jun 2000 | 19 Jun 2024 | 7 Jun 2025 |
| 521 | whiteheadfilmfestival.org | GoDaddy.com, LLC | 13 Nov 2008 | 2 Jan 2025 | 13 Nov 2025 |
| 522 | whiteheadlaw.org | TurnCommerce, Inc. DBA NameBright.com | 8 May 2001 | 30 Apr 2024 | 8 May 2025 |
| 523 | whiteheadcoop.org | Network Solutions, LLC | 1 Nov 2023 | 1 Nov 2023 | 1 Nov 2024 |
| 524 | whiteheadboards.org | 1&1 Internet AG | 25 Apr 2011 | 26 Apr 2016 | 25 Apr 2017 |
| 525 | whiteheadnetwork.org | easyDNS Technologies, Inc. | 11 Nov 2000 | 24 Aug 2024 | 11 Nov 2025 |
| 526 | whiteheadperformance.org | GoDaddy.com, LLC | 24 Aug 2011 | 25 Aug 2017 | 24 Aug 2020 |
| 527 | whiteheadmann.xxx | - | 1 Dec 2011 | 30 Jan 2012 | 1 Dec 2021 |
| 528 | whitehead40.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 29 Jul 2016 | 1 Jun 2017 |
| 529 | whiteheadbook124.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 530 | whiteheadtony.xyz | OnlineNIC, Inc. | 1 Jun 2016 | 29 Jul 2016 | 1 Jun 2017 |
| 531 | whitehead124.xyz | Uniregistrar Corp | 2 Jun 2016 | 23 Sep 2016 | 2 Jun 2017 |
| 532 | whiteheadtool.com | GKG.NET, INC. | 26 Oct 2016 | 26 Oct 2016 | 26 Oct 2019 |
| 533 | whitehead-gesellschaft.de | - | - | 19 Feb 2018 | - |
| 534 | whiteheadgroup.co.nz | - | 22 Feb 2006 | 27 Jan 2025 | - |
| 535 | whiteheadsestateagents.co.uk | - | 10 Sep 2021 | 4 Aug 2024 | 10 Sep 2025 |
| 536 | whitehead-monckton.co.uk | - | 16 Dec 1997 | 15 Dec 2023 | 16 Dec 2028 |
| 537 | whiteheadandaldrich.co.uk | - | 8 Oct 2002 | 14 Jun 2024 | 8 Oct 2026 |
| 538 | whitehead-vizard.co.uk | - | 23 Jun 1999 | 25 May 2024 | 23 Jun 2025 |
| 539 | whiteheadcatering.co.uk | - | 10 Nov 2005 | 10 Nov 2023 | 10 Nov 2025 |
| 540 | whiteheadbowls.co.uk | - | 20 May 2003 | 5 May 2024 | 20 May 2025 |
| 541 | whiteheadbaptist.org.uk | - | 30 Nov 2006 | 31 Oct 2015 | 30 Nov 2016 |
| 542 | whiteheaddental.com | GoDaddy.com, LLC | 31 Oct 2016 | 6 Nov 2023 | 31 Oct 2025 |
| 543 | whiteheadautomotivegroup.com | - | 31 Oct 2016 | 31 Oct 2016 | 31 Oct 2017 |
| 544 | whiteheadps.com | GoDaddy.com, LLC | 1 Nov 2016 | 2 Nov 2024 | 1 Nov 2025 |
| 545 | whiteheadandnash.com | Webfusion Ltd. | 13 Sep 2012 | 5 Sep 2017 | 13 Sep 2018 |
| 546 | whiteheadsgroup.net | Webfusion Ltd. | 17 Aug 2010 | 10 Aug 2019 | 17 Aug 2020 |
| 547 | whiteheadandsons.org | Name.com, Inc. | 17 Nov 2016 | 13 Dec 2017 | 17 Nov 2018 |
| 548 | whiteheadcommercialinteriors.com | 1&1 Internet AG | 14 Dec 2016 | 14 Apr 2018 | 14 Dec 2025 |
| 549 | whiteheadengineering.com | Network Solutions, LLC | 23 Dec 2016 | 24 Oct 2023 | 23 Dec 2025 |
| 550 | whiteheadhousing.com | Network Solutions, LLC | 24 Dec 2016 | 26 Dec 2017 | 24 Dec 2017 |
| 551 | whiteheadrecovery.com | Gandi SAS | 5 Jan 2017 | 6 Jan 2018 | 5 Jan 2018 |
| 552 | whiteheadway.com | 1&1 Internet AG | 14 Jan 2017 | 14 Apr 2018 | 14 Jan 2026 |
| 553 | whiteheadclan.com | Network Solutions, LLC | 23 Dec 2023 | 7 Mar 2025 | 23 Dec 2024 |
| 554 | whiteheadvascsettlement.com | GoDaddy.com, LLC | 25 Jan 2017 | 25 Jan 2017 | 25 Jan 2018 |
| 555 | whiteheadinstitute.com | GoDaddy.com, LLC | 2 Feb 2022 | 3 Feb 2025 | 2 Feb 2026 |
| 556 | whiteheadremover.net | GMO Internet Inc. | 29 Jan 2017 | 4 Jan 2018 | 29 Jan 2019 |
| 557 | whiteheadworldwines.com | GoDaddy.com, LLC | 1 Feb 2017 | 1 Feb 2017 | 1 Feb 2019 |
| 558 | whiteheadtreatment.com | NameCheap, Inc. | 8 Feb 2017 | 9 Feb 2017 | 8 Feb 2018 |
| 559 | whiteheadmotor.com | GoDaddy.com, LLC | 13 Feb 2017 | 13 Feb 2017 | 13 Feb 2018 |
| 560 | whiteheadswastemanagement.co.uk | - | 13 Nov 2020 | 2 Nov 2024 | 13 Nov 2025 |
| 561 | whiteheadfam.net | Automattic Inc. | 4 Mar 2017 | 12 Feb 2025 | 4 Mar 2026 |
| 562 | whiteheadsmot.com | GoDaddy.com, LLC | 18 Mar 2017 | 19 Mar 2025 | 18 Mar 2027 |
| 563 | whiteheadadvascsettlement.com | GoDaddy.com, LLC | 20 Mar 2017 | 20 Mar 2017 | 20 Mar 2018 |
| 564 | whiteheadsmicrogreens.com | GoDaddy.com, LLC | 28 Mar 2017 | 28 Mar 2017 | 28 Mar 2019 |
| 565 | whitehead-planning.co.uk | - | 30 Nov 2011 | 19 May 2017 | 30 Nov 2017 |
| 566 | whiteheaddriverhire.com | GoDaddy.com, LLC | 14 Apr 2017 | 14 Apr 2017 | 14 Apr 2019 |
| 567 | whiteheadbuilders.co.uk | - | 30 Sep 2022 | 15 Oct 2024 | 30 Sep 2024 |
| 568 | whiteheadplanning.co.uk | - | 25 Jan 2024 | 25 Jan 2024 | 25 Jan 2025 |
| 569 | whiteheadsolution.com | Heavydomains.net LLC | 8 Jul 2018 | 9 Jul 2018 | 8 Jul 2019 |
| 570 | whiteheadswed.com | eNom, Inc. | 21 Apr 2017 | 21 Apr 2017 | 21 Apr 2018 |
| 571 | whiteheadfamilyfirst.com | Automattic Inc. | 28 Apr 2017 | 28 Apr 2017 | 28 Apr 2018 |
| 572 | whiteheadhome1881.com | NameCheap, Inc. | 29 Apr 2017 | 30 Mar 2025 | 29 Apr 2026 |
| 573 | whiteheadmackayandassociates.com | GoDaddy.com, LLC | 8 May 2017 | 8 May 2017 | 8 May 2019 |
| 574 | whiteheadplumbing.com.au | - | - | 18 Mar 2025 | - |
| 575 | whiteheadrailwaymuseum.com | eNom, Inc. | 1 Mar 2021 | 22 Feb 2025 | 1 Mar 2027 |
| 576 | whiteheadfuneralservices.com | GoDaddy.com, LLC | 23 May 2017 | 24 May 2024 | 23 May 2025 |
| 577 | whiteheades.com | GoDaddy.com, LLC | 26 May 2017 | 27 May 2024 | 26 May 2025 |
| 578 | whiteheadworldwide.com | GoDaddy.com, LLC | 1 Mar 2022 | 2 Mar 2025 | 1 Mar 2026 |
| 579 | whiteheadrealtyandauction.com | GoDaddy.com, LLC | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 580 | whiteheadnatura.com | Automattic Inc. | 6 Jun 2017 | 20 Jun 2017 | 6 Jun 2019 |
| 581 | whiteheadr.com | register.com, Inc. | 9 Jun 2017 | 9 Jun 2017 | 9 Jun 2018 |
| 582 | whiteheadsportsandsocialclub.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 13 Jun 2017 | 13 Aug 2017 | 13 Jun 2018 |
| 583 | whiteheadinvestigations.com | Name.com, Inc. | 13 Jun 2017 | 13 Jun 2017 | 13 Jun 2018 |
| 584 | whiteheadspedia.com | Namesilo, LLC | 16 Jun 2017 | 8 Feb 2018 | 16 Jun 2018 |
| 585 | whiteheadgames.com | NetArt Registrar Sp. z o.o. | 20 Jun 2017 | 20 Aug 2017 | 20 Jun 2018 |
| 586 | whiteheadfrancis.co.uk | - | 10 Jul 2005 | 27 Jun 2017 | 10 Jul 2018 |
| 587 | whiteheadsystems.com | NameCheap, Inc. | 28 Jun 2017 | 28 Jun 2017 | 28 Jun 2018 |
| 588 | whiteheadrcm.com | Launchpad, Inc. | 28 Jun 2017 | 28 Aug 2017 | 28 Jun 2018 |
| 589 | whiteheads.uk.com | Webfusion Ltd. | 3 Feb 2004 | 9 Jun 2024 | 3 Feb 2029 |
| 590 | whiteheadagency.ca | - | 26 Aug 2011 | 4 Aug 2016 | 26 Aug 2017 |
| 591 | whiteheadelectronics.com | eNom, Inc. | 23 Aug 2017 | 23 Aug 2017 | 23 Aug 2018 |
| 592 | whiteheadoverheels.com | Amazon Registrar, Inc. | 26 Aug 2017 | 26 Aug 2017 | 26 Aug 2018 |
| 593 | whiteheadwaterandwastewater.com | Network Solutions, LLC | 17 Sep 2017 | 17 Sep 2017 | 17 Sep 2018 |
| 594 | whiteheadfoundation.org | Automattic Inc. | 30 Sep 2017 | 21 Sep 2024 | 30 Sep 2025 |
| 595 | whiteheadnorth.com | Key-Systems GmbH | 16 Sep 2016 | 24 Oct 2017 | 16 Sep 2018 |
| 596 | whiteheadmanorconferencecenter.net | Network Solutions, LLC | 3 Nov 2017 | 3 Nov 2017 | 3 Nov 2018 |
| 597 | whiteheadart.com | Network Solutions, LLC | 13 Nov 2017 | 14 Oct 2024 | 13 Nov 2025 |
| 598 | whiteheadsashby.com | Mesh Digital Limited | 20 Nov 2017 | 20 Nov 2017 | 20 Nov 2019 |
| 599 | whiteheadtech.com | TurnCommerce, Inc. DBA NameBright.com | 2 Feb 2022 | 14 Mar 2025 | 2 Feb 2025 |
| 600 | whiteheadsestates.com | TurnCommerce, Inc. DBA NameBright.com | 18 Feb 2022 | 1 May 2024 | 18 Feb 2024 |
| 601 | whiteheadsportspark.com | Uniregistrar Corp | - | - | - |
| 602 | whiteheadpj.com | Google, Inc. | 10 Dec 2017 | 10 Dec 2017 | 10 Dec 2018 |
| 603 | whiteheadcoin.com | Megazone Corp., dba HOSTING.KR | 11 Dec 2017 | 11 Dec 2017 | 11 Dec 2018 |
| 604 | whiteheadenterprise.com | register.com, Inc. | 17 Dec 2017 | 17 Dec 2017 | 17 Dec 2018 |
| 605 | whiteheadfieldtrainingprogram.com | Name.com, Inc. | 30 Dec 2017 | 8 Dec 2024 | 30 Dec 2025 |
| 606 | whiteheadsols.co.uk | - | 24 Feb 2004 | 25 Jan 2025 | 24 Feb 2026 |
| 607 | whiteheadscouts.org.uk | - | 6 Mar 2008 | 5 Mar 2024 | 6 Mar 2026 |
| 608 | whiteheadsgas.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 21 Sep 2011 | 14 Sep 2017 | 21 Sep 2019 |
| 609 | whitehead-architect.co.uk | - | 23 Dec 2001 | 20 Dec 2023 | 23 Dec 2024 |
| 610 | whiteheadspaint2paper.co.uk | - | 2 Nov 2015 | 13 Nov 2015 | 2 Nov 2021 |
| 611 | whiteheadbs.co.uk | - | 20 Sep 2005 | 21 Aug 2024 | 20 Sep 2025 |
| 612 | whiteheadcatering.uk | - | 28 Jul 2017 | 28 Jul 2023 | 28 Jul 2025 |
| 613 | whiteheadm.co.uk | - | 18 Apr 2020 | 15 Jan 2025 | 18 Apr 2025 |
| 614 | whiteheadci.co.uk | - | 24 Jan 2011 | 25 Jan 2025 | 24 Jan 2027 |
| 615 | whiteheadelectricalservices.co.uk | - | 14 Apr 2016 | 30 Jun 2024 | 14 Apr 2026 |
| 616 | whiteheadwedding.co.uk | - | 18 Sep 2024 | 18 Sep 2024 | 18 Sep 2025 |
| 617 | whiteheadconsultancy.co.uk | - | 30 Sep 2014 | 1 Oct 2024 | 30 Sep 2026 |
| 618 | whiteheadma.co.uk | Reserved | 23 Sep 2009 | 22 Sep 2017 | 23 Sep 2019 |
| 619 | whiteheadgolfclub.co.uk | - | 29 Nov 2010 | 28 Nov 2024 | 29 Nov 2025 |
| 620 | whiteheaddesigns.co.uk | - | 15 Jul 2004 | 27 Jul 2024 | 15 Jul 2025 |
| 621 | whiteheadrestoration.co.uk | - | 14 Nov 2014 | 13 Nov 2024 | 14 Nov 2025 |
| 622 | whiteheadmachinery.co.uk | - | 9 Apr 2002 | 4 May 2016 | 9 Apr 2018 |
| 623 | whiteheadandlow.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 24 Sep 2006 | 18 Sep 2016 | 24 Sep 2018 |
| 624 | whiteheaddriverhire.co.uk | - | 14 Apr 2017 | 14 Apr 2017 | 14 Apr 2019 |
| 625 | whiteheadphones.uk | - | 17 Aug 2016 | 10 Aug 2017 | 17 Aug 2018 |
| 626 | whiteheadsportsandsocialclub.co.uk | - | 6 Jun 2017 | 11 Jul 2017 | 6 Jun 2018 |
| 627 | whiteheadcreative.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 10 Jun 2014 | 3 Jun 2016 | 10 Jun 2018 |
| 628 | whiteheadsgas.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 17 Oct 2017 | 28 Nov 2017 | 17 Oct 2019 |
| 629 | whiteheadbaptist.co.uk | - | 21 Nov 2015 | 4 Jul 2024 | 21 Nov 2025 |
| 630 | whiteheadbuildingservices.co.uk | - | 21 Nov 2005 | 22 Oct 2024 | 21 Nov 2025 |
| 631 | whiteheadpresbyterianchurch.co.uk | - | 13 May 2022 | 19 Jun 2023 | 13 May 2024 |
| 632 | whiteheadsbutchers.co.uk | - | 5 Dec 2011 | 4 Dec 2023 | 5 Dec 2025 |
| 633 | whiteheadandnash.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 13 Sep 2012 | 6 Oct 2017 | 13 Sep 2018 |
| 634 | whiteheadforum.co.uk | - | 21 Dec 2017 | 21 Dec 2017 | 21 Dec 2018 |
| 635 | whitehead-uk.co.uk | - | 30 Dec 2009 | 29 Dec 2023 | 30 Dec 2025 |
| 636 | whiteheadalloys.co.uk | - | 8 Jun 2001 | 7 Jun 2023 | 8 Jun 2026 |
| 637 | whiteheadsmot.co.uk | - | 18 Mar 2017 | 19 Mar 2025 | 18 Mar 2027 |
| 638 | whiteheadaudio.co.uk | Reserved | 26 Nov 2017 | 26 Nov 2017 | 26 Nov 2018 |
| 639 | whiteheadphones.co.uk | - | 20 Jan 2010 | 13 Jan 2016 | 20 Jan 2018 |
| 640 | whiteheadbuildingltd.co.uk | - | 2 Aug 2012 | 17 Feb 2025 | 2 Aug 2025 |
| 641 | whiteheadrecruitment.co.uk | - | 28 Jan 2015 | 29 Jan 2025 | 28 Jan 2027 |
| 642 | whiteheadproductions.co.uk | - | 4 Sep 2012 | 7 Dec 2024 | 4 Sep 2027 |
| 643 | whiteheadhallmeadow.org.uk | One.com A/S | 5 Apr 2015 | 6 Mar 2016 | 5 Apr 2018 |
| 644 | whiteheadsdiy.co.uk | - | 21 Sep 2011 | 22 Sep 2024 | 21 Sep 2025 |
| 645 | whiteheadconsultancy.uk | - | 30 Sep 2014 | 1 Oct 2024 | 30 Sep 2026 |
| 646 | whiteheadsadmin.co.uk | - | 18 Aug 2014 | 21 Nov 2016 | 18 Aug 2018 |
| 647 | whiteheadfry.co.uk | eNom, Inc. | 8 Jan 2015 | 14 Dec 2016 | 8 Jan 2019 |
| 648 | whitehead-tribe.me.uk | - | 3 Aug 2010 | 5 Jun 2024 | 3 Aug 2026 |
| 649 | whiteheadsofboston.co.uk | LCN.COM Ltd. | 4 Apr 2008 | 20 Feb 2023 | 4 Apr 2032 |
| 650 | whitehead648.co.uk | - | 28 Mar 2016 | 25 Mar 2024 | 28 Mar 2025 |
| 651 | whitehead-family.co.uk | - | 2 Mar 2004 | 14 Feb 2025 | 2 Mar 2026 |
| 652 | whiteheadselection.co.uk | INTERNEXT | 14 Jun 2007 | 13 Jun 2017 | 14 Jun 2018 |
| 653 | whiteheadallen.co.uk | - | 5 Mar 2015 | 21 Jun 2024 | 5 Mar 2027 |
| 654 | whiteheadstimber.co.uk | - | 31 Dec 2020 | 2 Dec 2023 | 31 Dec 2024 |
| 655 | whiteheadclan.co.uk | - | 26 Dec 2011 | 18 Dec 2017 | 26 Dec 2019 |
| 656 | whiteheadwalkies.co.uk | - | 15 Jan 2014 | 18 Jun 2024 | 15 Jan 2026 |
| 657 | whiteheadsashby.co.uk | Hello Internet Corp. | 20 Nov 2017 | 24 Nov 2017 | 20 Nov 2019 |
| 658 | whiteheadssolicitors.co.uk | Reserved | 25 Jul 2006 | 2 May 2017 | 25 Jul 2018 |
| 659 | whiteheadplace.co.uk | - | 29 Apr 2014 | 25 May 2023 | 29 Apr 2024 |
| 660 | whiteheads.me.uk | - | 26 Aug 2009 | 25 Aug 2023 | 26 Aug 2025 |
| 661 | whiteheadcommercialinteriors.co.uk | - | 14 Dec 2016 | 13 Dec 2024 | 14 Dec 2025 |
| 662 | whiteheads1858.co.uk | - | 20 Jun 2005 | 21 Jun 2024 | 20 Jun 2025 |
| 663 | whiteheadfamily.org.uk | - | 5 Oct 2001 | 28 Jul 2024 | 5 Oct 2031 |
| 664 | whiteheadsdiy.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 11 Oct 2017 | 28 Nov 2017 | 11 Oct 2019 |
| 665 | whiteheadoilbuyingclub.co.uk | - | 21 Oct 2013 | 22 Oct 2024 | 21 Oct 2025 |
| 666 | whitehead-allen.co.uk | - | 14 Oct 2017 | 15 Sep 2024 | 14 Oct 2024 |
| 667 | whiteheadandwood.co.uk | - | 6 Feb 2015 | 10 Feb 2025 | 6 Feb 2026 |
| 668 | whiteheadsltd.co.uk | - | 29 Aug 2013 | 30 Jul 2017 | 29 Aug 2019 |
| 669 | whiteheadslettings.co.uk | Hello Internet Corp. | 6 Mar 2007 | 6 Mar 2017 | 6 Mar 2019 |
| 670 | whitehead-mann.co.uk | LCN.COM Ltd. | 11 Jan 2006 | 21 Dec 2017 | 11 Jan 2020 |
| 671 | whiteheadengineering.co.uk | - | 5 May 2004 | 4 Dec 2023 | 5 May 2024 |
| 672 | whiteheadsfabrics.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 28 Jul 2000 | 4 Aug 2016 | 28 Jul 2018 |
| 673 | whiteheadtraining.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 22 Jan 2017 | 26 Feb 2017 | 22 Jan 2019 |
| 674 | whiteheadcontracting.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 3 Aug 2012 | 28 Jul 2016 | 3 Aug 2018 |
| 675 | whiteheadelectrical.org.uk | - | 10 Mar 2015 | 10 Mar 2017 | 10 Mar 2018 |
| 676 | whiteheadandco.co.uk | - | 14 Feb 2002 | 16 Jan 2025 | 14 Feb 2026 |
| 677 | whitehead-home.co.uk | LCN.COM Ltd. | 17 Jan 2006 | 6 Jan 2016 | 17 Jan 2021 |
| 678 | whiteheadandday.co.uk | - | 31 Jul 2006 | 6 Jul 2023 | 31 Jul 2026 |
| 679 | whiteheadassociates.co.uk | - | 2 Mar 2010 | 27 Feb 2017 | 2 Mar 2018 |
| 680 | whiteheadshome.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 5 Dec 2007 | 28 Nov 2017 | 5 Dec 2019 |
| 681 | whiteheadsestates.co.uk | - | 29 Nov 2017 | 2 Jan 2025 | 29 Nov 2025 |
| 682 | whiteheadshomecare.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 27 Jan 2011 | 20 Jan 2017 | 27 Jan 2019 |
| 683 | whiteheadelectrical.co.uk | - | 8 Dec 1999 | 8 Nov 2024 | 8 Dec 2025 |
| 684 | whiteheadpipeworkeng.co.uk | Reserved | 16 Jun 2017 | 16 Jun 2017 | 16 Jun 2018 |
| 685 | whiteheadz.co.uk | - | 27 Jan 2023 | 26 Jan 2025 | 27 Jan 2026 |
| 686 | whitehead-moncktonbenefits.co.uk | - | 13 Nov 2014 | 9 Nov 2024 | 13 Nov 2025 |
| 687 | whiteheadroe.co.uk | - | 20 Apr 2010 | 21 Mar 2024 | 20 Apr 2025 |
| 688 | whiteheadracing.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 2 Jan 2010 | 26 Dec 2017 | 2 Jan 2020 |
| 689 | whiteheadjoinery.co.uk | - | 13 Mar 2014 | 12 Feb 2016 | 13 Mar 2018 |
| 690 | whitehead-roe.co.uk | - | 10 Apr 2013 | 12 Mar 2024 | 10 Apr 2025 |
| 691 | whiteheadlaw.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 6 Jun 2017 | 6 Jun 2017 | 6 Jun 2018 |
| 692 | whiteheadrecruitment.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 28 Jan 2015 | 5 Oct 2017 | 28 Jan 2019 |
| 693 | whiteheadandwolstenholme.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 25 Mar 2014 | 24 Mar 2016 | 25 Mar 2018 |
| 694 | whiteheadsletting.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 2 Apr 2013 | 26 Mar 2017 | 2 Apr 2019 |
| 695 | whitehead-ni.co.uk | LCN.COM Ltd. | 23 Jan 2002 | 20 Oct 2016 | 23 Jan 2018 |
| 696 | whitehead-welton.co.uk | - | 6 Sep 2013 | 5 Sep 2024 | 6 Sep 2025 |
| 697 | whiteheadsonline.co.uk | - | 24 Dec 2008 | 24 Nov 2024 | 24 Dec 2025 |
| 698 | whiteheadlandscapes.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 4 Jan 2017 | 30 Sep 2017 | 4 Jan 2019 |
| 699 | whiteheads.co.uk | LCN.COM Ltd. | 3 Apr 1998 | 28 Feb 2024 | 3 Apr 2027 |
| 700 | whiteheadsgroup.co.uk | - | 25 Feb 2025 | 25 Feb 2025 | 25 Feb 2026 |
| 701 | whiteheadslet.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 29 Jan 2013 | 22 Jan 2017 | 29 Jan 2019 |
| 702 | whiteheadfarming.uk | - | 24 Jul 2017 | 25 Jun 2024 | 24 Jul 2025 |
| 703 | whiteheadglass.co.uk | - | 14 Jan 2025 | 14 Jan 2025 | 14 Jan 2026 |
| 704 | whiteheadmail.co.uk | - | 23 Jan 2011 | 23 Jan 2025 | 23 Jan 2027 |
| 705 | whiteheadfarming.co.uk | - | 24 Jul 2017 | 25 Jun 2024 | 24 Jul 2025 |
| 706 | whiteheads.org.uk | - | 26 Aug 2010 | 27 Jul 2024 | 26 Aug 2025 |
| 707 | whiteheadcreative.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 19 Mar 2014 | 12 Mar 2016 | 19 Mar 2018 |
| 708 | whiteheadalloys.uk | - | 11 Jun 2014 | 15 Nov 2024 | 11 Jun 2026 |
| 709 | whiteheadsdevelopment.co.uk | The Registry at Info Avenue, LLC d/b/a Spirit Comm… | 30 Jun 2017 | 30 Jun 2017 | 30 Jun 2019 |
| 710 | whiteheadplanning-liskeard.co.uk | - | 19 Nov 2012 | 21 Oct 2024 | 19 Nov 2025 |
| 711 | whiteheaddiecast.net | Network Solutions, LLC | 4 Feb 2018 | 4 Feb 2018 | 4 Feb 2019 |
| 712 | whiteheadswg.com | Google, Inc. | 8 Feb 2018 | 24 Jan 2025 | 8 Feb 2026 |
| 713 | whiteheadsofsuttoncourtenay.uk | - | 8 Feb 2018 | 8 Feb 2018 | 8 Feb 2019 |
| 714 | whiteheadcardiology.com | DreamHost, LLC | 12 Feb 2018 | 11 Jan 2025 | 12 Feb 2026 |
| 715 | whiteheadross.co.uk | eNom, Inc. | 13 Feb 2018 | 13 Feb 2018 | 13 Feb 2019 |
| 716 | whiteheadsblueberryfarm.com | Google, Inc. | 14 Mar 2018 | 27 Feb 2025 | 14 Mar 2026 |
| 717 | whitehead-thomas.com | Launchpad, Inc. | 2 Apr 2018 | 18 Mar 2025 | 2 Apr 2026 |
| 718 | whiteheadtrainingsystem.com | Tucows Domains Inc. | 17 Apr 2018 | 26 Jun 2023 | 17 Apr 2032 |
| 719 | whiteheadenvironmentaltexas.com | GoDaddy.com, LLC | 11 Jun 2018 | 11 Jun 2018 | 11 Jun 2019 |
| 720 | whiteheadtexas.com | GoDaddy.com, LLC | 15 Jun 2018 | 16 Jun 2024 | 15 Jun 2025 |
| 721 | whiteheadenvironmentalsolutions.com | GoDaddy.com, LLC | 15 Jun 2018 | 15 Jun 2018 | 15 Jun 2019 |
| 722 | whitehead-strategies.com | eNom, Inc. | 18 Jun 2018 | 20 May 2024 | 18 Jun 2025 |
| 723 | whitehead-cpa.com | GoDaddy.com, LLC | 25 Jun 2018 | 11 Aug 2024 | 25 Jun 2025 |
| 724 | whiteheadbarrister.com | GoDaddy.com, LLC | 3 Jul 2018 | 3 Jul 2024 | 3 Jul 2026 |
| 725 | whiteheadlearninggroup.com | Google, Inc. | 3 Jul 2018 | 18 Jun 2024 | 3 Jul 2025 |
| 726 | whiteheadsautorepair.review | NameCheap, Inc. | 11 Jul 2018 | 11 Jul 2018 | 11 Jul 2019 |
| 727 | whitehead-dentalpractice.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 27 Jul 2018 | 27 Jul 2018 | 27 Jul 2019 |
| 728 | whiteheadpropertybuyers.com | NameCheap, Inc. | 3 Aug 2018 | 3 Aug 2018 | 3 Aug 2019 |
| 729 | whiteheadsrock.com | GoDaddy.com, LLC | 5 Aug 2018 | 5 Aug 2018 | 5 Aug 2019 |
| 730 | whiteheaddentalpractice.com | Namesilo, LLC | 5 Aug 2018 | 6 Aug 2018 | 5 Aug 2019 |
| 731 | whiteheadrealestategroup.com | GoDaddy.com, LLC | 27 Jun 2017 | 28 Jun 2024 | 27 Jun 2025 |
| 732 | whiteheadevan1.com | GoDaddy.com, LLC | 21 Aug 2018 | 21 Aug 2018 | 21 Aug 2019 |
| 733 | whiteheadsupremacy.com | GoDaddy.com, LLC | 5 Sep 2018 | 5 Sep 2018 | 5 Sep 2019 |
| 734 | whiteheadsolutions.com | GoDaddy.com, LLC | 13 Sep 2018 | 13 Sep 2024 | 13 Sep 2025 |
| 735 | whiteheaddentalcare.com | GoDaddy.com, LLC | 27 Sep 2018 | 27 Sep 2018 | 27 Sep 2020 |
| 736 | whiteheadpropierties.com | GoDaddy.com, LLC | 1 Oct 2018 | 12 Nov 2024 | 1 Oct 2024 |
| 737 | whiteheadoilcompany.com | GoDaddy.com, LLC | 1 Oct 2018 | 2 Oct 2024 | 1 Oct 2025 |
| 738 | whiteheadoil.com | GoDaddy.com, LLC | 1 Oct 2018 | 2 Oct 2023 | 1 Oct 2026 |
| 739 | whiteheadrm.com | Google, Inc. | 3 Oct 2018 | 18 Sep 2024 | 3 Oct 2025 |
| 740 | whiteheadallstate.com | eNom, Inc. | 4 Oct 2018 | 4 Oct 2018 | 4 Oct 2019 |
| 741 | whiteheadconsultants.com | Dynadot4 LLC | 6 Jul 2024 | 7 Jul 2024 | 6 Jul 2025 |
| 742 | whiteheadmudracing.com | DropCatch.com 582 LLC | 24 Feb 2024 | 25 Feb 2025 | 24 Feb 2025 |
| 743 | whiteheadma.com | GoDaddy.com, LLC | 20 Dec 2018 | 20 Dec 2018 | 20 Dec 2019 |
| 744 | whiteheadtravel.com | Gandi SAS | 26 Dec 2018 | 26 Dec 2018 | 26 Dec 2019 |
| 745 | whiteheadgaming.com | 1API GmbH | 9 Jan 2019 | 9 Jan 2019 | 9 Jan 2020 |
| 746 | whiteheadholidayapartment.com | NameCheap, Inc. | 31 Jan 2019 | 31 Jan 2019 | 31 Jan 2020 |
| 747 | whiteheadtravelagency.com | Tucows Domains Inc. | 12 Feb 2019 | 16 Feb 2020 | 12 Feb 2020 |
| 748 | whiteheadoverheads.com | GoDaddy.com, LLC | 22 Feb 2019 | 22 Feb 2019 | 22 Feb 2020 |
| 749 | whiteheadbusinessparks.com | GoDaddy.com, LLC | 26 Feb 2019 | 26 Feb 2019 | 26 Feb 2021 |
| 750 | whiteheadele.com | Cosmotown, Inc. | 29 Jul 2023 | 8 Sep 2024 | 29 Jul 2024 |
| 751 | whiteheadsstore.com | Tucows Domains Inc. | 7 Mar 2019 | 11 Mar 2020 | 7 Mar 2020 |
| 752 | whiteheadreforestation.com | GoDaddy.com, LLC | 10 Mar 2019 | 10 Mar 2019 | 10 Mar 2020 |
| 753 | whiteheadsworms.com | Network Solutions, LLC | 11 Mar 2019 | 11 Feb 2025 | 11 Mar 2027 |
| 754 | whiteheadandwhitehead.net | GoDaddy.com, LLC | 29 Jan 2019 | 7 Feb 2025 | 29 Jan 2026 |
| 755 | whiteheadsoftware.dev | NameCheap, Inc. | 18 Mar 2019 | 18 Mar 2025 | 18 Mar 2026 |
| 756 | whiteheadremovalmask.com | GoDaddy.com, LLC | 20 Mar 2019 | 20 Mar 2019 | 20 Mar 2020 |
| 757 | whiteheadbooks.com | FastDomain Inc. | 27 Mar 2019 | 30 Mar 2025 | 27 Mar 2027 |
| 758 | whiteheadandpoole.com | Dynadot, LLC | 29 Mar 2019 | 30 Mar 2019 | 29 Mar 2020 |
| 759 | whiteheaded.com | Tucows Domains Inc. | 1 Apr 2019 | 5 Apr 2020 | 1 Apr 2020 |
| 760 | whiteheadlawn.com | Network Solutions, LLC | 1 Apr 2019 | 1 Apr 2019 | 1 Apr 2021 |
| 761 | whiteheadfamilyofsoutheastkansas.com | GoDaddy.com, LLC | 5 Apr 2019 | 5 Apr 2019 | 5 Apr 2021 |
| 762 | whiteheadmackaymcneillprivatewealth.com | GoDaddy.com, LLC | 11 Apr 2019 | 12 Apr 2023 | 11 Apr 2025 |
| 763 | whiteheadstrategies.com | eNom, Inc. | 15 Apr 2019 | 17 Mar 2024 | 15 Apr 2025 |
| 764 | whiteheadtruckandtrailer.com | DROPCATCH.COM 844 LLC | 3 Jul 2021 | 3 Jul 2021 | 3 Jul 2022 |
| 765 | whiteheadstrategiesdevelopment.com | eNom, Inc. | 15 Apr 2019 | 17 Mar 2024 | 15 Apr 2025 |
| 766 | whitehead-energy.com | eNom, Inc. | 15 Apr 2019 | 17 Mar 2025 | 15 Apr 2026 |
| 767 | whiteheadsrhisgaafc.com | Network Solutions, LLC | 17 Apr 2019 | 17 Apr 2019 | 17 Apr 2020 |
| 768 | whiteheaddiscounttravel.com | GoDaddy.com, LLC | 23 Apr 2019 | 23 Apr 2019 | 23 Apr 2020 |
| 769 | whiteheaddiscountmall.com | GoDaddy.com, LLC | 23 Apr 2019 | 23 Apr 2019 | 23 Apr 2020 |
| 770 | whiteheadwinston2020.com | Wix.com Ltd. | 29 Apr 2019 | 1 May 2019 | 29 Apr 2020 |
| 771 | whiteheadluxurypropertymanagement.com | GoDaddy.com, LLC | 30 Apr 2019 | 30 Apr 2019 | 30 Apr 2021 |
| 772 | whiteheadres.com | GoDaddy.com, LLC | 2 May 2019 | 3 May 2023 | 2 May 2025 |
| 773 | whiteheadfamilyscholars.com | Launchpad, Inc. | 5 May 2019 | 5 May 2019 | 5 May 2020 |
| 774 | whiteheadtoolanddesign.com | GoDaddy.com, LLC | 6 May 2019 | 6 May 2019 | 6 May 2020 |
| 775 | whiteheadandcrump.com | Wild West Domains, LLC | 18 Jan 2024 | 19 Jan 2025 | 18 Jan 2026 |
| 776 | whiteheaddiet.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 777 | whiteheadslimpro.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 778 | whiteheadsheen.com | NameCheap, Inc. | 1 Aug 2023 | 12 Sep 2024 | 1 Aug 2024 |
| 779 | whiteheadslim.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 780 | whiteheadpumppro.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 781 | whiteheadpump.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 782 | whiteheadhairpro.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 783 | whiteheadsilk.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 784 | whiteheadstrength.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 785 | whiteheadstrengthpro.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 786 | whiteheadshine.com | NameCheap, Inc. | 13 May 2019 | 13 May 2019 | 13 May 2020 |
| 787 | whiteheadcontracting.com | GoDaddy.com, LLC | 17 May 2019 | 17 May 2019 | 17 May 2020 |
| 788 | whiteheadisland.com | GoDaddy.com, LLC | 17 May 2019 | 18 May 2023 | 17 May 2025 |
| 789 | whiteheadluxuryhomemanagement.com | GoDaddy.com, LLC | 22 May 2019 | 22 May 2019 | 22 May 2020 |
| 790 | whiteheadwaterservice.com | Tucows Domains Inc. | 23 May 2019 | 27 May 2024 | 23 May 2025 |
| 791 | whiteheadsbowls.com | GoDaddy.com, LLC | 12 Jun 2019 | 12 Jun 2019 | 12 Jun 2020 |
| 792 | whiteheadpartners.com | Namesilo, LLC | 25 Jun 2019 | 1 Jul 2024 | 25 Jun 2025 |
| 793 | whiteheadmediaentertainment.com | Wix.com Ltd. | 9 Jul 2019 | 13 Jul 2024 | 9 Jul 2025 |
| 794 | whiteheadhancock.com | GoDaddy.com, LLC | 29 Jul 2019 | 30 Jul 2024 | 29 Jul 2025 |
| 795 | whitehead-travel.com | Tucows Domains Inc. | 7 Aug 2019 | 11 Aug 2021 | 7 Aug 2021 |
| 796 | whiteheadssstrevel.com | Wild West Domains, LLC | 9 Aug 2019 | 9 Aug 2019 | 9 Aug 2021 |
| 797 | whiteheadconsultingofsc.com | Google, Inc. | 20 Aug 2019 | 5 Aug 2024 | 20 Aug 2025 |
| 798 | whiteheadevan.com | Tucows Domains Inc. | 27 Aug 2019 | 30 Aug 2020 | 27 Aug 2021 |
| 799 | whiteheadcharteredsurveyors.com | Netistrar Limited | 13 Sep 2019 | 13 Sep 2024 | 13 Sep 2025 |
| 800 | whiteheadresidential.com | DreamHost, LLC | 17 Sep 2019 | 17 Aug 2024 | 17 Sep 2025 |
| 801 | whiteheadcarpentry.com | CloudFlare, Inc. | 8 Jan 2022 | 18 Dec 2024 | 8 Jan 2026 |
| 802 | whiteheadmediagroup.com | GoDaddy.com, LLC | 13 Oct 2019 | 13 Oct 2019 | 13 Oct 2021 |
| 803 | whiteheadhassellwedding.com | eNom, Inc. | 13 Oct 2019 | 13 Oct 2019 | 13 Oct 2021 |
| 804 | whiteheadshare.com | GoDaddy.com, LLC | 16 Oct 2019 | 16 Oct 2019 | 16 Oct 2020 |
| 805 | whiteheadguns.com | Launchpad, Inc. | 11 Nov 2019 | 11 Nov 2019 | 11 Nov 2020 |
| 806 | whiteheadtec.com | TurnCommerce, Inc. DBA NameBright.com | 2 Feb 2022 | 14 Mar 2025 | 2 Feb 2025 |
| 807 | whiteheadtechnology.com | GoDaddy.com, LLC | 15 Nov 2019 | 15 Nov 2019 | 15 Nov 2021 |
| 808 | whiteheadsir.net | Google, Inc. | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 809 | whiteheadstorehouse.com | NameCheap, Inc. | 22 Nov 2019 | 31 Oct 2024 | 22 Nov 2025 |
| 810 | whiteheadh.net | Google, Inc. | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 811 | whiteheadherl.net | Google, Inc. | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 812 | whiteheadherl.com | Google, Inc. | 22 Nov 2019 | 22 Nov 2019 | 22 Nov 2020 |
| 813 | whiteheadinternationalwealth.com | GoDaddy.com, LLC | 2 Dec 2019 | 2 Dec 2019 | 2 Dec 2021 |
| 814 | whiteheadsecurity.com | NameCheap, Inc. | 3 Dec 2019 | - | 3 Dec 2022 |
| 815 | whiteheadhasselwedding.com | GoDaddy.com, LLC | 6 Dec 2019 | 6 Dec 2019 | 6 Dec 2020 |
| 816 | whiteheaddroneservices.com | Wix.com Ltd. | 12 Dec 2019 | 12 Nov 2024 | 12 Dec 2025 |
| 817 | whiteheadjewelry.com | GoDaddy.com, LLC | 30 Dec 2019 | 30 Dec 2019 | 30 Dec 2020 |
| 818 | whiteheadattorney.com | Squarespace Domains LLC | 4 Jan 2020 | 20 Dec 2024 | 4 Jan 2026 |
| 819 | whiteheadva.com | 1&1 Internet AG | 7 Jan 2020 | 7 Jan 2020 | 7 Jan 2021 |
| 820 | whiteheadfinancialgroupllc.com | GoDaddy.com, LLC | 7 Jan 2020 | 8 Jan 2025 | 7 Jan 2026 |
| 821 | whiteheadgroup.uk | - | 9 Jan 2020 | 9 Jan 2020 | 9 Jan 2021 |
| 822 | whiteheadautosalesinventory.com | GoDaddy.com, LLC | 13 Jan 2020 | 13 Jan 2020 | 13 Jan 2021 |
| 823 | whiteheadenvironmental.com | Tucows Domains Inc. | 12 Jan 2020 | 28 Dec 2024 | 12 Jan 2026 |
| 824 | whiteheadsalvage.com | Namesilo, LLC | 18 Jan 2020 | 19 Jan 2020 | 18 Jan 2021 |
| 825 | whiteheadnolesrealty.com | GoDaddy.com, LLC | 28 Jan 2020 | 29 Jan 2025 | 28 Jan 2026 |
| 826 | whiteheadjoinery.com | Google, Inc. | 3 Feb 2020 | 3 Feb 2020 | 3 Feb 2021 |
| 827 | whiteheadautocenter.com | Gandi SAS | 19 May 2022 | 18 Feb 2025 | 19 May 2025 |
| 828 | whiteheadpros.com | Google, Inc. | 9 Mar 2020 | 22 Feb 2025 | 9 Mar 2026 |
| 829 | whiteheadpropertysolutions.com | Google, Inc. | 12 Mar 2020 | 25 Feb 2025 | 12 Mar 2026 |
| 830 | whiteheaddevelopments.com | Melbourne IT, Ltd | 23 Mar 2020 | 23 Mar 2020 | 23 Mar 2021 |
| 831 | whiteheadmelissa.com | FastDomain Inc. | 28 Mar 2020 | 28 Mar 2020 | 28 Mar 2021 |
| 832 | whiteheadadvisory.com | GoDaddy.com, LLC | 12 Apr 2020 | 14 Apr 2024 | 12 Apr 2026 |
| 833 | whiteheadenterprisesllc.com | GoDaddy.com, LLC | 12 Apr 2020 | 24 Jun 2023 | 12 Apr 2023 |
| 834 | whiteheadsubventralamirate.com | Dynadot, LLC | 19 Apr 2020 | 19 Apr 2020 | 19 Apr 2021 |
| 835 | whitehead-partnership.com | GoDaddy.com, LLC | 18 Apr 2020 | 19 Apr 2024 | 18 Apr 2026 |
| 836 | whitehead-holmes.com | CloudFlare, Inc. | 2 May 2020 | 20 Jan 2025 | 2 May 2026 |
| 837 | whiteheadremodeling.com | Google, Inc. | 16 Mar 2024 | 1 Mar 2025 | 16 Mar 2026 |
| 838 | whiteheadvending.com | Dynadot, LLC | 7 May 2020 | 7 May 2020 | 7 May 2021 |
| 839 | whiteheadhomesnw.com | GoDaddy.com, LLC | 8 May 2020 | 15 Jan 2024 | 8 May 2024 |
| 840 | whiteheadscottdirect.com | GoDaddy.com, LLC | 12 May 2020 | 12 May 2020 | 12 May 2021 |
| 841 | whitehead-family.ca | - | 16 Mar 2012 | 16 Mar 2022 | 16 Mar 2027 |
| 842 | whiteheadul.com | Namesilo, LLC | 17 May 2020 | 18 May 2020 | 17 May 2021 |
| 843 | whiteheadproperties.net | GoDaddy.com, LLC | 31 Jan 2019 | 31 Jan 2019 | 31 Jan 2021 |
| 844 | whiteheadele.net | GoDaddy.com, LLC | 11 May 2018 | 23 Jul 2023 | 11 May 2023 |
| 845 | whiteheadorthodontics.net | GoDaddy.com, LLC | 27 Jul 2017 | 28 Jul 2019 | 27 Jul 2020 |
| 846 | whitehead-uk.net | One.com A/S | 6 Mar 2005 | 4 Feb 2025 | 6 Mar 2026 |
| 847 | whiteheadsnursery.com | Google, Inc. | 8 Jun 2020 | 24 May 2024 | 8 Jun 2025 |
| 848 | whiteheadfactory.com | GoDaddy.com, LLC | 29 Jun 2020 | 29 Jun 2020 | 29 Jun 2021 |
| 849 | whiteheadtorpedofactorymuseum.com | GoDaddy.com, LLC | 29 Jun 2020 | 29 Jun 2020 | 29 Jun 2021 |
| 850 | whiteheadrentals.com | GoDaddy.com, LLC | 17 Jul 2020 | 28 Aug 2024 | 17 Jul 2024 |
| 851 | whiteheadedmaid.com | GoDaddy.com, LLC | 8 Aug 2020 | 8 Aug 2020 | 8 Aug 2021 |
| 852 | whiteheadlee.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 14 Aug 2020 | 24 Aug 2023 | 14 Aug 2025 |
| 853 | whiteheadcompany.com | GoDaddy.com, LLC | 20 Aug 2020 | 21 Aug 2024 | 20 Aug 2025 |
| 854 | whiteheaddiscs.com | GoDaddy.com, LLC | 27 Aug 2020 | 27 Aug 2020 | 27 Aug 2021 |
| 855 | whiteheaddds.com | GoDaddy.com, LLC | 1 Feb 2018 | 10 Nov 2022 | 8 Oct 2026 |
| 856 | whiteheadbeckettfinancial.com | GoDaddy.com, LLC | 17 Sep 2020 | 29 Nov 2024 | 17 Sep 2024 |
| 857 | whiteheadreunion.com | GoDaddy.com, LLC | 20 Sep 2020 | 14 Jan 2025 | 20 Sep 2025 |
| 858 | whiteheadmigration.com | GoDaddy.com, LLC | 1 Nov 2020 | 1 Nov 2024 | 1 Nov 2026 |
| 859 | whiteheadselfcare.com | Google, Inc. | 18 Nov 2020 | 3 Nov 2024 | 18 Nov 2025 |
| 860 | whiteheadset.com | GoDaddy.com, LLC | 30 Nov 2020 | 30 Nov 2020 | 30 Nov 2021 |
| 861 | whiteheadent.com | TurnCommerce, Inc. DBA NameBright.com | 23 Feb 2022 | 17 Feb 2023 | 23 Feb 2024 |
| 862 | whiteheadremoval.com | GoDaddy.com, LLC | 8 Dec 2020 | 8 Dec 2020 | 8 Dec 2021 |
| 863 | whiteheadq.site | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 9 Dec 2020 | 9 Dec 2020 | 9 Dec 2021 |
| 864 | whiteheadengineering.site | Network Solutions, LLC | 27 Mar 2020 | 28 Mar 2023 | 27 Mar 2024 |
| 865 | whiteheadq.space | Alibaba Cloud Computing Ltd. d/b/a HiChina (www.ne… | 28 Dec 2020 | 29 Dec 2020 | 28 Dec 2021 |
| 866 | whiteheadandcoevents.com | Google, Inc. | 1 Jan 2021 | 17 Dec 2024 | 1 Jan 2026 |
| 867 | whiteheadmd.com | GoDaddy.com, LLC | 11 Jan 2021 | 12 Jan 2025 | 11 Jan 2026 |
| 868 | whiteheadmusic.com | Namesilo, LLC | 13 Jan 2021 | 14 Jan 2021 | 13 Jan 2022 |
| 869 | whitehead-refuse.com | GMO Internet Inc. | 20 Jan 2021 | 21 Jan 2021 | 20 Jan 2022 |
| 870 | whiteheadkidsoutside.co.uk | LCN.COM Ltd. | 23 Jan 2021 | 23 Jan 2022 | 23 Jan 2023 |
| 871 | whiteheadsnotes.com | OVH sas | 27 Jan 2021 | 27 Jan 2021 | 27 Jan 2022 |
| 872 | whiteheadestate.com | - | 22 Apr 2022 | 23 Apr 2023 | 22 Apr 2024 |
| 873 | whiteheaddirect.com | GoDaddy.com, LLC | 7 Feb 2021 | 7 Feb 2025 | 7 Feb 2027 |
| 874 | whiteheadland.com | Google, Inc. | 10 Feb 2021 | 26 Jan 2025 | 10 Feb 2026 |
| 875 | whiteheadrailwaymuseum.online | eNom, Inc. | 1 Mar 2021 | 1 Mar 2021 | 1 Mar 2022 |
| 876 | whiteheadorganicfruitsbiz.xyz | Crazy Domains FZ-LLC | 5 Mar 2021 | - | 5 Mar 2022 |
| 877 | whiteheadc.com | HiChina Zhicheng Technology Limited | 22 Mar 2021 | 22 Mar 2021 | 22 Mar 2022 |
| 878 | whiteheadadventure.com | LiquidNet Ltd. | 23 Mar 2021 | 24 Mar 2023 | 23 Mar 2023 |
| 879 | whiteheadkeyboards.com | 1&1 Internet AG | 29 Mar 2021 | 29 Mar 2021 | 29 Mar 2025 |
| 880 | whiteheadchiropracticexercises.online | Tucows Domains Inc. | 27 Mar 2020 | 31 Mar 2021 | 27 Mar 2022 |
| 881 | whiteheadchiropractic.store | Tucows Domains Inc. | 30 Mar 2020 | 3 Apr 2021 | 30 Mar 2022 |
| 882 | whiteheadmanagem.com | Internet Domain Services BS Corp | 2 Apr 2021 | 2 Apr 2021 | 2 Apr 2022 |
| 883 | whiteheadforbk.com | Dynadot, LLC | 9 Jun 2022 | 19 May 2024 | 9 Jun 2025 |
| 884 | whiteheadworms.com | Domain Jamboree, LLC | 8 Apr 2021 | 23 May 2023 | 8 Apr 2023 |
| 885 | whiteheadssportsandsocialclub.com | Tucows Domains Inc. | 15 Apr 2020 | 19 Apr 2021 | 15 Apr 2021 |
| 886 | whitehead-ab.icu | 1&1 Internet AG | 2 May 2021 | 30 Jul 2024 | 2 May 2025 |
| 887 | whiteheadformayor.com | GoDaddy.com, LLC | 2 May 2021 | 2 May 2021 | 2 May 2022 |
| 888 | whiteheadstudio.com | Squarespace Domains LLC | 8 May 2021 | 23 Apr 2024 | 8 May 2025 |
| 889 | whiteheadssmokeshop.com | Tucows Domains Inc. | 27 May 2021 | 27 May 2021 | 27 May 2022 |
| 890 | whiteheadcorder.com | GoDaddy.com, LLC | 9 Jun 2021 | 9 Jun 2021 | 9 Jun 2022 |
| 891 | whiteheadremover.com | - | 20 Aug 2022 | 12 Sep 2024 | 20 Aug 2025 |
| 892 | whiteheadplumbingpc.com | GoDaddy.com, LLC | 1 Jul 2021 | 2 Jul 2024 | 1 Jul 2025 |
| 893 | whiteheaddesign.xyz | CloudFlare, Inc. | 22 Jul 2021 | 31 Aug 2023 | 22 Jul 2026 |
| 894 | whiteheadelectric.site | Network Solutions, LLC | 29 Jul 2021 | 29 Jul 2021 | 29 Jul 2022 |
| 895 | whiteheadhiuu1.asia | GMO Internet Inc. | 12 Aug 2021 | - | 12 Aug 2022 |
| 896 | whiteheadhiuu1.site | GMO Internet Inc. | 12 Aug 2021 | - | 12 Aug 2022 |
| 897 | whiteheadhiuu1.space | GMO Internet Inc. | 12 Aug 2021 | - | 12 Aug 2022 |
| 898 | whiteheadhiuu1.club | GMO Internet Inc. | 12 Aug 2021 | - | 12 Aug 2022 |
| 899 | whiteheadbrosinc.com | Tucows Domains Inc. | 2 Nov 2024 | 2 Nov 2024 | 2 Nov 2025 |
| 900 | whiteheadmarine.online | Crazy Domains FZ-LLC | 9 Sep 2021 | 9 Sep 2021 | 9 Sep 2022 |
| 901 | whiteheadmarine.com | Crazy Domains FZ-LLC | 9 Sep 2021 | 9 Sep 2021 | 9 Sep 2022 |
| 902 | whiteheadcrowther.com | GoDaddy.com, LLC | 10 Sep 2021 | 21 Oct 2024 | 10 Sep 2024 |
| 903 | whiteheadhomefinder.info | Google, Inc. | 28 Sep 2021 | 19 Sep 2024 | 28 Sep 2025 |
| 904 | whiteheadhomevalue.info | Google, Inc. | 28 Sep 2021 | 19 Sep 2024 | 28 Sep 2025 |
| 905 | whiteheadelectricga.com | register.com, Inc. | 27 Sep 2021 | 27 Sep 2021 | 27 Sep 2022 |
| 906 | whiteheadwalkies.com | Automattic Inc. | 28 Sep 2021 | 8 Sep 2024 | 28 Sep 2025 |
| 907 | whiteheadstrings.com | register.com, Inc. | 12 Oct 2021 | 24 Nov 2024 | 12 Oct 2024 |
| 908 | whiteheadandwallace.com | Google, Inc. | 19 Oct 2021 | 5 Oct 2024 | 19 Oct 2025 |
| 909 | whitehead-farms.com | Automattic Inc. | 22 Oct 2021 | 28 Jan 2025 | 22 Oct 2025 |
| 910 | whiteheadromeovbipm.com | Wild West Domains, LLC | 24 Oct 2021 | 24 Oct 2021 | 24 Oct 2022 |
| 911 | whiteheadian.com | Porkbun, LLC | 29 Oct 2021 | 23 Oct 2024 | 29 Oct 2025 |
| 912 | whiteheadrealtyutah.com | GoDaddy.com, LLC | 9 Nov 2021 | 21 Dec 2023 | 9 Nov 2023 |
| 913 | whiteheadelec.com | register.com, Inc. | 10 Nov 2021 | 11 Nov 2024 | 10 Nov 2025 |
| 914 | whitehead-umlauf.com | GMO Internet Inc. | 16 Nov 2021 | 17 Nov 2021 | 16 Nov 2022 |
| 915 | whiteheadbaby.com | GoDaddy.com, LLC | 19 Nov 2021 | 20 Nov 2024 | 19 Nov 2025 |
| 916 | whiteheades.online | GMO Internet Inc. | 23 Nov 2021 | 24 Nov 2021 | 23 Nov 2022 |
| 917 | whiteheadface.com | GoDaddy.com, LLC | 25 Nov 2021 | 25 Nov 2021 | 25 Nov 2022 |
| 918 | whiteheadtranslogistics.com | Google, Inc. | 28 Nov 2021 | 28 Nov 2021 | 28 Nov 2022 |
| 919 | whiteheadbrethers.com | NameCheap, Inc. | 14 Dec 2021 | - | 14 Dec 2022 |
| 920 | whiteheadleemeta.com | Google, Inc. | 17 Dec 2021 | 17 Dec 2021 | 17 Dec 2022 |
| 921 | whiteheadvelten.com | GoDaddy.com, LLC | 23 Dec 2021 | 23 Dec 2021 | 23 Dec 2022 |
| 922 | whiteheadscribes.com | Google, Inc. | 25 Dec 2021 | 10 Dec 2024 | 25 Dec 2025 |
| 923 | whiteheadtest.com | Google, Inc. | 3 Jan 2022 | 3 Jan 2022 | 3 Jan 2023 |
| 924 | whiteheadswarehouse.com | GoDaddy.com, LLC | 8 Jan 2022 | 19 Feb 2024 | 8 Jan 2024 |
| 925 | whiteheadfacelift.com | GoDaddy.com, LLC | 11 Jan 2022 | 11 Jan 2022 | 11 Jan 2023 |
| 926 | whiteheadfacialplastics.com | GoDaddy.com, LLC | 11 Jan 2022 | 11 Jan 2022 | 11 Jan 2023 |
| 927 | whiteheadandbooth.com | Squarespace Domains LLC | 18 Jan 2022 | 1 Apr 2025 | 18 Jan 2025 |
| 928 | whiteheadhawk.com | NameCheap, Inc. | 24 Jan 2022 | - | 24 Jan 2023 |
| 929 | whiteheadinsutrialltd.com | NameCheap, Inc. | 28 Jan 2022 | - | 28 Jan 2023 |
| 930 | whitehead-adventures.com | Automattic Inc. | 13 Feb 2022 | 13 Feb 2022 | 13 Feb 2023 |
| 931 | whiteheadtrip.com | Automattic Inc. | 13 Feb 2022 | 13 Feb 2022 | 13 Feb 2023 |
| 932 | whiteheads.store | GoDaddy.com, LLC | 22 Feb 2022 | 5 Apr 2023 | 22 Feb 2023 |
| 933 | whiteheads-ark.com | PDR Ltd. d/b/a PublicDomainRegistry.com | 23 Feb 2022 | 23 Feb 2025 | 23 Feb 2025 |
| 934 | whiteheadsconstruction.biz | PDR Ltd. d/b/a PublicDomainRegistry.com | 24 Mar 2022 | 24 Mar 2023 | 24 Mar 2023 |
| 935 | whiteheadmillwork.com | Google, Inc. | 4 Apr 2022 | 1 Jun 2024 | 4 Apr 2025 |
| 936 | whiteheadfinancialholdings.com | GoDaddy.com, LLC | 7 Apr 2022 | 19 May 2023 | 7 Apr 2023 |
| 937 | whiteheadadvisors.com | DropCatch.com 1236 LLC | 14 Jun 2024 | 15 Jun 2024 | 14 Jun 2025 |
| 938 | whiteheadfamilyfoundation.com | Automattic Inc. | 15 Apr 2022 | 6 Oct 2023 | 15 Apr 2025 |
| 939 | whiteheadspwp.com | Google, Inc. | 18 Apr 2022 | 17 Apr 2023 | 18 Apr 2023 |
| 940 | whiteheadlogistics.com | Google, Inc. | 25 Apr 2022 | 4 Jun 2024 | 25 Apr 2025 |
| 941 | whiteheadplumbingandheating.com | - | 22 Jul 2024 | 18 Mar 2025 | 22 Jul 2025 |
| 942 | whiteheadecllc.com | Google, Inc. | 9 May 2022 | 5 Jun 2024 | 9 May 2025 |
| 943 | whiteheadelectricalsystems.com | Porkbun, LLC | 16 May 2022 | 15 May 2024 | 16 May 2025 |
| 944 | whiteheadlegalservices.com | Key-Systems GmbH | 18 May 2022 | 18 May 2022 | 18 May 2024 |
| 945 | whiteheadfilms.com | Google, Inc. | 20 May 2022 | 1 Jul 2024 | 20 May 2025 |
| 946 | whiteheadroofing.com | FastDomain Inc. | 2 Jun 2022 | 19 Jun 2024 | 2 Jun 2025 |
| 947 | whiteheadhd.tv | eNom, Inc. | 13 Apr 2011 | 13 Apr 2024 | 13 Apr 2025 |
| 948 | whiteheads.online | PDR Ltd. d/b/a PublicDomainRegistry.com | 8 Jun 2022 | 28 Jul 2022 | 8 Jun 2024 |
| 949 | whiteheadpropertyinvestments.com | GoDaddy.com, LLC | 10 Jun 2022 | 22 Aug 2023 | 10 Jun 2023 |
| 950 | whiteheadlawpllc.com | GoDaddy.com, LLC | 22 Jun 2021 | 24 Jun 2023 | 22 Jun 2025 |
| 951 | whitehead-itconsulting.com | GoDaddy.com, LLC | 19 Jul 2022 | 30 Aug 2023 | 19 Jul 2023 |
| 952 | whiteheadgas.co.uk | - | 21 Oct 2020 | 4 Sep 2024 | 21 Oct 2025 |
| 953 | whiteheadarcondicionado.com | Google, Inc. | 27 Jul 2022 | 28 Jul 2023 | 27 Jul 2024 |
| 954 | whiteheadinvestigations.online | GoDaddy.com, LLC | 31 Jul 2022 | 31 Jul 2022 | 31 Jul 2023 |
| 955 | whiteheaddiecast.site | Network Solutions, LLC | 3 Aug 2022 | 15 Sep 2023 | 3 Aug 2023 |
| 956 | whiteheadcons.com | Google, Inc. | 8 Aug 2022 | 8 Aug 2023 | 8 Aug 2024 |
| 957 | whitehead-cade.com | GMO Internet Inc. | 9 Aug 2022 | 20 Sep 2023 | 9 Aug 2023 |
| 958 | whiteheadeducation.com | Google, Inc. | 28 Aug 2022 | 27 Aug 2024 | 28 Aug 2025 |
| 959 | whiteheadpracticaleducation.com | Google, Inc. | 28 Aug 2022 | 27 Aug 2024 | 28 Aug 2025 |
| 960 | whiteheadweddings.com | Wix.com Ltd. | 14 Feb 2022 | 23 Jun 2024 | 14 Feb 2027 |
| 961 | whiteheadrenovations.net | GoDaddy.com, LLC | 2 Sep 2022 | 14 Nov 2023 | 2 Sep 2023 |
| 962 | whiteheadrenovations.com | GoDaddy.com, LLC | 2 Sep 2022 | 14 Nov 2023 | 2 Sep 2023 |
| 963 | whiteheadoutdoor.com | Google, Inc. | 30 Sep 2022 | 15 Oct 2023 | 30 Sep 2024 |
| 964 | whitehead19.com.au | - | - | 28 Jan 2025 | - |
| 965 | whiteheadinvest.com | GoDaddy.com, LLC | 5 Oct 2022 | 6 Oct 2024 | 5 Oct 2026 |
| 966 | whiteheadinvestgroup.com | GoDaddy.com, LLC | 5 Oct 2022 | 6 Oct 2024 | 5 Oct 2026 |
| 967 | whiteheadlawoffice.com | GoDaddy.com, LLC | 12 Oct 2022 | 23 Oct 2024 | 12 Oct 2025 |
| 968 | whiteheadlawoffices.com | GoDaddy.com, LLC | 12 Oct 2022 | 23 Oct 2024 | 12 Oct 2025 |
| 969 | whiteheadtransportation.com | GoDaddy.com, LLC | 24 Oct 2022 | 5 Dec 2024 | 24 Oct 2024 |
| 970 | whiteheadcrowther.net | Google, Inc. | 10 Nov 2022 | 11 Nov 2023 | 10 Nov 2024 |
| 971 | whiteheadrosseducation.com | Promo People inc. | 14 Nov 2022 | 7 Nov 2024 | 14 Nov 2026 |
| 972 | whiteheadoilbenefits.com | GoDaddy.com, LLC | 15 Nov 2022 | 16 Nov 2024 | 15 Nov 2025 |
| 973 | whitehead-sofie.com | GMO Internet Inc. | 16 Nov 2022 | 28 Dec 2023 | 16 Nov 2023 |
| 974 | whiteheadoilbenefit.com | Dynadot, LLC | 16 Nov 2022 | 26 Jan 2024 | 16 Nov 2023 |
| 975 | whiteheadoilbenfits.com | Dynadot, LLC | 16 Nov 2022 | 26 Jan 2024 | 16 Nov 2023 |
| 976 | whiteheadoilbenifits.com | - | 16 Nov 2022 | 28 Oct 2023 | 16 Nov 2025 |
| 977 | whiteheadoibenefits.com | Cloud Yuqu LLC | 16 Nov 2022 | 29 Dec 2023 | 16 Nov 2023 |
| 978 | whiteheadferris.com | Google, Inc. | 25 Nov 2022 | 10 Nov 2024 | 25 Nov 2025 |
| 979 | whiteheadheatingandac.com | Namesilo, LLC | 16 Dec 2022 | 16 Feb 2025 | 16 Dec 2024 |
| 980 | whiteheadadventureafrica.com | LiquidNet Ltd. | 16 Dec 2022 | 3 Aug 2024 | 16 Dec 2025 |
| 981 | whiteheadmanagement.co.uk | - | 16 Dec 2022 | 16 Dec 2022 | 16 Dec 2024 |
| 982 | whiteheadeagles.co.uk | - | 2 Jan 2023 | 15 May 2023 | 2 Jan 2024 |
| 983 | whiteheadpropertymanagement.com | Squarespace Domains LLC | 6 Jan 2023 | 22 Dec 2024 | 6 Jan 2026 |
| 984 | whiteheadandporter.com | Domain.com, LLC | 10 Jan 2023 | 26 Dec 2024 | 10 Jan 2026 |
| 985 | whiteheadrober.art | NameCheap, Inc. | 16 Jan 2023 | 28 Mar 2024 | 16 Jan 2024 |
| 986 | whiteheadstaal.africa | Domain Name Services (Pty) Ltd | 2 Jun 2022 | 12 Jun 2023 | 2 Jun 2023 |
| 987 | whiteheaddevelopment.biz | GoDaddy.com, LLC | 21 Jan 2023 | 26 Jan 2025 | 21 Jan 2027 |
| 988 | whiteheaddevelopment.info | GoDaddy.com, LLC | 21 Jan 2023 | 7 Mar 2025 | 21 Jan 2027 |
| 989 | whiteheaddevelopment.mobi | GoDaddy.com, LLC | 21 Jan 2023 | 7 Mar 2025 | 21 Jan 2027 |
| 990 | whiteheaddevelopment.org | GoDaddy.com, LLC | 21 Jan 2023 | 7 Mar 2025 | 21 Jan 2027 |
| 991 | whiteheaddevelopment.com | GoDaddy.com, LLC | 21 Jan 2023 | 21 Jan 2025 | 21 Jan 2027 |
| 992 | whiteheaddevelopment.net | GoDaddy.com, LLC | 21 Jan 2023 | 21 Jan 2025 | 21 Jan 2027 |
| 993 | whitehead-hancock.net | GoDaddy.com, LLC | 24 Jan 2023 | 25 Jan 2025 | 24 Jan 2026 |
| 994 | whiteheadhancock.net | GoDaddy.com, LLC | 24 Jan 2023 | 25 Jan 2025 | 24 Jan 2026 |
| 995 | whiteheads.com.hr | - | 18 Jan 2018 | 17 Jan 2019 | 18 Jan 2026 |
| 996 | whiteheadfoundation.ca | - | 28 Nov 2008 | 3 Jul 2024 | 28 Nov 2025 |
| 997 | whiteheads.au | - | - | 27 Jan 2025 | - |
| 998 | whiteheadcreations.com | Squarespace Domains LLC | 1 Feb 2023 | 2 Mar 2024 | 1 Feb 2024 |
| 999 | whiteheadmovers.com | Google, Inc. | 7 Feb 2023 | 23 Jan 2025 | 7 Feb 2026 |
| 1000 | whiteheadservices.com | GoDaddy.com, LLC | 8 Feb 2023 | 9 Feb 2025 | 8 Feb 2027 |
Displaying 1,000 out of 1,207 domains starting with the keyword "WHITEHEAD". To see all the results, kindly use our Reverse WHOIS API.
Reverse Whois API
You can fetch the above results using our Reverse Whois API.
https://api.whoxy.com/?key=xxxxx&reverse=whois&keyword=whitehead
Reverse Whois API lets you perform a comprehensive search on our database, to find domains owned by a company or person.
You just need to enter search terms such as the name, email or company, and you can find all the domains they ever owned.
If your search returns no results, you will NOT be charged any API queries. You are charged only on successful queries.
Sample Output: JSON Schema • XML Schema • JSON Live Results • XML Live Results
| Reverse Whois Pricing | Total API Calls | Price | CPM | Purchase |
|---|---|---|---|---|
| 200 Reverse Whois API Queries | 200 | $2 | $10.00 | Order Now |
| 1,000 Reverse Whois API Queries | 1,000 | $10 | $10.00 | Order Now |
| 10,000 Reverse Whois API Queries | 10,000 | $100 | $10.00 | Order Now |
| 50,000 Reverse Whois API Queries | 50,000 | $400 | $8.00 | Order Now |
| 250,000 Reverse Whois API Queries | 250,000 | $1,500 | $6.00 | Order Now |
| 1 Million Reverse Whois API Queries | 1,000,000 | $4,000 | $4.00 | Order Now |
| 5 Million Reverse Whois API Queries | 5,000,000 | $10,000 | $2.00 | Order Now |